Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
04-27-26 City Council agenda and packet
A.5:30 P.M. - WORK SESSION Note: Unless otherwise noted, work sessions are held in the Training Room on the main level of City Hall and are open to the public. If the City Council does not complete the work session items in the time allotted, the remaining items will be considered after the regular agenda. Public comment is not allowed at the work session. A.1 Fire Department Space Needs Assessment Follow Up A.2 Permitted Burning Discussion A.3 2026 Park Renovation Fund Allocation Discussion A.4 Future Work Session Schedule B.7:00 P.M. - CALL TO ORDER (Pledge of Allegiance) C.PUBLIC ANNOUNCEMENTS C.1 Proclamation Designating April 28th, 2026 as Mary Blazanin Day D.CONSENT AGENDA All items listed under the Consent Agenda are considered to be routine by the city council and will be considered as one motion. There will be no separate discussion of these items. If discussion is desired, that item will be removed from the Consent Agenda and considered separately. City council action is based on the staff recommendation for each item. Refer to the council packet for each staff report. D.1 Approve City Council Meeting Minutes dated April 13, 2026 D.2 Approve City Council Work Session Meeting Minutes dated April 13, 2026 D.3 Receive Environmental Commission Minutes dated March 11, 2026 D.4 Receive Planning Commission Minutes dated April 7, 2026 AGENDA CHANHASSEN CITY COUNCIL MONDAY, APRIL 27, 2026 CITY COUNCIL CHAMBERS, 7700 MARKET BOULEVARD 1 D.5 Receive Economic Development Commission Minutes dated March 10, 2026 D.6 Approve Claims Paid dated April 27, 2026 D.7 Approve a Conditional Use Permit for a Contractor's Yard located at 1480 Park Road D.8 Award Design Contract for Rehabilitation of Wells 7 and 13 D.9 Accept Bids and Award Contract for the 2026 Sealcoat Project D.10 Approve 2026 Sanitary and Storm Sewer Televising and Cleaning Contract D.11 Approve Temporary On-Sale Liquor License, July 2, 3 & 4, 2026, Rotary Club of Chanhassen D.12 Approve 2026 Chanhassen Farmers' Market Agreement D.13 Award Chanhassen Community Center Bid Package #1a: Steel Supply & Install D.14 Resolution 2026-XX: Approve Construction Materials Testing Agreement for the 2026 City Pavement Rehabilitation Project No. 26-01 D.15 Resolution 2026-XX: Approve Construction Materials Testing Agreement for the Market Boulevard Rehabilitation Project No. 25-02 D.16 Resolution 2026-XX: Approve Construction Materials Testing Agreement for the 2026 Great Plains Blvd/Lake Drive East Rehabilitation Project No. 26-02 D.17 Resolution 2026-XX: Accepting a $2,561.31 Donation from the Chanhassen Athletic Association for Lake Ann Park Ballfield 1, 4, and 5 Irrigation Improvements D.18 Resolution 2026-XX: Authorize Contract for Engineering Design and Construction Services for the 2027 City Pavement Rehabilitation Project (27-01) D.19 Resolution 2026-XX: Authorize Contract for Engineering Design and Construction Services for the 2027 Lake Riley Blvd Reconstruction Project (27-02) D.20 Resolution 2026-XX: Authorize Submission for Carver County Community Development Agency Community Growth Partnership Initiative (CGPI) Redevelopment Assistance Grant Application E.VISITOR PRESENTATIONS Visitor Presentations requesting a response or action from the City Council must complete and submit the Citizen Action Request Form (see VISITOR GUIDELINES at the end of this agenda). F.FIRE DEPARTMENT/LAW ENFORCEMENT UPDATE F.1 2026 Quarter One Fire Department Update G.PUBLIC HEARINGS G.1 Resolution 2026-XX: Accept the Bids and Award the Contract for the 2026 City Pavement 2 Rehabilitation Project; and Resolution 2026-XX: Adopt Final Assessment Roll for the 2026 City Pavement Rehabilitation Project G.2 Resolution 2026-XX: 7480 Frontier Trail - Easement Acquisition Agreement and Vacation G.3 Resolution 2026:XX and Ordinance XXX: Consider a Metes & Bounds Subdivision and Rezoning from Rural Residential to Single-Family Residential for the property located at 6651 Galpin Boulevard H.GENERAL BUSINESS H.1 Approve Facility Management Agreement for the Chanhassen Community Center with Sports Facilities Companies I.COUNCIL PRESENTATIONS I.1 Report on City Manager's Annual Performance Review J.ADMINISTRATIVE PRESENTATIONS J.1 First Quarter 2026 Communications Update K.CORRESPONDENCE DISCUSSION K.1 Letter to the Metropolitan Council regarding Comprehensive Plan Amendment Policy K.2 Follow-Up: Chanhassen Citizen Action Request L.ADJOURNMENT GUIDELINES FOR VISITOR PRESENTATIONS Welcome to the Chanhassen City Council Meeting. In the interest of open communications, the Chanhassen City Council wishes to provide an opportunity for the public to address the City Council. That opportunity is provided at every regular City Council meeting during Visitor Presentations. Anyone seeking a response or action from the City Council following their presentation is required to complete and submit a Citizen Action Request Form. An online form is available at https://www.chanhassenmn.gov/action or paper forms are available in the city council chambers prior to the meeting. A total of thirty minutes is alloted for Visitor Presentations. Priority is given to Chanhassen residents. An additional thirty minutes may be provided after General Business items are complete at the discretion of the City Council. Anyone indicating a desire to speak during Visitor Presentations will be acknowledged by the Mayor. When called upon to speak, state your name, address, and topic. All remarks shall be addressed to the City Council as a whole, not to any specific member(s) or to any person who is not a member of the City Council. If there are a number of individuals present to speak on the same topic, please designate a spokesperson that can summarize the issue. 3 Limit your comments to five minutes. Additional time may be granted at the discretion of the Mayor. If you have written comments, provide a copy to the Council. Comments may also be emailed to the City Council at council@chanhassenmn.gov. During Visitor Presentations, the Council and staff listen to comments and will not engage in discussion. Council members or the City Manager may ask questions of you in order to gain a thorough understanding of your concern, suggestion or request. Please be aware that disrespectful comments or comments of a personal nature, directed at an individual either by name or inference, will not be allowed. Personnel concerns should be directed to the City Manager. Members of the City Council and some staff members may gather at Tequila Butcher, 590 West 79th Street in Chanhassen immediately after the meeting for a purely social event. All members of the public are welcome. 4 City Council Item April 27, 2026 Item Fire Department Space Needs Assessment Follow Up File No.Item No: A.1 Agenda Section 5:30 P.M. - WORK SESSION Prepared By Andrew Heger, Fire Chief Reviewed By SUGGESTED ACTION Provide staff with a preferred direction regarding the pursuit and funding of a Community Risk Assessment and Standards of Cover study. Motion Type N/A Strategic Priority Operational Excellence SUMMARY BACKGROUND Over the past year, the City Council and staff have engaged in a series of discussions regarding fire department facilities and staffing. These conversations have highlighted several key concerns, including effective service delivery, firefighter health and safety, and the ability to plan proactively for continued community growth. Facility needs and staffing needs are tightly interconnected; without adequate facility space, the department will be unable to add the staffing necessary to meet the community’s future demand for emergency services. The space needs assessment presented to the Council on February 23rd, 2026, identified several needs related to firefighter health and safety, training capabilities, and service delivery. Four scenarios were provided, each with preliminary budget estimates. Staff did not identify a preferred option at that time and noted that additional analysis would be required to fully understand the service delivery impacts 5 associated with each scenario. To conduct this analysis, staff have developed a plan that includes engaging a consultant to complete a Community Risk Assessment followed by a Standards of Cover study. The Community Risk Assessment is a comprehensive evaluation of all hazards in the community, not limited to fire, which will identify the overall level of risk present across the entire community. The Standards of Cover study will complement this work by evaluating staffing levels and optimal facility placement to reduce identified risks. If authorized, both studies can be completed within the next year. Upon completion of the Community Risk Assessment and Standards of Cover study, staff will have the information needed to accurately assess service impacts and make a recommendation regarding the space needs assessment. The data and insights gathered will support the development of both a master facility plan and a staffing plan. These plans will be grounded in actual community needs and ensure that future investments are aligned with service expectations and growth. DISCUSSION BUDGET These projects are not currently included in any budget requests. The Community Risk Assessment and Standards of Cover studies are $25,000 each. Council could elect to utilize funding from the capital facilities fund to move both these projects forward in an expedited manner. Another option, which would likely slow the project timing, could be to include both projects as part of the 2027 budget process. RECOMMENDATION ATTACHMENTS Chanhassen_FD_CRA_Proposal 6 Community Risk Assessment Proposal Chanhassen Fire Department • March 2026 1 Emergency Service Perspectives • brian@esp-data.com • 612-227-5413 Community Risk Assessment Consulting Services Proposal Prepared for: Chanhassen Fire Department Chief Andrew Heger Prepared by: Emergency Service Perspectives Brian DesLauriers, Principal Consultant March 2026 7 Community Risk Assessment Proposal Chanhassen Fire Department • March 2026 2 Emergency Service Perspectives • brian@esp-data.com • 612-227-5413 EXECUTIVE SUMMARY Emergency Service Perspectives (ESP) is pleased to submit this proposal to conduct a Community Risk Assessment (CRA) for the Chanhassen Fire Department. This engagement follows the methodology prescribed by the Center for Public Safety Excellence (CPSE) and the Commission on Fire Accreditation International (CFAI) — the recognized national standard for fire service risk assessment and planning. The Chanhassen Fire Department serves a growing community of approximately 28,000 residents across 22 square miles in Carver County — a community whose rapid residential and commercial development has outpaced its current fire service infrastructure. Translating that growth into a clear picture of community risk, geographic coverage, and service demand is exactly what the CRA is designed to do — giving department and city leadership the objective data they need to determine what an acceptable level of risk looks like and what resources are required to achieve it. A formal Community Risk Assessment provides exactly that foundation — data-driven evidence that translates operational realities into language that resonates with elected officials and city administrators. This proposal outlines a community-driven CRA with these key deliverables: 1. A comprehensive Community Risk Assessment identifying fire and non-fire hazards 2. Critical task identification for all risk categories and service types 3. GIS-based risk mapping and response coverage analysis 4. Community profile with demographic, economic, and growth trend analysis 5. Foundation documentation developed in accordance with CPSE/CFAI methodology Our approach emphasizes collaboration and knowledge transfer, ensuring that department personnel develop the expertise to maintain and update the CRA as a living document that guides data-informed decision making for years to come. ESP proposes to begin this engagement in July 2026, with anticipated completion within 12–16 weeks. A Standards of Cover (SOC) study — the natural complement to the CRA — is available as an optional add-on engagement, building directly on the work product of this project. Given Chanhassen’s current situation, the SOC represents the critical next step in translating CRA findings into formal adopted standards that can drive city action on staffing, station coverage, and response benchmarks. See the Optional Add-On section for details. INTRODUCTION About Emergency Service Perspectives Emergency Service Perspectives (ESP) specializes in providing data-driven analytics and consulting services to fire departments and emergency service agencies. Our team combines decades of fire service experience with advanced geographic information systems (GIS) capabilities and modern data analytics to help departments understand their communities, measure their performance, and plan for the future. Principal Consultant Brian DesLauriers brings extensive fire service expertise combined with technical proficiency in GIS analysis, database management, and performance measurement systems. This unique combination enables ESP to deliver CRA documents that are both technically rigorous and operationally practical. 8 Community Risk Assessment Proposal Chanhassen Fire Department • March 2026 3 Emergency Service Perspectives • brian@esp-data.com • 612-227-5413 Understanding Chanhassen Chanhassen is a rapidly growing suburban city in the Minneapolis–Saint Paul metropolitan area, situated in Carver County with approximately 28,000 residents and a service area of roughly 22 square miles. The city has experienced sustained residential and commercial growth that has transformed its risk landscape in ways that legacy infrastructure has not kept pace with. The Chanhassen Fire Department faces a diverse and evolving risk profile that includes: • Expanding residential subdivisions and multi-family developments concentrated in the eastern and central portions of the city • Commercial and retail corridors along Highway 5 and Powers Boulevard • The Chanhassen Dinner Theatres — one of the nation’s largest professional dinner theatres — representing a significant assembly occupancy risk • Highway 212, Highway 41, and US-169 corridors with significant commercial vehicle and commuter traffic • Minnesota Landscape Arboretum and significant natural area parkland with wildland-urban interface considerations • A Lake Minnewaska lakeshore community with waterfront and recreational emergency response requirements • Light industrial and office park developments in the northern service area The department currently operates from a single fire station, and the community has experienced sustained growth in both population and geographic extent. Understanding how that growth has shaped the risk landscape — and where current service demand and coverage capability stand relative to community need — is the core purpose of this engagement. The CRA will give department and city leadership the factual foundation to make informed decisions about what constitutes an acceptable level of risk and what resources are necessary to achieve it. This reality makes a formal, data-driven Community Risk Assessment not just a best practice — it is the essential first step in building the evidence base that city leadership needs to take meaningful action on response standards, staffing levels, and long-term capital infrastructure planning. PURPOSE AND VALUE Why Conduct a Community Risk Assessment? A Community Risk Assessment serves as the foundational guidance document for a fire department’s operations. As defined by the Center for Public Safety Excellence, the CRA process establishes an agency’s credibility through data-driven analysis and transparent communication with the community and governing body. The CRA provides critical value in several key areas: Risk Identification and Prioritization: Systematically identifies and categorizes fire and non-fire risks throughout the service area, enabling focused resource allocation and community risk reduction efforts. Performance Baseline: Establishes baseline performance metrics using the industry-standard 90th percentile methodology, creating a framework for continuous improvement and benchmarking against peer agencies. Resource Deployment Insight: Provides data-driven context for current resource deployment decisions and surfaces geographic coverage patterns and demand concentrations that inform future planning. 9 Community Risk Assessment Proposal Chanhassen Fire Department • March 2026 4 Emergency Service Perspectives • brian@esp-data.com • 612-227-5413 Firefighter Safety: Identifies the risk landscape that informs critical tasking requirements, ensuring that sufficient resources are available to safely mitigate incidents across all identified risk categories. City Leadership Communication: Creates an objective, defensible mechanism for communicating service level gaps and performance expectations to elected officials and city administrators — translating operational realities into data that drives budget and policy decisions. Methodology All work conducted under this engagement follows the CPSE/CFAI framework for community risk assessment — the recognized national standard for this type of analysis. Using CFAI 11th Edition methodology ensures that the data collection, risk classification, and documentation processes are rigorous, defensible, and consistent with how leading fire service agencies across the country approach this work. The result is a CRA document that will hold up to scrutiny from city leadership, peer reviewers, and any future planning processes the department chooses to pursue. SCOPE OF WORK This project follows the CFAI/CPSE methodology for developing a Community Risk Assessment. The work is organized into four phases, each building upon the previous to create a comprehensive and defensible document. Phase 1: Project Initiation and Data Collection Duration: 4–6 weeks │ Target: August 2026 Objective: Establish the project framework, engage stakeholders, and collect foundational data. Key Activities: 6. Conduct project kickoff meeting with department leadership and city staff liaison 7. Establish internal stakeholder working group representing all organizational levels 8. Collect three or more years of incident response data from CAD/RMS systems 9. Gather GIS data including parcels, zoning, building footprints, and infrastructure 10. Obtain Census demographic data for community profile and growth trend analysis 11. Review existing department policies, procedures, and response protocols 12. Define fire demand zones (planning zones) for risk analysis across the service area Phase 2: Community Risk Assessment Duration: 6–8 weeks │ Target: October 2026 Objective: Identify, analyze, and categorize all fire and non-fire risks within the service area. Key Activities: 13. Develop community profile including demographics, economics, and growth projections 14. Conduct physical risk assessment of structures, occupancies, and assembly uses 15. Assess fire risk using probability and consequence methodology 16. Evaluate EMS risk including medical call density and population health factors 17. Identify special hazards including hazardous materials, technical rescue needs, and target hazards 18. Assess critical infrastructure vulnerabilities 19. Develop risk classification categories (Low, Moderate, High, Maximum/Special) 20. Create GIS risk maps for each risk classification, with coverage gap overlays 10 Community Risk Assessment Proposal Chanhassen Fire Department • March 2026 5 Emergency Service Perspectives • brian@esp-data.com • 612-227-5413 Phase 3: Stakeholder Engagement Duration: Concurrent with Phase 2 │ Ongoing throughout project Objective: Gather input from internal and external stakeholders to ensure community-driven outcomes. Key Activities: 21. Facilitate internal stakeholder working sessions with department personnel 22. Conduct external stakeholder focus group(s) with community representatives and city leadership 23. Present preliminary findings to department leadership 24. Gather institutional knowledge from experienced personnel 25. Document stakeholder input and incorporate into final analysis Phase 4: Documentation and Presentation Duration: 4–5 weeks │ Target: November 2026 Objective: Compile the final CRA document and present findings to stakeholders, including city leadership. Key Activities: 26. Compile comprehensive Community Risk Assessment document in CFAI 11th Edition format 27. Develop performance statements for each risk classification 28. Create executive summary for Authority Having Jurisdiction (AHJ) 29. Present findings to department leadership and staff 30. Present findings to City Council/AHJ with data-driven case for coverage and staffing action 31. Provide recommendations for ongoing performance monitoring and next steps OPTIONAL ADD-ON: STANDARDS OF COVER STUDY The Community Risk Assessment completed in 2026 provides the essential risk intelligence that a Standards of Cover study builds upon. The SOC takes the CRA’s findings and translates them into formally adopted deployment and response standards — giving the department and city leadership a documented framework for evaluating current capabilities against community-defined performance objectives. ESP can conduct a full SOC engagement building directly on the established risk classifications, GIS data, demand zone analysis, and community profile from the CRA — eliminating redundant data collection and accelerating the process. The Standards of Cover study would add the following phases and deliverables: • Critical task analysis for each risk category and incident type • Effective Response Force (ERF) determination for fire and EMS incidents • Response time analysis by component (alarm handling, turnout, travel) at the 90th percentile • Resource distribution assessment (first-due coverage) and concentration analysis (ERF assembly) • Identification of performance gaps between current baseline and industry benchmarks • Benchmark performance goal development and documentation 11 Community Risk Assessment Proposal Chanhassen Fire Department • March 2026 6 Emergency Service Perspectives • brian@esp-data.com • 612-227-5413 • Station location modeling — data-driven analysis of coverage alternatives to inform capital planning decisions • Complete CRA/SOC document package developed in accordance with CPSE/CFAI methodology Optional Add-On: Standards of Cover Study For Chanhassen, the CRA and SOC together represent the complete evidence package needed to make the case for infrastructure investment. The CRA documents what the risks are and where coverage gaps exist. The SOC establishes what the department should be doing — formally, with adopted benchmarks — and quantifies the gap between current and desired state. Together, they give city leadership no ambiguity about what is needed and why. Standards of Cover Study Investment: $25,000 DELIVERABLES Upon completion of this engagement, the Chanhassen Fire Department will receive: 32. Community Risk Assessment Document — A comprehensive document following CFAI 11th Edition format, including community profile, physical risk assessment, probability and consequence analysis, special hazard identification, and risk classification mapping. 33. GIS Risk Maps — Digital and printed maps depicting risk classifications, demand density, geographic coverage gaps, and target hazard distribution across the service area. 34. Performance Statements — Baseline and benchmark statements for all service types and risk categories, formatted per CFAI requirements. 35. Executive Summary Presentation — A presentation-ready summary suitable for City Council and community stakeholder meetings, designed to support conversations on staffing and coverage. 36. ESP Analytics Platform Access — Access to the OMNIA-ONE analytics platform (CRA Module) for ongoing performance monitoring, reporting, and future CRA maintenance. 37. Knowledge Transfer — Training for designated department personnel on maintaining and updating the CRA as a living document. PROJECT TIMELINE The following timeline reflects a July 2026 project start. Phases 2 and 3 overlap to maximize efficiency. Actual timeline may vary based on data availability and stakeholder scheduling. Phase Duration Target Completion Phase 1: Initiation & Data Collection 4–6 weeks August 2026 Phase 2: Community Risk Assessment 6–8 weeks October 2026 Phase 3: Stakeholder Engagement Concurrent Ongoing 12 Community Risk Assessment Proposal Chanhassen Fire Department • March 2026 7 Emergency Service Perspectives • brian@esp-data.com • 612-227-5413 Phase 4: Documentation & Presentation 4–5 weeks November 2026 Total Project Duration 12–16 weeks Est. Nov. 2026 DEPARTMENT RESPONSIBILITIES The success of this project depends on active collaboration between ESP and the Chanhassen Fire Department. As emphasized by CPSE, the CRA process is most effective when treated as a "team sport" that invites contributions from all levels of the organization. Project Sponsor The Fire Chief or designee will serve as the project sponsor, providing overall direction and ensuring organizational commitment to the process. Internal Stakeholder Working Group The department will establish a working group of 4–6 members representing various ranks and functional areas. This group will meet regularly throughout the project to provide input, review findings, and ensure buy-in from all organizational levels. Data Access The department will provide access to CAD/RMS data, GIS resources, inspection records, and other relevant data sources. ESP will work with department staff to establish secure data transfer protocols. Stakeholder Coordination The department will assist in identifying and scheduling external stakeholder participants, including community members, business representatives, and city government officials — particularly those involved in capital planning and budget decisions. INVESTMENT The total investment for the Community Risk Assessment is structured to provide comprehensive value while respecting municipal budget constraints. Service Component Investment Phase 1: Project Initiation and Data Collection $5,000 Phase 2: Community Risk Assessment $11,000 Phase 3: Stakeholder Engagement $4,000 Phase 4: Documentation and Presentation $5,000 ESP Analytics Platform — CRA Annual Update (2027) Included Total Community Risk Assessment Investment $25,000 13 Community Risk Assessment Proposal Chanhassen Fire Department • March 2026 8 Emergency Service Perspectives • brian@esp-data.com • 612-227-5413 Payment Terms: Invoiced in three installments: 40% upon contract execution, 30% upon completion of Phase 2, and 30% upon final delivery. Optional Add-On: Standards of Cover Study The Community Risk Assessment lays the ideal foundation for a Standards of Cover (SOC) study. ESP can conduct a full SOC engagement building directly on the risk classifications, GIS data, and performance baselines established in this project — without duplicating data collection effort. For Chanhassen, the SOC is the natural next step after the CRA: it establishes formally adopted response standards, quantifies the gap between current capability and community- defined performance objectives, and provides the policy framework that supports informed decision-making on staffing, coverage, and capital planning. Standards of Cover Study Investment: $25,000 WHY EMERGENCY SERVICE PERSPECTIVES? Fire Service Expertise Our team understands fire department operations from the inside. We speak your language and understand the unique challenges of balancing community expectations, resource constraints, and firefighter safety. Advanced Analytics Platform Unlike traditional consultants who deliver a static report, ESP provides an ongoing analytics platform that enables continuous performance monitoring. Your CRA becomes a living document that evolves with your community — and the platform positions you to seamlessly integrate a Standards of Cover study when you’re ready. GIS Excellence Our GIS capabilities enable sophisticated spatial analysis that goes beyond basic mapping. We provide detailed risk visualization, demand density analysis, and geographic coverage assessment that gives departments and city leadership a clear, objective picture of where the community stands today. CFAI/CPSE Alignment All work products are developed in strict accordance with CFAI 11th Edition methodology and CPSE best practices — the recognized national standard for fire service risk assessment and planning. This ensures the work is rigorous, defensible, and consistent with how leading departments across the country approach this process. Local Presence Based in Minnesota, ESP offers the convenience of local presence combined with national-level expertise. We are committed to being a long-term partner in the Chanhassen Fire Department’s continuous improvement journey and its effort to ensure fire service planning keeps pace with community growth. 14 Community Risk Assessment Proposal Chanhassen Fire Department • March 2026 9 Emergency Service Perspectives • brian@esp-data.com • 612-227-5413 NEXT STEPS We welcome the opportunity to discuss this proposal in greater detail and tailor our approach to meet the specific needs of the Chanhassen Fire Department. Recommended next steps: • Schedule a meeting to discuss project scope and department priorities • Review available data sources and GIS infrastructure • Finalize project timeline and engagement agreement • Execute contract and begin Phase 1 in July 2026 Thank you for the opportunity to partner with the Chanhassen Fire Department. We are excited to conduct this Community Risk Assessment and build a strong, data-driven foundation that supports meaningful action on staffing, coverage, and long-term community safety planning. Respectfully submitted, Brian DesLauriers Principal Consultant Emergency Service Perspectives Email: brian@esp-data.com Phone: 612-227-5413 15 City Council Item April 27, 2026 Item Permitted Burning Discussion File No.Item No: A.2 Agenda Section 5:30 P.M. - WORK SESSION Prepared By Andrew Heger, Fire Chief Reviewed By SUGGESTED ACTION Provide direction to staff regarding permitted burns. Motion Type N/A Strategic Priority Operational Excellence SUMMARY BACKGROUND Last September, council and staff engaged in conversations regarding the permitted burning process currently set forth in City Ordinance. Staff highlighted several concerns regarding the current ordinance language and the need to impose additional restrictions on permitted burning. The City Council directed staff to make several revisions to the current ordinance, which were brought back to the December 15th, 2025, meeting for adoption. A Citizen Action Request was brought forth to that meeting, and the council tabled the item for future consideration. Staff have reviewed the concerns expressed through the Citizen Action Request and would like to discuss further with the City Council to bring forth a resolution to this issue. DISCUSSION 16 BUDGET RECOMMENDATION ATTACHMENTS Permitted Burns Proposed Ordinance Permitted Burning Presentation 17 237820v1 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA ORDINANCE NO. ____ AN ORDINANCE AMENDING CHAPTER 9, ARTICLE III OF THE CHANHASSEN CITY CODE CONCERNING PERMITTED BURNS THE CITY COUNCIL OF THE CITY OF CHANHASSEN ORDAINS: SECTION 1. Section 9-32 of the Chanhassen City Code is amended to add the underlined language and delete the strikethrough language as follows: Sec 9-32 Eligible Properties Burn permits for residents will only be issued, subject to the requirements of this article, for properties meeting the criteria listed in Sec. 9-34in rural portions of the city. Burn permits for the purpose of prairie grass restoration conducted by a licensed and Minnesota DNR-approved contractor are allowed in all areas of the city. The figure below indicates which areas of the city are classified as rural, urban, or suburban for determining burn permit eligibility. SECTION 2. Section 9-33 of the Chanhassen City Code is amended to add the underlined language as follows: Sec 9-33 Application For Permit To apply for a burn permit an applicant must: (a) Submit an application on the form provided by the city to the fire chief or fire marshal. (b) Provide a nonrefundable fee, which shall be imposed in accordance with the fee schedule established by the city council. (c) If conducting a prairie grass burn larger than one-half an acre, the applicant must first apply for and receive a variance permit from the Minnesota DNR. The applicant must provide a copy of the Minnesota DNR variance permit when applying for a local burning permit. SECTION 3. Section 9-34 of the Chanhassen City Code is amended to add the underlined language and delete the strikethrough language as follows: Sec 9-34 Criteria For Approval Burn permits shall only be issued if the following criteria are met: (a) The applicant has not violated the conditions of a previous burn permit. 18 237820v1 (b) The proposed burn site is on a property shown as eligible to receive a burn permit in Section 9-32. (c) (a). The proposed burn site is at least 250 feet from any building. (b) The proposed burn site is at least 600 feet from any public roadways. (c) The proposed burn site will not impact any wetlands, as determined by city water resources staff. (d) The proposed burn site will not impact any bluffs, as determined by city forestry staff. (e) There is not a practical alternative method for disposal of the materials such as hauling off-site, chipping, or composting. SECTION 4. Sec. 9-35 of the Chanhassen City Code is amended to add the underlined language and delete the strikethrough language as follows: Sec 9-35 Conditions The city may place conditions on any aspect of the burn as deemed necessary to prevent the creation of hazardous conditions or nuisances. All burn permits issued under this article are subject to the following conditions: (a) The fire must be kept under control and the applicant must assume all responsibility for all damages and costs that may result from burning done under this permit. (b) The fire must be attended at all times until completely extinguished. (c) Fires will not be allowed to smolder without flame. (d) A clean burning device must be used to start fire. (e) No burning may be conducted during any air quality alert. (f) No burning may be conducted when the Minnesota Department of Natural Resources places Carver County under restricted, no open burning, or elevated burning restrictions. (f)(g) Burning may only be conducted when prevailing winds are blowing away from occupied buildings, roadways, and when wind speeds do not exceed ten mph. (g)(h) Leaves, yard waste, grass clippings, paper, cardboard, oils, rubber, plastics, tires, and chemically treated materials such as railroad ties, treated lumber, composite shingles, tar paper, composition board, sheetrock, wiring, paint and hazardous and industrial solid waste may not be burnt. (h)(i) The permit must be present and available at the burn site for inspection. (i)(j) The fire must be extinguished immediately if the permit is revoked. (k) Piled brush shall be no larger than 20 feet by 20 feet. (l) Reasonable accommodations shall be provided for the fire department to access the burn site in the event of an emergency. SECTION 5. Section 9-36 of the Chanhassen City Code is amended to add the underlined language as follows: 19 237820v1 Sec 9-36 Revocation A burn permit issued under this article may be revoked by the fire chief or their designee if it is determined after an inspection by city staff that the permit holder is in violation of or has violated conditions placed upon the burn permit, or that a burn has been conducted in such a manner as to constitute a public nuisance. Fires that are found to be in violation of the requirements set forth in this chapter are subject to issuance of a misdemeanor citation. SECTION 6. EFFECTIVE DATE: This ordinance shall be effective immediately upon its passage and publication. PASSED AND ADOPTED this ___ day of ____________, 2025, by the City Council of the City of Chanhassen, Minnesota. ATTEST: _________________________________ ______________________________ Jenny Potter, City Clerk Elise Ryan, Mayor 20 Permitted Burning April 27th, 2026 21 Recap •Council workshop September 22nd, 2025 •Direction to strengthen existing permitted burn requirements/process •Council meeting December 15th, 2025 •Citizen Action Request received •Amendments to city code tabled •Early 2026 •Citizen Action Request reviewed •Proposed requirements revisited by staff 22 Citizen Action Request-Summary •Nonrefundable fee •Concern of cost •Wind, dry weather, air pollution aren’t factored in •250-foot structure requirement •Seeks clarification of what a building is (lean-to, shed, playset, etc.) •600-foot requirement from roadway •Concerned that compliance cannot be met •Reference to the DNR 25-foot setback rule •Definition of what can be burned, not just what can’t be •Definition of a clean burning device 23 Proposed Language-Eligible Properties •Burn permits for residents will only be issued, subject to the requirements of this article, for properties meeting the criteria listed in Sec. 9-34 in rural portions of the city. Burn permits for the purpose of prairie grass restoration conducted by a licensed and Minnesota DNR-approved contractor are allowed in all areas of the city. The figure below indicates which areas of the city are classified as rural, urban, or suburban for determining burn permit eligibility. 24 Proposed Language-Criteria for Approval (a) The applicant has not violated the conditions of a previous burn permit. (b) The proposed burn site is on a property shown as eligible to receive a burn permit in Section 9-32. (a) The proposed burn site is at least 250 feet from any building. (b) The proposed burn site is at least 600 feet from any public roadways. (c) The proposed burn site will not impact any wetlands, as determined by city water resources staff. (d) The proposed burn site will not impact any bluffs, as determined by city forestry staff. (e) There is not a practical alternative method for disposal of the materials such as hauling off-site, chipping, or composting. 25 Proposed Language-Conditions (a) The fire must be kept under control and the applicant must assume all responsibility for all damages and costs that may result from burning done under this permit. (b) The fire must be attended at all times until completely extinguished. (c) Fires will not be allowed to smolder without flame. (d) A clean burning device must be used to start fire. (e) No burning may be conducted during any air quality alert. (f) No burning may be conducted when the Minnesota Department of Natural Resources places Carver County under restricted, no open burning, or elevated burning restrictions. (g) Burning may only be conducted when prevailing winds are blowing away from occupied buildings, roadways, and when wind speeds do not exceed ten mph. (h) Leaves, yard waste, grass clippings, paper, cardboard, oils, rubber, plastics, tires, and chemically treated materials such as railroad ties, treated lumber, composite shingles, tar paper, composition board, sheetrock, wiring, paint and hazardous and industrial solid waste may not be burnt. (i) The permit must be present and available at the burn site for inspection. (j) The fire must be extinguished immediately if the permit is revoked. (k) Piled brush shall be no larger than 20 feet by 20 feet. (l) Reasonable accommodations shall be provided for the fire department to access the burn site in the event of an emergency. 26 Proposed Language-Revocation •A burn permit issued under this article may be revoked by the fire chief or their designee if it is determined after an inspection by city staff that the permit holder is in violation of or has violated conditions placed upon the burn permit, or that a burn has been conducted in such a manner as to constitute a public nuisance. Fires that are found to be in violation of the requirements set forth in this chapter are subject to issuance of a misdemeanor citation. 27 Fees •Previously, fees were indicated as a requirement in ordinance but never charged •Proposed $25 for a short-term permit, less than 30 days •Proposed $100 for a long-term permit, maximum of six months 28 Impact •The proposed revisions will allow some properties who had not previously been able to burn the opportunity to do so. •The proposed revisions will prevent some properties who had previously been able to burn from doing so. •Goal is to reduce overall risk in the community. 29 Questions? 30 City Council Item April 27, 2026 Item 2026 Park Renovation Fund Allocation Discussion File No.Item No: A.3 Agenda Section 5:30 P.M. - WORK SESSION Prepared By Jerry Ruegemer, Park and Recreation Director Reviewed By SUGGESTED ACTION The City Council expresses support for the 2026 Park Renovation Park Priorities as recommended by the Park and Recreation Commission, for a replacement playground at Stone Creek Park ($85,000) and supplemental playground equipment at Carver Beach Park ($15,000). Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY The Park and Recreation Commission at your February 24 meeting listened to a Park Renovation Fund presentation from Finance Director, Kelly Grinnell. She outlined the fund's history, current budget, and projected fund balance over the next 3-5 years. The Park Renovation Fund for 2026 will have an allocation of $110,000 for the commission to identify priority projects for the city council to consider and approve. Staff asked the commission to work on creating a list of park priority projects for the next 1-10 years and to identify park priority projects for 2026. BACKGROUND The Park Renovation Fund was developed in 2018 with revenues typically transferred from the General Fund to fund a variety of Park improvement projects. When first developed, the fund did not have a dedicated funding source. From 2018 to 2025, a variety of park improvements were completed. In 2022 and 2023, the city transferred funds from the General Fund to complete several playground replacement 31 projects. The city did not budget any transfers, income, or expenses in 2024 due to the Lake Ann Park Preserve project. In 2025, the City Council adopted a $100,000 levy for this fund, and the Chan Rec Center Pickleball Courts were resurfaced, and the Carver Beach Playground equipment was replaced. With the City Council instituting this new levy, the city will have approximately $700,000 available to fund park improvement projects over the next 5 years. DISCUSSION The Park and Recreation Commission reviewed the park priorities list and are formulating a plan to implement higher priority projects over the next 5-10 years. This priority plan continues to evolve and the commission is recommending the following 2026 Park projects be completed within the $110,000 budget. *Stone Creek Park Playground Replacement $85,000 *Carver Beach Park Playground Supplemental Equipment $15,000 Total $100,000 BUDGET RECOMMENDATION Review the recommendation and provide implementation direction to staff. ATTACHMENTS 2026 Park Priority Projects 32 2026 Park Priority Projects On March 24 the Park and Recreation Commission reviewed and discussed the 2026 Park Renovation Fund and what park projects they felt important to prioritize with the $110,000 allocated budget. For 2026, the commission is recommending that the Stone Creek Park Playground be replaced ($85,000). The current playground was installed in 1998 and is currently in year 28 of a 25 year replacement schedule. The commission is also recommending an additional ($15,000) be allocated to supplement additional equipment at the Carver Beach Park Playground. Looking ahead with the desire to install the playground equipment this fall the following timeline has been created to illustrate the process. Stone Creek Park Playground April - Prepare and distribute RFP to Playground Vendors Assessment & Engagement May 26 Neighborhood meeting – Park & Recreation Commission Meeting Neighborhood selects favorite playground design/company June 8 - City Council Approval June 10 - Contracts signed & playground equipment ordered 8-10 weeks manufacture production schedule August - Playground equipment delivered September 1 - Existing playground removed September 14 - Installation begins (2-3 week build) October 5-9 - Ribbon Cutting Carver Beach Park Playground Assessment & Engagement Staff initiated conversation with playground equipment vendor to develop options to supplement container. City has no intention of expanding the container size May 26 - Neighborhood meeting – Park & Recreation Commission Meeting 33 Neighborhood selects favorite playground design options provided Under $20,000 doesn’t need City Council Approval to Purchase Equipment Contracts signed & playground equipment ordered 8-10 weeks manufacture production schedule August - Playground equipment delivered September 1 - Installation begins for 1-2 week duration 34 City Council Item April 27, 2026 Item Future Work Session Schedule File No.Item No: A.4 Agenda Section 5:30 P.M. - WORK SESSION Prepared By Laurie Hokkanen, City Manager Reviewed By Laurie Hokkanen SUGGESTED ACTION N/A Motion Type N/A Strategic Priority N/A SUMMARY May 11, 2026 Audit Results Presentation (tentative, may move to June) May 18, 2026 Stormwater Ponds Maintenance June 8, 2026 Community Center BP #2 June 22, 2026 City Council Roundtable BACKGROUND Staff or the City Council may suggest topics for work sessions. Dates are tentative until the meeting 35 agenda is published. Work sessions are typically held at 5:30 pm in conjunction with the regular City Council meeting, but may be scheduled for other times as needed. DISCUSSION BUDGET RECOMMENDATION ATTACHMENTS 36 City Council Item April 27, 2026 Item Proclamation Designating April 28th, 2026 as Mary Blazanin Day File No.Item No: C.1 Agenda Section PUBLIC ANNOUNCEMENTS Prepared By Matt Unmacht, Assistant City Manager Reviewed By SUGGESTED ACTION N/A Motion Type N/A Strategic Priority N/A SUMMARY Senior Center Coordinator Mary Blazanin will retire on May 1st, 2026, after many dedicated years of service to the City. Mary was a tireless advocate, innovator, and friend to Chanhassen's 55+ community. In acknowledgment of her outstanding contributions, the city will honor her by proclaiming April 28th, 2026 as Mary Blazanin Day. BACKGROUND DISCUSSION BUDGET RECOMMENDATION 37 ATTACHMENTS Mary Blazanin Day Proclamation 38 OFFICE OF THE MAYOR CITY OFCHANHASSENApril 27, 2026 Mayor Elise Ryan MARY BLAZANIN DAY PROCLAMATION APRIL 28, 2026 Mary Blazanin began her service to the City of Chanhassen in 2018 and served as a tireless advocate, innovator and friend to our 55+ community members; and Mary has consistently demonstrated an extraordinary level of heart and empathy, going far beyond the requirements of the role to treat every member of our senior community like family; and During the unprecedented challenges and isolation brought on by the COVID-19 pandemic, Mary served as a vital lifeline, personally checking in on residents to ensure that their safety, health and spirits remained high; and During the construction of the new Senior Center, Mary played a key role in successfully transitioning programs and services to the Recreation Center while maintaining a strong sense of community. Through her leadership and dedication, she helped bring the vision of the new Senior Center to life, culminating in a successful grand opening that created an enhanced space for connection and engagement for Chanhassen’s older adults; and Mary was a valued and trusted colleague whose warmth, calm demeanor and genuine kindness positively impacted those around her and her generous and caring nature made her not only an exceptional teammate but also a source of support, encouragement and positivity for coworkers across the organization; and Mary’s selfless service has significantly improved the quality of life for Chanhassen’s older adults, proving that a single dedicated individual can strengthen the fabric of an entire city; and As Senior Center Coordinator, Mary provided mentorship, friendship and compassionate leadership to the many older adults, volunteers and staff members who passed through the doors of the Senior Center. Her willingness to share time, experience and encouragement helped build a welcoming community, enriched the lives of participants and strengthened the programs and services that supported the City of Chanhassen’s aging community; and I, Mayor of the City of Chanhassen, do hereby designate the 28th of April, 2026, as Mary Blazanin Day. On behalf of Chanhassen seniors, employees and the community alike, this day shall pay tribute to and recognize the substantial contributions Mary has made to protect our community’s health, safety and quality of life. WHEREAS, WHEREAS, WHEREAS, WHEREAS, WHEREAS, WHEREAS, WHEREAS, RESOLVED, 39 City Council Item April 27, 2026 Item Approve City Council Meeting Minutes dated April 13, 2026 File No.Item No: D.1 Agenda Section CONSENT AGENDA Prepared By Jenny Potter, City Clerk Reviewed By SUGGESTED ACTION "The Chanhassen City Council approves the City Council Meeting minutes dated April 13, 2026." Motion Type Simple Majority Vote of members present Strategic Priority N/A SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION Staff recommends that the Chanhassen City Council approve the City Council Meeting minutes dated April 13, 2026. 40 ATTACHMENTS City Council Meeting minutes dated April 13, 2026 41 CHANHASSEN CITY COUNCIL REGULAR MEETING MINUTES APRIL 13, 2026 Mayor Ryan called the meeting to order at 7:00 p.m. The meeting was opened with the Pledge of Allegiance. COUNCIL MEMBERS PRESENT: Mayor Ryan, Councilmember McDonald, Councilmember Schubert, Councilmember von Oven, and Councilmember Kimber. COUNCIL MEMBERS ABSENT: None. STAFF PRESENT: Laurie Hokkanen, City Manager; Charlie Howley, Public Works Director/City Engineer; Eric Maass, Community Development Director; Patrick Gavin, Communications Manager; Jerry Ruegemer, Park & Recreation Director; Kelly Grinnell, Finance Director PUBLIC PRESENT: The Vantage Public Policy Student Group from Minnetonka High School Brad Barickman, RJM Construction PUBLIC ANNOUNCEMENTS: None. CONSENT AGENDA: Councilmember McDonald moved, Councilmember von Oven seconded that the City Council approve the following consent agenda items 1 through 18 pursuant to the City Manager’s recommendations: 1. Approve City Council Minutes dated March 23, 2026 2. Approve City Council Work Session Meeting Minutes dated March 23, 2026 3. Receive Park and Recreation Commission Minutes dated February 24, 2026 4. Receive Planning Commission Minutes dated March 17, 2026 5. Receive Commission on Aging Minutes dated February 20, 2026 6. Approve Claims Paid dated April 13, 2026 7. Arbor Day Proclamation 8. Approve Site Plan for an Addition to Minnetonka Middle School West 42 City Council Minutes – April 13, 2026 2 9. Approve the Civic Campus Outdoor Site Furnishing Quote with Landscape Forms, Inc., in the amount of $103,908.62 10. Approve Construction Services Scope Amendment to the Professional Services Agreement with Short Elliot Hendrickson Inc (SHE) for the Lake Ann Park Preserve project 11. Approve a Massage Therapy Business License for a new owner of Hand and Stone Massage and Facial Spa located at 858 West 78th Street 12. Resolution 2026-24: Call for the Assessment Hearing for the 2026 City Pavement Rehabilitation Project No. 26-01 13. Resolution 2026-25: Authorize a contract for Geotechnical Services for the 2027 Rehabilitation Projects 14. Resolution 2026-26: Grant agreement with MCES for municipal infiltration/inflow 15. Resolution 2026-27: Approve Year-End Transfers 16. Resolution 2026-28: Approve Interfund Loans for the Fiscal Year 2025 17. Resolution 2026-29: Authorize Submission for Carver County Community Development Agency Community Growth Partnership Initiative (CGPI) Technology Assistance Grant Application 18. Ordinance 759: Amending Chapters 1 and 20, Updating Sign Definitions and Regulations All voted in favor, and the motion carried unanimously with a vote of 5 to 0. VISITOR PRESENTATIONS. The Vantage Public Policy Student Group from Minnetonka High School provided an overview of the Vantage Program and its goals for the project. They provided survey results for the demographics of the duration of residency in Chanhassen, age, and sex. Another student summarized the survey results about City Council meeting attendance and the reasons behind the lack of attendance as applicable. Another student explained the deliverable result, which was an AI Chat Tool called the Chan Chatter, and provided a demonstration. The students reviewed the different facts that they learned about Chanhassen during the project. FIRE DEPARTMENT/LAW ENFORCEMENT UPDATES. None. PUBLIC HEARINGS. 1. Market Boulevard Improvement Project: Assessment Hearing/Award Construction Contract/No Parking Resolution 43 City Council Minutes – April 13, 2026 3 Charlie Howley, Public Works Director/City Engineer, provided an overview of the Market Boulevard Improvement Project. He provided background work leading up to the project and noted that the city received one bid for the project on March 26, 2026. He summarized the regional downtown water reuse, which would be utilized as irrigation for the Civic Campus and City Center Park athletic field. He noted that they received an MPCA Climate Resiliency Grant for the innovative smart pond. He explained the staging phase one of the project, which they want to complete by mid-June, ahead of the 4th of July. He reviewed the staging of phases two and three and noted that all phases should be complete by the end of October. He explained the no parking for the project, which would be added on both sides of Market Boulevard north of West 78th Street to Chan View. He summarized the bid results and noted that it came in eight percent over the estimate, but VE items had been identified to bring the costs down. Mr. Howley explained the project funding sources. He explained the assessment amounts, which were determined by the front footage methodology. He summarized the public feedback received about the project. He stated that the future City Council actions include establishing a TIF Note, revising the Special Agreement Assessment, and awarding a contract for the entry monument construction. Mayor Ryan opened the public hearing. There were no public comments. Mayor Ryan closed the public hearing. Mayor Ryan thanked the City staff and the City Council for all of their work contributions to the project. She voiced support for the local contractor completing the project. Councilmember Kimber moved, Councilmember Schubert seconded that the Chanhassen City Council adopt a resolution awarding the construction contract to Valley Paving and adopting the assessment role for the Market Boulevard Rehabilitation Project, City Project Number 25-02; and further adopts a resolution establishing No Parking on both sides of Market Boulevard between west 78th Street and Chan View. All voted in favor, and the motion carried unanimously with a vote of 5 to 0. GENERAL BUSINESS. 1. Award Chanhassen Community Center Bid Package #1 Brad Barickman, RJM Construction, summarized bid package #1 for the Chanhassen Community Center. The bid project would include concrete and utilities, which have longer lead times and require earlier action to reserve production slots. Mayor Ryan asked him to explain the lead time. Mr. Barickman answered that the pre-cast wall panels' lead time due to the significant increase of data centers in the. The current average lead time was in excess of six months, so they wanted to get in front of this time period. He discussed 44 City Council Minutes – April 13, 2026 4 the lead time for structural rebar and noted that they should be able to start construction after bid package number two. Councilmember von Oven moved, Councilmember McDonald seconded that the Chanhassen City Council moves to award Bid Package #1 for the Chanhassen Community Center to RJM Construction, in the amounts of: $3,031,200 for Donald R. Frantz, $6,672,160 to Wells, and $1,664,410 to MN Utilities as part of the Construction Manager at Risk (CMAR) delivery method, and authorize the City Manager to execute the necessary documents. This award does not establish the Guaranteed Maximum Price (GMP), which will be brought forward for the City Council approval at a later date. All voted in favor, and the motion carried unanimously with a vote of 5 to 0. COUNCIL PRESENTATIONS. None. ADMINISTRATIVE PRESENTATIONS. Mayor Ryan voiced support and pride in the reports completed by these two departments. 1. 2025 Community Development Department Annual Report and 2026 Work Plan 2. 2025 Park and Recreation Department Annual Report CORRESPONDENCE DISCUSSION. 1. City Manager Annual Performance Review Councilmember Schubert moved, Councilmember McDonald seconded to adjourn the meeting. All voted in favor, and the motion carried unanimously with a vote of 5 to 0. The City Council meeting was adjourned at 8:20 p.m. Submitted by Laurie Hokkanen City Manager Prepared by Jenny Potter City Clerk 45 City Council Item April 27, 2026 Item Approve City Council Work Session Meeting Minutes dated April 13, 2026 File No.Item No: D.2 Agenda Section CONSENT AGENDA Prepared By Jenny Potter, City Clerk Reviewed By SUGGESTED ACTION "The Chanhassen City Council approves the City Council Work Session Meeting minutes dated April 13, 2026." Motion Type Simple Majority Vote of members present Strategic Priority N/A SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION Staff recommends that the Chanhassen City Council approve the City Council Work Session Meeting minutes dated April 13, 2026. 46 ATTACHMENTS City Council Work Session Meeting minutes dated April 13, 2026 47 City Council Work Session Minutes – April 13, 2026 1 CHANHASSEN CITY COUNCIL WORK SESSION MINUTES April 13, 2026 Mayor Ryan called the work session to order at 5:30 p.m. COUNCIL MEMBERS PRESENT: Mayor Ryan, Councilmember McDonald, Councilmember von Oven, Councilmember Kimber, Councilmember Schubert COUNCIL MEMBERS ABSENT: STAFF PRESENT: Laurie Hokkanen, City Manager; Charlie Howley, Public Works Director/City Engineer; Patrick Gavin, Communications Manager; Eric Maass, Community Development Director; Jerry Ruegemer, Parks Director; Kelly Grinnell, Finance Director PUBLIC PRESENT: Brad Barickman, RJM Construction Sketch Plan Review for commercial development at the northeast corner of Lyman Boulevard and Powers Boulevard Eric Maass, Community Development Director, discussed a preliminary sketch plan for a potential commercial development at the northeast corner of Lyman Boulevard and Powers Boulevard, an early step in what may become a future redevelopment of two existing residential properties. The concept, brought forward by Northland Real Estate Group, included two commercial buildings, one with a drive-through, and would require a Comprehensive Plan amendment and rezoning to move forward. City Council feedback focused on high-level considerations, including traffic impacts along Lyman Boulevard, potential noise and compatibility with nearby residential areas, and preservation of existing trees on the site. While there was no clear consensus, Council generally expressed cautious openness to exploring a commercial designation, with several members indicating that a Neighborhood Business zoning district would be the most appropriate fit if the project advances. Chanhassen Community Center Bid Package #1 Laurie Hokkanen, City Manager and Brad Barickman, RJM Construction, the city’s construction manager, provided an overview of the first bid package, which focuses on securing key early components of the project with longer lead times. The package includes three primary contracts: structural concrete, precast concrete wall panels and site utilities. In total, 15 bids were received across the three categories, with approximately five bids per category. All recommended bids came in at or below previously established cost estimates, reflecting a strong and competitive bidding environment. 48 City Council Work Session Minutes – April 13, 2026 2 The City Council discussed the importance of advancing these early packages to secure materials and maintain the overall construction schedule, particularly given extended lead times for precast wall panels, which can exceed five to six months. The approval allows work to begin on early- phase elements while additional bid packages, including remaining project components and alternates, are refined and brought forward for consideration later this year, with Bid Package #2 expected in June. Sign Code Ordinance Eric Maass, Community Development Director gave an overview of an ordinance amending Chapters 1 and 20 of the City Code to update sign definitions and regulations, following several months of work that included multiple Planning Commission meetings and public hearings. The updates will make several changes to modernize and clarify the city’s sign code. Signage opportunities would be expanded across commercial zoning districts, allowing canopy, awning and projecting signs in areas such as Downtown, Highway Business, Neighborhood Business , and other commercial districts. The ordinance also introduces clearer definitions for “window signs” and “window coverings,” helping distinguish between signage and materials used for privacy or screening. The Planning Commission recommended that window signs be allowed in 50% of a business’s windows and that those window signs could occupy up to 50% of the area of the window in which it is located. Following discussion amongst the City Council related to comparable cities regulations around window sign size allowances, the City Council directed staff to update standards for window signage, establishing that up to 50% of a business’s windows may contain signage, with each window limited to 30% coverage. Entrance doors are exempt from these limits. Additional provisions clarify that window signage may not blink, flash or be excessively bright. The ordinance also updates regulations for nonconforming signs, requiring that when signs are replaced beyond normal maintenance, they must be brought into compliance with the current code. Other changes focus on improving implementation and consistency, including allowing temporary signs without a permit, establishing clearer standards for site signage , and addressing content- based regulations to ensure compliance with First Amendment considerations. Overall, the updates are intended to provide greater flexibility for businesses while maintaining a consistent and high- quality visual environment across the city. City Council Roundtable The City Council held its quarterly roundtable discussion during the work session. Several Citizen Action Requests were discussed, along with updates on previously raised topics. A citizen request related to immigration enforcement policies and city cooperation with federal authorities prompted discussion about recent outreach to federal officials. Mayor Ryan noted that the city remains in regular communication with Congressman Tom Emmer’s office regarding ICE-related matters, but there was no consensus to move forward with a resolution or to pursue the establishment of a Human Rights Commission. 49 City Council Work Session Minutes – April 13, 2026 3 Regarding participation in the Safe & Stable Coalition, the mayor noted that the city is an ally but not a formal, dues-paying member, participating in periodic updates but not contributing financially or taking formal policy positions. Activity within the coalition has been minimal and no additional action was recommended at this time. A request to explore tree planting and native landscaping efforts along 78th Street is moving forward, with a resident working directly with city staff on potential opportunities and coordination. Council expressed general support for continued collaboration on these efforts. The roundtable also included discussion of traffic concerns related to a recent highway closure, with staff actively coordinating with Carver County on signage, enforcement , and other mitigation efforts. Mayor Ryan adjourned the work session at 6:57 P.M. Submitted by Laurie Hokkanen City Manager Prepared by Jenny Potter City Clerk 50 City Council Item April 27, 2026 Item Receive Environmental Commission Minutes dated March 11, 2026 File No.Item No: D.3 Agenda Section CONSENT AGENDA Prepared By Amy Weidman, Senior Admin Support Specialist Reviewed By SUGGESTED ACTION "The Chanhassen City Council receives Environmental Commission Minutes dated March 11, 2026." Motion Type Simple Majority Vote of members present Strategic Priority N/A SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION ATTACHMENTS 51 Environmental Commission Minutes dated March 11, 2026 52 Chanhassen Environmental Commission (EC) 6:00 pm March 11, 2026 Members Present: Chair Scott Grefe, Leslie Elhadi, Paget Pengelly, Sidney Lindmark, Glenn Stolar, Tanvi Akuthota Members Absent: Vice Chair John Stutzman Staff Present: Jamie Marsh, Environmental Resource Specialist Visitors: None Call to Order The meeting was called to order at 6:01 p.m. Minutes The commissioners reviewed the minutes. Commissioner Pengelly moved to approve the minutes, and Commissioner Elhadi seconded. The motion passed 6-0. Discussion Items 1. Communication Strategies The commission discussed using flash vote as a way to seek input to guide topics for the commission events. The flash vote is a tool that is used very conservatively by the city. The commissioners discussed that a potential question could be centered around, “how many people are aware of the Environmental Commission.” One option could be to collaborate with other commissions to aid in receiving approval for the flash vote. The questions need to be crafted intentionally to gather information that is helpful. The commission expressed interest in getting to know the other commissions. Ms. Marsh suggested revisiting the subject in May. 2. Arbor Day Planning Ms. Marsh announced that this year’s tree planting event will be at South Lotus Lake Park on Saturday, May 2 at 9 a.m. This park was selected due to recent ash tree removals and a trail project. This year, the trees will be in containers rather than bare root. The event begins with a planting demonstration, followed by the tree plantings. The commissioners arrive early for preparations. Usually about 20 trees are planted. They discussed the campaign to advertise the event, and ways to reach out to youth groups and service groups to invite volunteers. Light refreshments are provided. They will bring milkweed seed bombs, frisbees and tree seedlings. The intent is to keep the event simple and focused on tree planting. 53 Commission Presentations: Chair Grefe advised that he was on the interview panel, but nobody was appointed to the Environmental Commission. The commissioners discussed the process. The next round of applicants will be interviewed March 23. Chair Grefe isn’t available to attend. Vice Chair Stutzman will be invited, and Commissioner Pengelly is able to attend if he is not available. Upcoming Items and Events Ms. Marsh shared that she is working to secure a date for the next Environmental Trivia. Once the date and location are secured, the questions and prizes are in place. The Arbor Day poster contest is coming up. The July 3 Business Expo will be discussed at a future meeting. The spring paper shredding and garden tool swap events are both scheduled for May. Chair Grefe and the other commissioners thanked Commissioner Elhadi for her years of service on the commission. Today is her final meeting. Adjournment Commissioner Elhadi moved to adjourn the meeting. The motion was carried, and the meeting adjourned at 6:59 p.m. Minutes prepared by Amy Weidman, Senior Administrative Support Specialist Minutes Submitted by Jamie Marsh, Environmental Resource Specialist 54 City Council Item April 27, 2026 Item Receive Planning Commission Minutes dated April 7, 2026 File No.Item No: D.4 Agenda Section CONSENT AGENDA Prepared By Amy Weidman, Senior Admin Support Specialist Reviewed By SUGGESTED ACTION "The Chanhassen City Council receives the Planning Commission minutes dated April 7, 2026." Motion Type Simple Majority Vote of members present Strategic Priority N/A SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION The City Council receives the Planning Commission minutes dated April 7, 2026. ATTACHMENTS 55 Planning Commission minutes dated April 7, 2026 56 CHANHASSEN PLANNING COMMISSION REGULAR MEETING MINUTES APRIL 7, 2026 CALL TO ORDER: Chair Noyes called the meeting to order at 6:00 p.m. MEMBERS PRESENT: Chair Eric Noyes, Steve Jobe, Jeremy Rosengren, Ryan Soller, and Dave Grover. MEMBERS ABSENT: Mike Olmstead and Katie Trevena. STAFF PRESENT: Rachel Arsenault, Associate Planner; Jenny Potter, City Clerk; and Eric Maass, Community Development Director. PUBLIC PRESENT: Steve and Wendy Buresh 6651 Galpin Boulevard Nolan Lepel 123 2nd Ave Northwest Al Steinhagen 8815 Tiller Avenue Jason Kleinprintz MGM Vernelle Clayton Market Square ADMINISTRATIVE PRESENTATIONS: 1. PLANNING COMMISSION APPOINTMENT & OATH OF OFFICE City Clerk Jenny Potter administered the oath of office for Eric Noyes and Steve Jobe for a three-year term ending March 31, 2029. 2. ELECTION OF CHAIR AND VICE-CHAIR Commissioner Soller moved, Commissioner Rosengren seconded that the Chanhassen Planning Commission motions to elect Eric Noyes as Chair and Steve Jobe as Vice Chair. All voted in favor and the motion carried unanimously with a vote of 5 to 0 3. ADOPTION OF BYLAWS Community Development Director Eric Maass gave a summary of the revision to the bylaws to modify the meeting curfew from 10:30 p.m. to 9:00 p.m. Commissioner Jobe moved, Commissioner Grover seconded that the Chanhassen Planning Commission adopts the 2026 City of Chanhassen Planning Commission bylaws. All voted in favor and the motion carried unanimously with a vote of 5 to 0. 57 Planning Commission Minutes – April 7, 2026 2 PUBLIC HEARINGS: 1. CONSIDER A REQUEST TO REZONE THE PROPERTY LOCATED AT 6651 GALPIN BOULEVARD FROM RURAL RESIDENTIAL TO SINGLE-FAMILY RESIDENTIAL Associate Planner Rachel Arsenault reviewed the rezoning request for 6651 Galpin Boulevard. She noted that the present zoning was rural residential, and the lot was 2.5 acres and heavily wooded. She said that the rezoning request was to move from rural residential to single-family residential. She noted that the single-family residential district (RSF rezoning request matched the 2040 Comprehensive Plan. She said that the staff reviews the rezoning request according to six different criteria and this proposal met the requirements of City Code. Chair Noyes opened the public hearing. There were no public comments. Chair Noyes closed the public hearing. Commissioner Grover moved, Commissioner Jobe seconded that the Chanhassen Planning Commission recommends that the City Council approve rezoning the property located at 6651 Galpin Boulevard from Rural Residential to Single-Family Residential. All voted in favor and the motion carried unanimously with a vote of 5 to 0. 2. CONSIDER A CONDITIONAL USE PERMIT FOR A CONTRACTOR’S YARD AT 1480 PARK ROAD Mrs. Arsenault reviewed the proposed site plan from the applicant for a contractor’s yard at 1480 Park Road. She said a new fence and landscaping screening were required to meet the F4 and buffer yard D requirements. She explained that the fence should be placed behind the curb, should be 8 feet tall and 95% opaque. She said that the applicant proposed a new sumped catch basin to capture sediment prior to discharging off-site, which would require O&M approval. She noted the additional pavement improvements, curb, gutter, and new stripping, and said that five trees would be removed and replaced on site. She explained that the staff reviewed the City Code Section 20-289 contracting yard requirements, this proposal met the requirements of City Code. Commissioner Rosengren asked about lighting requirements from a previous project at 2100 Stoughton and if the same would apply in this instance. Mrs. Arsenault responded that the City of Chaska bordered 2100 Stoughton on three sides, so as a condition it was required to align with their City Code as well as Chanhassen City Code. Chair Noyes asked if there were inspections of storage yards to make sure that the requirements are being met. Mrs. Arsenault answered that a conditional use permit requires a yearly inspection, completed by city staff. Commissioner Jobe asked about the six-foot high fence at a different property and what the standard fence size was for a contractor yard. Mr. Maass responded that the other property also had an 8-foot-tall fence requirement. 58 Planning Commission Minutes – April 7, 2026 3 Chair Noyes opened the public hearing. There were no public comments. Chair Noyes closed the public hearing. Commissioner Soller asked if there was a diversity requirement for the trees that would be planted. Mrs. Arsenault answered that diversity requirements apply to this project. Commissioner Soller asked if that would be a part of the conditions. Mrs. Arsenault confirmed this information. Commissioner Rosengren moved, Commissioner Grover seconded that the Chanhassen Planning Commission recommends approval of the conditional use permit for a contractor’s yard at 1480 Park Road, subject to staff conditions. All voted in favor and the motion carried unanimously with a vote of 5 to 0. 3. ORDINANCE XXX: AMENDING CHAPTERS 1 AND 20, UPDATING SIGN DEFINITIONS AND REGULATIONS Mrs. Arsenault reviewed the sign code change proposals and noted that the first four proposed changes were reviewed on March 3. She stated that the next three proposed changes were identified and addressed after the meeting. She said that the expanded signage opportunities would expand the ability to add awnings, canopies, and projecting signs to all commercial zoning districts. She clarified the definitions for window sign and window covering. She provided example photos of a window sign, a window covering, and a combination of the two for future application. She provided an overview of the proposed code for both. Chair Noyes asked if the changes addressed the issues discussed at the March 3 meeting. Commissioner Jobe responded that the changes addressed the issues. Commissioner Jobe asked for clarification on the 30% for non-window cover and if it was for the total window space. Mrs. Arsenault answered that 30% was the windowpane in which the sign was located. Commissioner Grover asked if the window sign shown in the example would be allowed. Mrs. Arsenault responded that if it were replaced, it would have to be decreased to 30%, but it could continue currently as lawfully non-conforming. Commissioner Grover asked if someone only had one window and how the rules applied. Chair Noyes clarified the amount for the square footage of larger and smaller windows. Mr. Maass said that if a business only had one window, they would round up based on code, allowing a sign on the window. Chair Noyes clarified that the Med Box Grill photo was one window, the Total Wine was one window, and the combination photo was three windows. Mr. Maass confirmed this information. 59 Planning Commission Minutes – April 7, 2026 4 Mrs. Arsenault said a company could still have window coverings to screen certain items or uses. Chair Noyes said that if the retailer or designer was brought into conversation to clarify window amounts, it would be adequate. He thought there was a lack of clarity about the definitions of a window. Commissioner Grover asked if there was a mechanism for a variance. Mr. Maass responded that a variance would not be applicable because there would likely not be a practical difficulty. If they had a unique situation, an applicant could apply for a zoning code amendment. Commissioner Jobe asked if they could clarify what would constitute a window by including language about an inner-pane divider. Mr. Maass explained what they determined made a window for staff. Commissioner Jobe asked about how the process would play out to determine what would constitute a window. Mr. Maass answered that they would use building permit records. Commissioner Soller discussed allowing non-conformities to remain, and if there was a final decision for a safe harbor line. He noted that he did not want to impact current businesses that have already designed items for the window, especially if they just needed to make a small change. Mrs. Arsenault responded that if a business did anything beyond repair, face change, or maintenance, the window would have to come into compliance with city standards. Commissioner Soller stated he did not want businesses to be put under any hardships. Commissioner Grover asked if it was maintenance to replace signage that was like-for-like. Mrs. Arsenault answered that maintenance would be replacing a small portion of the sign. She said that the window cling would be determined if it were a smaller, minuscule replacement like a missing letter. Commissioner Soller proposed allowing like-for-like replacement for businesses with existing signage, unless it is not used for over a year. Mrs. Arsenault noted that the lawful non-conforming code that applies to the rest of Section 20 would allow a sign to be changed out and the square footage to be the same. She said that the content could change but would be allowed to utilize the size. Commissioner Soller asked if that was a separate piece. Mrs. Arsenault answered that it was the lawful non-conforming code. She said that the current sign-code carves out its own lawful non- conforming code. Commissioner Soller asked for clarification. Mrs. Arsenault responded that the code that regulates the Moe’s sign was under the sign article, which had its own lawful non-conforming replacement code. 60 Planning Commission Minutes – April 7, 2026 5 Mr. Maass responded that they had to determine if they would want to be less restrictive than what was currently written. Commissioner Soller asked if they could just rely on the Section 20 non-conforming language. Mrs. Arsenault answered that any square footage that was currently held would be allowed to be used moving forward if they changed the language. Mr. Maass stated that signs were more often to turn over, instead of buildings. He suggested including the carve-out in the code because of the longevity differences. Chair Noyes opened the public hearing. Jason Kleinprintz, owner of MGM, said he was not sure how many windows he had, and what was considered a window. He stated they rely on signs to go across multiple windows to share that they are locally owned and operated, and when they have deals. He asked about the purpose of the change. He stated that the window signs block the back of the shelves he has in his store. He voiced opposition to making changes and expressed a desire to continue to use the windows as he does. Vernelle Clayton, manager of Market Square, said she wanted to protect the businesses and tenants that moved into the buildings. She said that signs were a huge need for businesses. She stated that the second example that they provided was not actually a window, and it was requested by the city because the city did not like that they had no windows. She stated that a lot of progress had been made since the last meeting. She asked about the lumen requirements for lights at night and how much it would cost for business owners. She asked if it was necessary unless the business was facing a residential area. She suggested allowing for signage on the awning or a projecting sign. Mr. Maass clarified that they included the ability for projecting and awning signs to be in all districts. He stated that the reduction of wall signs was only applicable to the downtown zoning district. Chair Noyes closed the public hearing. Commissioner Soller asked about the event of a subjective concern, and the staff would defer. He asked if this was the case and if it was acceptable since there is no appeals process. Mrs. Arsenault answered that the Planning staff and director make the determination, but if the property owners did not agree on the interpretation, they could bring the information before the City Council for appeal. Chair Noyes suggested taking the three examples and clarifying how many windows were present in each photo, so business owners could have a better understanding. Commissioner Soller discussed the window covering definition and the MGM example, which required screening to meet regulatory requirements. He said that window coverings could be used for screening or privacy and should comply with design standards. He asked if there was 61 Planning Commission Minutes – April 7, 2026 6 anything that prevented the content in the ordinance, such as what MGM had to do with the window coverings. The window coverings were used for more than just coverings, but were descriptive. He thought this was acceptable, since the windows were required to be covered anyway. He asked if there were restrictions for other business owners when it was not a requirement for screening or privacy. He asked how much advertising and design could go into a covering that would give an unfair advantage. Chair Noyes suggested they might need another paragraph that provided details about combinations between window signs and window coverings. Mrs. Arsenault answered that the white box in the combination example is what split the difference between a window sign and window covering due to the definition of window sign as the extreme limits of the message. Commissioner Jobe asked if they put an image, it would be a window covering rather than a window sign. Mrs. Arsenault responded that if there were images, they would be window coverings. Commissioner Soller asked why they would restrict content on coverings. Mr. Maass responded that they should detach the two. He said a window covering was a window covering and a window sign was a window sign. He asked if 50% of the windows and the 30% area would be something that the Planning Commission would support. Commissioner Rosengren responded that he supported the percentage-based language. He said it may need to be adjusted in the future based on feedback from the residents or business owners. He mentioned that they would need to think about unfairness, as the liquor store with the requirement to have screening would be allowed to have more signage. Chair Noyes clarified that the signage percentage would be restricted in the same way, even if they were not using a covering for their windows. He said that some of the coverings might transmit a message to a user even if they were not a sign. Commissioner Jobe asked if portable signs that could sit on the sidewalk could be allowed and what the criteria would be. Mrs. Arsenault answered that they were allowed and had requirements for sizing. She said they would have to adhere to the City Code for temporary signage. Commissioner Grover said he struggled with the percentage limitations for signs, as larger windows would allow for larger advertisements. He encouraged flexibility to ensure it would be fair so that it could work for all businesses. Mr. Maass responded that they were trying to adjust for those who had larger windows. He stated that businesses had the choice to pick out their space when renting facilities. Commissioner Jobe asked if other cities had percentage base. Mr. Maass responded that percentages ranged from 30-50% in other communities, but some allow for square footage. Commissioner Soller asked if the definition of sign in the code would mean that a window covering is anything but blank; it would be defined as a sign. Mrs. Arsenault answered that she 62 Planning Commission Minutes – April 7, 2026 7 would discourage specific requirements, since the sign definition is connected to First Amendment concerns. They must focus on the construction of the sign rather than the content of the sign. Commissioner Soller clarified that the item in the middle was a window covering. Mrs. Arsenault answered that the item in the middle was a window covering for screening purposes. Commissioner Grover asked if it could be considered a window covering if it was not a window. Mr. Maass responded that the city staff would consider the example a window, although it was not traditional. He said the architectural standards were to look and act like a window, although it does not function as one. Commissioner Rosengren asked if they were trying to make a definition of a symbol or an image on the covering. He asked about the transition. Commissioner Soller provided an example of window coverings that had a logo for beer. He asked if that would be an example of a non-conforming window covering. Commissioner Jobe said that they were getting into the weeds, since there is a process for review. He stated that there would be one-offs that would occur, and they cannot write rules to address every situation. They needed to get 95% of it right, and the 5% could go before the City Council. Commissioner Soller stated that unless there was a clear interpretation, for example, like Top Ten Liquor or MGM. He asked if those would be non-conforming. Mr. Maass responded that Top Ten Liquor would likely be non-conforming because what was shown in the window would constitute a sign. He said if the sign ordinance were written to rely on the non-conforming standards from general Chapter 20 rather than the nonconforming sign code, they would remain and could be replaced as-is. Commissioner Soller clarified that if Top Ten Liquor wanted to get rid of one logo on a window, they could not replace it with another logo sign. Mr. Maass confirmed this information. Commissioner Jobe suggested hitting right in the middle of the 30-50% size for the signage. Mr. Maass answered that they were trying to strike a balance between windows serving as windows versus another surface as a sign. They wanted to strike a balance between how many signs were on a building façade, but they were open to increasing the amount to 40%. Commissioner Jobe clarified that the 40% was a maximum. Mr. Maass responded that they typically see people go to the maximum amount. Commissioner Soller said he was not repulsed by the non-conforming sign options. Chair Noyes asked if he thought there would be a hardship on these businesses that would have non-conforming signs. He stated that a good percentage of advertisements have a lifespan. 63 Planning Commission Minutes – April 7, 2026 8 Commissioner Soller said if people normally utilize their maximum, it sounds like that was what the public was asking for. Chair Noyes asked where Commissioner Soller was leaning. Commissioner Soller responded that he was leaning toward striking the percentage language completely, and what that would look like, or if they were twice as large. He asked if it was better for consumers, because signage and advertising help consumers. Chair Noyes stated that 50% had been suggested for coverage as well, but there was a question of how many windows could have signs. He asked if they wanted to move both numbers. Commissioner Soller responded that he would move both numbers. He said there was no detriment to how Top Ten Liquor currently looked. He did not know how many non-conforming situations they would create overnight. Commissioner Rosengren asked if the City Council struggled with the same conversations. Mr. Maass responded that it took multiple conversations with the City Council, so they did struggle. He said that the City Council did not have a strong opinion about lawful non-conforming, and they were looking to the Planning Commission for feedback. Commissioner Rosengren said that the Planning Commission did not have a clear answer. Commissioner Jobe stated that if they force a change, they will see different types of advertising. He commented that they had an intended purpose of making the city look similar. They needed to decide something by the end of the day. Mr. Maass responded that currently businesses could not have projecting signage or canopy signage, but they could have these signs with this change. He stated he did not want them to miss the additional signage opportunities with the ordinance. Commissioner Jobe suggested additional conversations about the percentage. He said that 50% would be the most lenient they could get, and if the City Council did not agree with it, they could change it. Commissioner Soller stated that everything was passive enforcement. He thought that 50% seemed more straightforward. Mr. Maass responded that the city is on a complaint basis for enforcement, but signage requires permits, so there would be a check at that stage. He clarified that window signs would not require a permit. Mrs. Arsenault answered that window signage would be allowed without a permit in this proposed ordinance. Commissioner Grover said that he wanted to support 50% to allow for more flexibility for businesses. Commissioner Rosengren said that he was comfortable with the 50% number, and the City Council could review the minutes to see the feedback and concerns. 64 Planning Commission Minutes – April 7, 2026 9 Commissioner Jobe stated he was comfortable with the 50%, and if it was not a desired feature, businesses would not utilize the signs. Commissioner Soller said that today, it was square footage across all the windows. Mrs. Arsenault confirmed this information. Commissioner Soller stated he was trying to determine if it would be more or less restrictive. Chair Noyes reminded that they were only considering the downtown, and he guessed that they were trying to protect the aesthetics of downtown. Commissioner Soller asked about the future state of the code for electronic messaging signs. He said that the electronic messaging signs would give more rights to public signs and gas station signs. He asked if that was based on content and if there would be any risks associated with the restrictions. Mrs. Arsenault responded that EMC signs were allowed for governmental property, but they were banned everywhere else in the city. She said that motor fuel signs were written out of the definition of EMC signs, but they had to reinstate them due to their construction being EMC signs. They would no longer be called motor fuel signs, as it would be judging them based on the content they were showing. They were regulated by what property was installing the signs, which would be gas stations. She said it would go off the property uses rather than the content of the signs. Commissioner Jobe asked if a liquor store could put an EMC sign up in front of its store. Mrs. Arsenault answered that it was limited to motor fuel stations and government property. The application was the same as the prior code. Commissioner Soller voiced concerns about identifying what signs could be used by business type, because it still seemed connected to the content. He did not know why the government could do different things with its signs than anyone else. Chair Noyes said that the carveouts were likely done in other cities, so it did not seem extraordinary. Commissioner Grover stated that he could see the justification for the electronic messaging signs for gas stations because gas prices change frequently, and consumers want to easily see the gas prices. Commissioner Soller said it did not specify what gas stations could put up on the sign, but they cannot regulate it because then it becomes content. He thought it was a challenge. He expressed a desire to move forward. Commissioner Jobe asked if the size of the sign only allowed them to display certain items. Mr. Maass responded that they were allowing EMCs by use and not by store type. He said they could regulate the size of the area that could have a message, but they could not regulate what the sign would say. 65 Planning Commission Minutes – April 7, 2026 10 Commissioner Grover asked if electronic signs with images were considered EMCs, such as Culver's. Mrs. Arsenault answered that they were EMCs and if they were to ever to reconstruct, they would have to get rid of the EMC sign. Mr. Maass provided an example of a popular sign of an EMC at the American Legion. It was grandfathered in and is a lawful non-conforming. He clarified that he did not see an EMC sign for Culver’s. Chair Noyes asked about the modified language for window sign updates and if it would say that window signs were limited to up to 50% of the window. He requested a motion based on the change. Commissioner Rosengren moved, Commissioner Jobe seconded that the Chanhassen Planning Commission recommend that the Chanhassen City Council adopt the proposed sign ordinance as presented, with the modification that window signs be limited to 50% of the window rather than 30% of the window. The motion was approved with a vote of 4 to 1. Commissioner Soller voted Nay. APPROVAL OF MINUTES: 1. APPROVAL OF PLANNING COMMISSION MINUTES DATED MARCH 17, 2026 Commissioner Soller moved, Commissioner Grover seconded to approve the Chanhassen Planning Commission summary minutes dated March 17, 2026, as presented. All voted in favor, and the motion carried unanimously with a vote of 5 to 0. COMMISSION PRESENTATIONS: CORRESPONDENCE DISCUSSION: OPEN DISCUSSION: Mr. Maass said that they received a PUD Amendment and a Preliminary Plat for Avienda within the retail portion, specifically outlining their grocery area. It was anticipated to go before the Planning Commission in May and to the City Council in June but that those months were only estimates. Chair Noyes asked if that meant a retailer had been proposed for that site. Mr. Maass responded that the application did not name a specific grocery retailer. Commissioner Soller said that bids for the comprehensive plan request for proposal would close in a few days. He asked what they could look forward to in the coming months. Mr. Maass responded that the city had not received any submissions to date, but staff were not concerned, as they had received questions from various firms. They expected to receive a handful of responses, 66 Planning Commission Minutes – April 7, 2026 11 but they would discuss with consulting partners if they did not receive bids and adjust as necessary. Commissioner Soller asked about what role the Planning Commission would play in the process. Mr. Maass responded that each commission would provide feedback on the chapter that was related to their commission. He said that the Planning Commission, as the zoning body for the city, would look at the whole plan prior to it going to City Council. They did not have any specific multi-commission working sessions, but the Planning Commission could form a subcommittee if desired. ADJOURNMENT: Commissioner Grover moved, Commissioner Rosengren seconded to adjourn the meeting. All voted in favor and the motion carried unanimously with a vote of 5 to 0. The Planning Commission meeting was adjourned at 7:59 p.m. Submitted by Eric Maass Community Development Director 67 City Council Item April 27, 2026 Item Receive Economic Development Commission Minutes dated March 10, 2026 File No.Item No: D.5 Agenda Section CONSENT AGENDA Prepared By Amy Weidman, Senior Admin Support Specialist Reviewed By SUGGESTED ACTION "The Chanhassen City Council receives the Economic Development Commission Minutes dated March 10, 2026." Motion Type Simple Majority Vote of members present Strategic Priority N/A SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION ATTACHMENTS 68 Economic Development Commission Minutes dated March 10, 2026 69 CHANHASSEN ECONOMIC DEVELOPMENT COMMISSION REGULAR MEETING MARCH 10, 2026 Chair Anderson called the meeting to order at 5:34 p.m. MEMBERS’ PRESENT: Eric Anderson, John Kroll, Nick Gardino MEMBERS ABSENT: David Benedict, Luke Bame STAFF PRESENT: Samantha DiMaggio, Economic Development Manager, and Rachel Arsenault, Associate Planner. PUBLIC PRESENT: APPROVAL OF AGENDA: APPROVE ECONOMIC DEVELOPMENT COMMISSION AGENDA DATED MARCH 10, 2026 Commissioner Gardino moved, and Commissioner Kroll seconded to approve the Agenda of the Economic Development Commission meeting dated March 10, 2026, as presented. All voted in favor, and the motion was carried unanimously with a vote of 3 to 0. APPROVAL OF MINUTES: APPROVE ECONOMIC DEVELOPMENT COMMISSION MINUTES DATED NOVEMBER 18, 2025 Commissioner Kroll moved, and Commissioner Gardino seconded to approve the Minutes of the Economic Development Commission meeting dated February 10, 2026, as presented. All voted in favor, and the motion was carried unanimously with a vote of 3 to 0. VISITOR PRESENTATIONS: REVIEW OF THE PROPOSED SIGN CODE ORDINANCE DISCUSSION/GENERAL BUSINESS ITEMS: ADJOURNMENT: Commissioner Gardino moved, and Commissioner Kroll seconded to adjourn the meeting. All voted in favor, and the motion was carried unanimously with a vote of 3 to 0. The Economic Development Commission meeting was adjourned at 6:32 p.m. Submitted by Samantha DiMaggio Economic Development Manager 70 City Council Item April 27, 2026 Item Approve Claims Paid dated April 27, 2026 File No.Item No: D.6 Agenda Section CONSENT AGENDA Prepared By Danielle Washburn, Assistant Finance Director Reviewed By Kelly Grinnell SUGGESTED ACTION "The Chanhassen City Council Approves Claims Paid dated April 27, 2026." Motion Type Simple Majority Vote of members present Strategic Priority Financial Sustainability SUMMARY BACKGROUND DISCUSSION The following claims are submitted for review and approval on April 27, 2026: Total Claims $1,145,649.23 BUDGET RECOMMENDATION 71 ATTACHMENTS Payment Summary Payment Detail 72 Accounts Payable Checks by Date - Summary Vendor Name Check Date Void Checks Check Amount Ana Fatturi 04/08/2026 0.00 276.44 CCP NI MASTER TENANT 4 LLC 04/08/2026 0.00 4,039.79 CenturyLink 04/08/2026 0.00 64.00 Enterprise FM Trust 04/08/2026 0.00 35,532.80 GoTo Communications Inc 04/08/2026 0.00 2,780.41 Metronet Holdings, LLC 04/08/2026 0.00 56.61 MN DEPT OF HEALTH 04/08/2026 0.00 550.00 Potentia MN Solar 04/08/2026 0.00 7,567.12 SUBURBAN RATE AUTHORITY 04/08/2026 0.00 3,048.00 Thomas Erdmann 04/08/2026 0.00 157.25 Tyler Vickerman 04/08/2026 0.00 130.00 VERIZON WIRELESS 04/08/2026 0.00 4,129.41 XCEL ENERGY INC 04/08/2026 0.00 1,539.60 4 Paws Animal Control 04/09/2026 0.00 175.00 Abdo LLP 04/09/2026 0.00 24,000.00 All Truck & Trailer Parts 04/09/2026 0.00 6,320.34 Allegra Print & Imaging 04/09/2026 0.00 852.00 CivicPlus 04/09/2026 0.00 3,965.50 Commercial Plumbing & Heating 04/09/2026 0.00 30.06 COMPUTER INTEGRATION TECHN. 04/09/2026 0.00 2,550.40 Cozen O'Connor 04/09/2026 0.00 999.50 DELEGARD TOOL COMPANY 04/09/2026 0.00 33.25 ECM PUBLISHERS INC 04/09/2026 0.00 856.40 Guard Guys, LLC 04/09/2026 0.00 111.80 Houston Engineering Inc 04/09/2026 0.00 789.50 Infosend, Inc 04/09/2026 0.00 3,635.48 Juli Al-Hilwani 04/09/2026 0.00 412.50 Keys Well Drilling Co 04/09/2026 0.00 45,752.00 Kurilla Contracting Company 04/09/2026 0.00 61,773.75 Lano Equipment 04/09/2026 0.00 62,959.04 LVC Companies Inc 04/09/2026 0.00 2,974.09 Macqueen Emergency Group 04/09/2026 0.00 1,179.08 METROPOLITAN COUNCIL 04/09/2026 0.00 264,887.91 Midwest Pump Works 04/09/2026 0.00 49.00 Minnesota Ground Control LLC 04/09/2026 0.00 13,683.67 MINNESOTA PETROLEUM SERVICE INC 04/09/2026 0.00 228.00 MN DEPT OF LABOR AND INDUSTRY 04/09/2026 0.00 3,892.87 MN TRUCKING ASSOCIATION 04/09/2026 0.00 410.37 NAPA AUTO & TRUCK PARTS 04/09/2026 0.00 185.99 Oneloveyoga 04/09/2026 0.00 300.00 P & L AUTOMOTIVE 04/09/2026 0.00 400.00 Perfection Plus, Inc 04/09/2026 0.00 105.79 PUMP AND METER SERVICE INC 04/09/2026 0.00 27,603.22 SEH 04/09/2026 0.00 28,439.63 Page 1 of 3 73 Vendor Name Check Date Void Checks Check Amount Sports Facilities Companies LLC 04/09/2026 0.00 10,000.00 Springbrook 04/09/2026 0.00 375.30 SUMMIT FIRE PROTECTION 04/09/2026 0.00 858.00 TBEI, Inc 04/09/2026 0.00 138,384.00 TK Elevator Corporation 04/09/2026 0.00 8,155.90 WSB & ASSOCIATES INC 04/09/2026 0.00 39,783.55 WW GRAINGER INC 04/09/2026 0.00 2,132.53 Zoho Corporation 04/09/2026 0.00 270.00 8170 UPLAND CIRCLE LLC 04/15/2026 0.00 1,382.70 ALL AMERICAN TITLE COMPANY LLC 04/15/2026 0.00 434.59 CENTERPOINT ENERGY MINNEGASCO 04/15/2026 0.00 25.14 CHRISTOPHER MCGINTY 04/15/2026 0.00 66.40 DONALD SINGER 04/15/2026 0.00 49.60 EDINA REALTY TITLE 04/15/2026 0.00 33.28 EMILY CALLAHAN 04/15/2026 0.00 650.11 FLEX TITLE COMPANY 04/15/2026 0.00 35.92 GREGORY JOHN HENKEL 04/15/2026 0.00 67.98 JOSEPH WELU 04/15/2026 0.00 960.93 Kelly Hance 04/15/2026 0.00 200.00 LISA KANGAS 04/15/2026 0.00 5.27 Marco Inc 04/15/2026 0.00 1,110.00 MARK & ALEISA SPAIN 04/15/2026 0.00 14.09 MASON R. MCCLELLAN 04/15/2026 0.00 37.13 Metronet Holdings, LLC 04/15/2026 0.00 106.50 MICHAEL T. & KIMBERLY WALKER 04/15/2026 0.00 55.90 MN Board of Water and Soil Resources 04/15/2026 0.00 2,033.71 NOVEL SOLAR THREE, LLC 04/15/2026 0.00 8,034.45 PAUL & ALISON RYAN 04/15/2026 0.00 41.81 SCOTT & JULIE BERGQUIST 04/15/2026 0.00 83.76 SCU PROPERTY 4, LLC 04/15/2026 0.00 14.58 SONJA F. LEINES 04/15/2026 0.00 37.41 Thomas Erdmann 04/15/2026 0.00 330.27 TITLESMART 04/15/2026 0.00 8.96 TRADEMARK TITLE SERVICES 04/15/2026 0.00 164.24 WATERMARK TITLE AGENCY 04/15/2026 0.00 117.55 ACTA MN - Chanhassen LLC 04/16/2026 0.00 1,423.26 ALLDATA LLC 04/16/2026 0.00 1,500.00 ARAMARK Refreshment Services, LLC 04/16/2026 0.00 1,649.27 BENEFIT EXTRAS INC 04/16/2026 0.00 325.50 BOLTON & MENK INC 04/16/2026 0.00 2,270.50 BOUND TREE MEDICAL LLC 04/16/2026 0.00 1,688.86 BS & A Software 04/16/2026 0.00 10,845.00 Carver County 04/16/2026 0.00 2,525.00 CENTURY 2000 PARTNERS LLP 04/16/2026 0.00 7,455.00 Chappell Central Inc 04/16/2026 0.00 7,197.12 Cintas Corporation No. 2 04/16/2026 0.00 90.82 CITY OF EDEN PRAIRIE 04/16/2026 0.00 2,000.00 COMPUTER INTEGRATION TECHN. 04/16/2026 0.00 1,236.80 CORE & MAIN LP 04/16/2026 0.00 4,455.00 Creative Concrete, Inc 04/16/2026 0.00 500.00 DEM-CON LANDFILL 04/16/2026 0.00 477.28 DISPLAY SALES COMPANY 04/16/2026 0.00 1,275.72 ECM PUBLISHERS INC 04/16/2026 0.00 209.10 Page 2 of 3 74 Vendor Name Check Date Void Checks Check Amount Ferguson Waterworks #2518 04/16/2026 0.00 771.43 Game One 04/16/2026 0.00 3,082.56 GOPHER STATE ONE-CALL INC 04/16/2026 0.00 469.80 GRANICUS INC 04/16/2026 0.00 9,217.74 GRAYBAR 04/16/2026 0.00 838.80 GS DIRECT INC 04/16/2026 0.00 224.79 Hagberg Home Service LLC 04/16/2026 0.00 500.00 HUELIFE 04/16/2026 0.00 5,575.00 I & S Group, Inc 04/16/2026 0.00 3,742.50 INDEPENDENT SCHOOL DIST 112 04/16/2026 0.00 16,742.18 Indigo Signs 04/16/2026 0.00 157.95 Infosend, Inc 04/16/2026 0.00 3,958.91 Jennifer Xuan Tuyet Doan-Nguyen 04/16/2026 0.00 474.42 John & Leigh Meyer 04/16/2026 0.00 500.00 KELLINGTON CONSTRUCTION 04/16/2026 0.00 159,885.00 KIMLEY HORN AND ASSOCIATES INC 04/16/2026 0.00 26,475.00 LEAGUE OF MN CITIES INS TRUST 04/16/2026 0.00 4,801.40 MERLINS ACE HARDWARE 04/16/2026 0.00 325.65 NAPA AUTO & TRUCK PARTS 04/16/2026 0.00 106.14 NvoicePay 04/16/2026 0.00 712.70 O'Reilly Automotive Inc 04/16/2026 0.00 195.53 Outdoor Link Inc 04/16/2026 0.00 1,770.16 PATCHIN MESSNER 04/16/2026 0.00 1,896.25 PDCM/SCSU-DDP 04/16/2026 0.00 453.00 PLAYPOWER LT FARMINGTON 04/16/2026 0.00 1,645.00 PRECISE MRM LLC 04/16/2026 0.00 315.00 Premium Waters, Inc 04/16/2026 0.00 4.38 Ready Watt Electric 04/16/2026 0.00 5,715.00 Rent N Save Portable Services 04/16/2026 0.00 1,544.05 ROADKILL ANIMAL CONTROL 04/16/2026 0.00 477.00 Scott Renn 04/16/2026 0.00 500.00 SRF CONSULTING GROUP INC 04/16/2026 0.00 128.73 SUBURBAN CHEVROLET 04/16/2026 0.00 41.86 TimeSaver Off Site Secretarial, Inc 04/16/2026 0.00 575.50 TRAFFIC CONTROL CORPORATION 04/16/2026 0.00 4,800.00 Travis Ott 04/16/2026 0.00 474.42 USA BLUE BOOK 04/16/2026 0.00 1,752.08 Waste Management of Minnesota, Inc 04/16/2026 0.00 1,569.40 WW GRAINGER INC 04/16/2026 0.00 616.54 Report Total:1,145,649.23 Page 3 of 3 75 AP Check Detail User: dwashburn@chanhassenmn.gov Printed: 4/21/2026 10:01:22 AM Last Name Acct 1 Amount Check Date Description 4 Paws Animal Control 101-1210-4300 175.00 4/9/2026 Animal impounds 175.00 4/9/2026 4 Paws Animal Control 175.00 8170 UPLAND CIRCLE LLC 720-0000-2020 1,380.89 4/15/2026 Refund Check 105683-000, 8170 UPLAND CIRCLE 8170 UPLAND CIRCLE LLC 700-0000-2020 1.81 4/15/2026 Refund Check 105683-000, 8170 UPLAND CIRCLE 1,382.70 4/15/2026 8170 UPLAND CIRCLE LLC 1,382.70 Abdo LLP 700-0000-4301 8,000.00 4/9/2026 Audit services Abdo LLP 701-0000-4301 8,000.00 4/9/2026 Audit services Abdo LLP 720-0000-4301 4,900.00 4/9/2026 Audit services Abdo LLP 101-1130-4301 3,100.00 4/9/2026 Audit services 24,000.00 4/9/2026 Abdo LLP 24,000.00 ACTA MN - Chanhassen LLC 101-1538-4343 1,423.26 4/16/2026 Q1 Tae Kwon Do Pederson 1,423.26 4/16/2026 ACTA MN - Chanhassen LLC 1,423.26 Al-Hilwani Juli 101-1530-4347 412.50 4/9/2026 Personal Training AP - Check Detail (4/21/2026)Page 1 of 30 76 Last Name Acct 1 Amount Check Date Description 412.50 4/9/2026 Al-Hilwani Juli 412.50 ALL AMERICAN TITLE COMPANY LLC 700-0000-2020 121.27 4/15/2026 Refund Check 096059-000, 1535 HEMLOCK WAY ALL AMERICAN TITLE COMPANY LLC 720-0000-2020 64.27 4/15/2026 Refund Check 096059-000, 1535 HEMLOCK WAY ALL AMERICAN TITLE COMPANY LLC 701-0000-2020 242.84 4/15/2026 Refund Check 096059-000, 1535 HEMLOCK WAY ALL AMERICAN TITLE COMPANY LLC 700-0000-2020 6.21 4/15/2026 Refund Check 096059-000, 1535 HEMLOCK WAY 434.59 4/15/2026 ALL AMERICAN TITLE COMPANY LLC 434.59 All Truck & Trailer Parts 101-1320-4140 6,320.34 4/9/2026 #103 Differential 6,320.34 4/9/2026 All Truck & Trailer Parts 6,320.34 ALLDATA LLC 101-1160-4207 1,500.00 4/16/2026 Subscription-AllData Repair 1,500.00 4/16/2026 ALLDATA LLC 1,500.00 Allegra Print & Imaging 101-1120-4110 852.00 4/9/2026 Postcard Perfed 2-up Templates 852.00 4/9/2026 Allegra Print & Imaging 852.00 ARAMARK Refreshment Services, LLC 101-1120-4113 214.18 4/16/2026 Bevi ARAMARK Refreshment Services, LLC 101-1120-4112 612.50 4/16/2026 City Hall Coffee ARAMARK Refreshment Services, LLC 101-1120-4112 209.74 4/16/2026 Fire Station Coffee Order ARAMARK Refreshment Services, LLC 101-1120-4112 462.85 4/16/2026 PW Coffee ARAMARK Refreshment Services, LLC 101-1120-4113 150.00 4/16/2026 Bevi Rental AP - Check Detail (4/21/2026)Page 2 of 30 77 Last Name Acct 1 Amount Check Date Description 1,649.27 4/16/2026 ARAMARK Refreshment Services, LLC 1,649.27 BENEFIT EXTRAS INC 101-1120-4351 105.00 4/16/2026 Cobra qualifying letters BENEFIT EXTRAS INC 101-1120-4351 130.95 4/16/2026 Tax Advantage Plan-April May & June BENEFIT EXTRAS INC 101-0000-2012 89.55 4/16/2026 Cobra admin/retiree billing 325.50 4/16/2026 BENEFIT EXTRAS INC 325.50 BERGQUIST SCOTT & JULIE 720-0000-2020 21.70 4/15/2026 Refund Check 014213-000, 1321 LAKE SUSAN HLS DR BERGQUIST SCOTT & JULIE 701-0000-2020 38.62 4/15/2026 Refund Check 014213-000, 1321 LAKE SUSAN HLS DR BERGQUIST SCOTT & JULIE 700-0000-2020 2.09 4/15/2026 Refund Check 014213-000, 1321 LAKE SUSAN HLS DR BERGQUIST SCOTT & JULIE 700-0000-2020 21.35 4/15/2026 Refund Check 014213-000, 1321 LAKE SUSAN HLS DR 83.76 4/15/2026 BERGQUIST SCOTT & JULIE 83.76 BOLTON & MENK INC 701-6053-4303 181.64 4/16/2026 Sanitary @ 8% BOLTON & MENK INC 601-6053-4303 1,362.30 4/16/2026 PMP @ 60% BOLTON & MENK INC 700-6053-4303 227.05 4/16/2026 Water @ 10% BOLTON & MENK INC 720-6053-4303 499.51 4/16/2026 Storm @ 22% 2,270.50 4/16/2026 BOLTON & MENK INC 2,270.50 BOUND TREE MEDICAL LLC 101-1220-4142 1,216.89 4/16/2026 Medical supplies BOUND TREE MEDICAL LLC 101-1220-4144 83.99 4/16/2026 Kneeling pads for CPR classes BOUND TREE MEDICAL LLC 201-0000-4705 387.98 4/16/2026 Blood pressure cuffs 1,688.86 4/16/2026 AP - Check Detail (4/21/2026)Page 3 of 30 78 Last Name Acct 1 Amount Check Date Description BOUND TREE MEDICAL LLC 1,688.86 BS & A Software 101-1160-4236 10,845.00 4/16/2026 Annual Community Dvlp Saas & Cloud Hosting Fee 10,845.00 4/16/2026 BS & A Software 10,845.00 CALLAHAN EMILY 701-0000-2020 228.42 4/15/2026 Refund Check 100025-000, 2961 HIGHWOOD DRIVE CALLAHAN EMILY 700-0000-2020 421.69 4/15/2026 Refund Check 100025-000, 2961 HIGHWOOD DRIVE 650.11 4/15/2026 CALLAHAN EMILY 650.11 Carver County 700-0000-4300 765.00 4/16/2026 Special Assessment entry Carver County 101-1150-4501 660.00 4/16/2026 Special Assessment entry Carver County 101-1210-4300 1,100.00 4/16/2026 Liquor License renewals Background Check 2,525.00 4/16/2026 Carver County 2,525.00 CCP NI MASTER TENANT 4 LLC 700-0000-4320 52.69 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1540-4320 167.56 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1600-4320 13.69 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 700-7019-4320 834.96 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1550-4320 178.65 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1120-1193 57.07 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1550-4320 39.64 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1540-4320 37.06 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 701-0000-4320 134.17 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 700-7019-4320 186.27 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1350-4320 1,394.35 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 701-0000-4320 608.08 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1120-1193 12.63 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 700-0000-4320 11.93 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1350-4320 308.00 4/8/2026 Electric Charges CCP NI MASTER TENANT 4 LLC 101-1600-4320 3.04 4/8/2026 Electric Charges AP - Check Detail (4/21/2026)Page 4 of 30 79 Last Name Acct 1 Amount Check Date Description 4,039.79 4/8/2026 CCP NI MASTER TENANT 4 LLC 4,039.79 CENTERPOINT ENERGY MINNEGASCO 701-0000-4321 25.14 4/15/2026 Gas Charges 25.14 4/15/2026 CENTERPOINT ENERGY MINNEGASCO 25.14 CENTURY 2000 PARTNERS LLP 701-0000-2023 7,455.00 4/16/2026 SAC Refund-Revised Determination Permit 2026-00109 7,455.00 4/16/2026 CENTURY 2000 PARTNERS LLP 7,455.00 CenturyLink 700-0000-4310 32.00 4/8/2026 Telephone & Communication Charges CenturyLink 701-0000-4310 32.00 4/8/2026 Telephone & Communication Charges 64.00 4/8/2026 CenturyLink 64.00 Chappell Central Inc 414-4010-4702 7,197.12 4/16/2026 Pay App #13 Civic Campus 7,197.12 4/16/2026 Chappell Central Inc 7,197.12 Cintas Corporation No. 2 101-1312-4510 90.82 4/16/2026 first aid kits 90.82 4/16/2026 Cintas Corporation No. 2 90.82 CITY OF EDEN PRAIRIE 101-1220-4360 2,000.00 4/16/2026 2026 WAFTA dues AP - Check Detail (4/21/2026)Page 5 of 30 80 Last Name Acct 1 Amount Check Date Description 2,000.00 4/16/2026 CITY OF EDEN PRAIRIE 2,000.00 CivicPlus 101-1160-4207 3,965.50 4/9/2026 Civic Plus annual renewal 3,965.50 4/9/2026 CivicPlus 3,965.50 Commercial Plumbing & Heating 101-1250-3306 30.00 4/9/2026 Plumbing Permit Refund Commercial Plumbing & Heating 101-0000-2022 0.06 4/9/2026 Surcharge - Permit Refund 30.06 4/9/2026 Commercial Plumbing & Heating 30.06 COMPUTER INTEGRATION TECHN.101-1160-4300 2,550.40 4/9/2026 Scale onboarding setup 2,550.40 4/9/2026 COMPUTER INTEGRATION TECHN.101-1160-4300 44.80 4/16/2026 Project management Scale migration COMPUTER INTEGRATION TECHN.101-1160-4211 410.80 4/16/2026 Datto office 365 cloud backup monthly charge COMPUTER INTEGRATION TECHN.101-1160-4300 781.20 4/16/2026 Scale VM project CIP item 1,236.80 4/16/2026 COMPUTER INTEGRATION TECHN. 3,787.20 CORE & MAIN LP 700-0000-4550 4,455.00 4/16/2026 watermain gate valves 4,455.00 4/16/2026 CORE & MAIN LP 4,455.00 Cozen O'Connor 101-1140-4302 999.50 4/9/2026 Professional Fees AP - Check Detail (4/21/2026)Page 6 of 30 81 Last Name Acct 1 Amount Check Date Description 999.50 4/9/2026 Cozen O'Connor 999.50 Creative Concrete, Inc 101-0000-2073 500.00 4/16/2026 Erosion escrow 7166 Alphabet St #706415 500.00 4/16/2026 Creative Concrete, Inc 500.00 DELEGARD TOOL COMPANY 101-1370-4260 33.25 4/9/2026 Caliper 33.25 4/9/2026 DELEGARD TOOL COMPANY 33.25 DEM-CON LANDFILL 101-1550-4300 477.28 4/16/2026 Trash Dump 477.28 4/16/2026 DEM-CON LANDFILL 477.28 DISPLAY SALES COMPANY 101-1550-4120 1,275.72 4/16/2026 Replacement flags (restock) 1,275.72 4/16/2026 DISPLAY SALES COMPANY 1,275.72 ECM PUBLISHERS INC 101-1310-4336 270.60 4/9/2026 26-01 Ad for Bids ECM PUBLISHERS INC 101-1310-4336 487.40 4/9/2026 Market Blvd -Ad for Bids ECM PUBLISHERS INC 101-1310-4336 98.40 4/9/2026 26-05 Ad for Bids 856.40 4/9/2026 ECM PUBLISHERS INC 101-1420-4336 41.00 4/16/2026 Publication of PH for Planning CUP ECM PUBLISHERS INC 101-1310-4336 90.20 4/16/2026 Market Blvd Assessment PH Notice ECM PUBLISHERS INC 101-1420-4336 41.00 4/16/2026 PH Notice Rezoning AP - Check Detail (4/21/2026)Page 7 of 30 82 Last Name Acct 1 Amount Check Date Description ECM PUBLISHERS INC 101-1420-4336 36.90 4/16/2026 PH Notice Sign Code Ord 209.10 4/16/2026 ECM PUBLISHERS INC 1,065.50 EDINA REALTY TITLE 700-0000-2020 1.43 4/15/2026 Refund Check 100500-000, 7639 NICHOLAS WAY EDINA REALTY TITLE 720-0000-2020 2.84 4/15/2026 Refund Check 100500-000, 7639 NICHOLAS WAY EDINA REALTY TITLE 701-0000-2020 18.63 4/15/2026 Refund Check 100500-000, 7639 NICHOLAS WAY EDINA REALTY TITLE 700-0000-2020 10.38 4/15/2026 Refund Check 100500-000, 7639 NICHOLAS WAY 33.28 4/15/2026 EDINA REALTY TITLE 33.28 Enterprise FM Trust 400-0000-4811 13.21 4/8/2026 214 - 22 Chev Silv #25G5D2 Enterprise FM Trust 701-0000-2317 225.12 4/8/2026 307 - 23 Chev Equinox #262P8K Enterprise FM Trust 400-0000-4811 104.04 4/8/2026 602 - 24 Chev Equi #27MF9K Enterprise FM Trust 400-0000-4810 683.78 4/8/2026 501 - 23 Chev Silv #26RL44 Enterprise FM Trust 400-0000-4811 214.32 4/8/2026 430 - 24 Chry Paci #275N63 Enterprise FM Trust 400-0000-4811 176.98 4/8/2026 501 - 23 Chev Silv #26RL44 Enterprise FM Trust 400-0000-4811 116.49 4/8/2026 402 - 23 Chev Silv #25XGMF Enterprise FM Trust 701-0000-4811 80.16 4/8/2026 310 - 24 Chev Silv #27MGR3 Enterprise FM Trust 400-0000-4811 107.11 4/8/2026 416 - 23 Chev Silv #25XGMC Enterprise FM Trust 400-0000-4810 493.83 4/8/2026 001 - 22 Ford Esca #26M3MH Enterprise FM Trust 700-0000-4811 80.17 4/8/2026 310 - 24 Chev Silv #27MGR3 Enterprise FM Trust 400-0000-4811 105.15 4/8/2026 134 - 23 Chev Silv #25WNKR Enterprise FM Trust 701-0000-2317 411.54 4/8/2026 308 - 24 Chev Silv #27RZHT Enterprise FM Trust 701-0000-2317 352.90 4/8/2026 305 - 22 Chev Silv #25G5QR Enterprise FM Trust 700-0000-2317 448.48 4/8/2026 310 - 24 Chev Silv #27MGR3 Enterprise FM Trust 700-0000-4811 86.89 4/8/2026 306 - 24 Chev Silv #27MGRB Enterprise FM Trust 400-0000-4810 543.32 4/8/2026 605 - 22 Ford Rang #25G25M Enterprise FM Trust 700-0000-4811 86.53 4/8/2026 314 - 24 Chev Silv #27MGTW Enterprise FM Trust 701-0000-4811 82.44 4/8/2026 303 - 24 Chev Silv #27MGR7 Enterprise FM Trust 701-0000-2317 444.73 4/8/2026 315 - 24 Chev Silv #27MGTV Enterprise FM Trust 400-0000-4810 828.12 4/8/2026 403 - 23 Chev Silv #25XGMK Enterprise FM Trust 400-0000-4810 828.22 4/8/2026 419 - 23 Chev Silv #25XGMJ Enterprise FM Trust 700-0000-2317 411.55 4/8/2026 308 - 24 Chev Silv #27RZHT Enterprise FM Trust 700-0000-2317 446.84 4/8/2026 303 - 24 Chev Silv #27MGR7 Enterprise FM Trust 400-0000-4811 107.06 4/8/2026 420 - 23 Chev Silv #25XGMS Enterprise FM Trust 701-0000-4811 78.46 4/8/2026 308 - 24 Chev Silv #27RZHT AP - Check Detail (4/21/2026)Page 8 of 30 83 Last Name Acct 1 Amount Check Date Description Enterprise FM Trust 700-0000-4811 86.53 4/8/2026 315 - 24 Chev Silv #27MGTV Enterprise FM Trust 400-0000-4810 506.05 4/8/2026 606 - 22 Ford Rang #25G23Z Enterprise FM Trust 400-0000-4811 254.03 4/8/2026 130 - 24 GMC Sier #27NF7M Enterprise FM Trust 400-0000-4811 150.25 4/8/2026 401 - 23 Chev Silv #26RPBZ Enterprise FM Trust 400-0000-4811 54.46 4/8/2026 405 - 22 Chev Silv #25G5QQ Enterprise FM Trust 701-0000-2317 442.88 4/8/2026 306 - 24 Chev Silv #27MGRB Enterprise FM Trust 400-0000-4811 159.81 4/8/2026 202 - 23 Chev Tahoe #25WDVJ Enterprise FM Trust 101-1550-4440 45.00 4/8/2026 27NDJB-EMF fee Enterprise FM Trust 700-0000-2317 225.12 4/8/2026 307 - 23 Chev Equinox #262P8K Enterprise FM Trust 400-0000-4811 181.35 4/8/2026 603 - 25 Chev Equi #28CM4H Enterprise FM Trust 400-0000-4810 701.21 4/8/2026 408 - 22 Chev Silv #25G89X Enterprise FM Trust 700-0000-2317 444.74 4/8/2026 315 - 24 Chev Silv #27MGTV Enterprise FM Trust 400-0000-4810 609.26 4/8/2026 502 - 23 Chev Blazer #25XQVB Enterprise FM Trust 700-0000-4811 78.45 4/8/2026 308 - 24 Chev Silv #27RZHT Enterprise FM Trust 700-0000-2317 444.73 4/8/2026 314 - 24 Chev Silv #27MGTW Enterprise FM Trust 700-0000-2317 442.88 4/8/2026 306 - 24 Chev Silv #27MGRB Enterprise FM Trust 400-0000-4811 14.73 4/8/2026 412 - 22 GMC Sier #25H28F Enterprise FM Trust 400-0000-4811 38.46 4/8/2026 605 - 22 Ford Rang #25G25M Enterprise FM Trust 400-0000-4811 159.81 4/8/2026 204 - 23 Chev Tahoe #25WDVL Enterprise FM Trust 400-0000-4811 161.59 4/8/2026 203 - 23 Chev Silv #26RPC3 Enterprise FM Trust 400-0000-4810 633.19 4/8/2026 430 - 24 Chry Paci #275N63 Enterprise FM Trust 101-1550-4440 14.50 4/8/2026 27NDJB-DMV fee Enterprise FM Trust 400-0000-4810 826.16 4/8/2026 401 - 23 Chev Silv #26RPBZ Enterprise FM Trust 700-0000-4811 12.38 4/8/2026 305 - 22 Chev Silv #25G5QR Enterprise FM Trust 701-0000-2317 446.84 4/8/2026 303 - 24 Chev Silv #27MGR7 Enterprise FM Trust 400-0000-4810 821.85 4/8/2026 404 - 24 GMC Sier #27NDJJ Enterprise FM Trust 400-0000-4810 826.25 4/8/2026 416 - 23 Chev Silv #25XGMC Enterprise FM Trust 400-0000-4811 235.70 4/8/2026 131 - 24 Chev Silv #27NDJK Enterprise FM Trust 700-0000-2317 352.90 4/8/2026 305 - 22 Chev Silv #25G5QR Enterprise FM Trust 701-0000-2317 442.42 4/8/2026 301 - 24 Chev Silv #27MGR8 Enterprise FM Trust 400-0000-4810 705.27 4/8/2026 411 - 22 Chev Silv #25G8CL Enterprise FM Trust 400-0000-4810 825.88 4/8/2026 420 - 23 Chev Silv #25XGMS Enterprise FM Trust 701-0000-2317 448.48 4/8/2026 310 - 24 Chev Silv #27MGR3 Enterprise FM Trust 400-0000-4810 829.16 4/8/2026 201 - 22 GMC Yuko #25MPSN Enterprise FM Trust 400-0000-4811 107.36 4/8/2026 419 - 23 Chev Silv #25XGMJ Enterprise FM Trust 400-0000-4810 767.24 4/8/2026 131 - 24 Chev Silv #27NDJK Enterprise FM Trust 400-0000-4810 586.52 4/8/2026 412 - 22 GMC Sier #25H28F Enterprise FM Trust 400-0000-4811 40.11 4/8/2026 606 - 22 Ford Rang #25G23Z Enterprise FM Trust 701-0000-4811 12.38 4/8/2026 305 - 22 Chev Silv #25G5QR Enterprise FM Trust 400-0000-4811 57.50 4/8/2026 001 - 22 Ford Esca #26M3MH Enterprise FM Trust 701-0000-4811 86.54 4/8/2026 315 - 24 Chev Silv #27MGTV Enterprise FM Trust 400-0000-4810 520.32 4/8/2026 602 - 24 Chev Equi #27MF9K Enterprise FM Trust 400-0000-4810 823.72 4/8/2026 130 - 24 GMC Sier #27NF7M AP - Check Detail (4/21/2026)Page 9 of 30 84 Last Name Acct 1 Amount Check Date Description Enterprise FM Trust 400-0000-4811 6.15 4/8/2026 140 - 22 Chev Silv #25G5J6 Enterprise FM Trust 700-0000-2317 442.42 4/8/2026 301 - 24 Chev Silv #27MGR8 Enterprise FM Trust 700-0000-4811 33.09 4/8/2026 307 - 23 Chev Equinox #262P8K Enterprise FM Trust 400-0000-4811 110.37 4/8/2026 502 - 23 Chev Blazer #25XQVB Enterprise FM Trust 400-0000-4811 29.97 4/8/2026 411 - 22 Chev Silv #25G8CL Enterprise FM Trust 400-0000-4810 821.84 4/8/2026 410 - 24 GMC Sier #27NDJB Enterprise FM Trust 400-0000-4811 151.36 4/8/2026 505 - 23 Chev Silv #26RP8Z Enterprise FM Trust 701-0000-4811 87.34 4/8/2026 301 - 24 Chev Silv #27MGR8 Enterprise FM Trust 701-0000-2317 444.74 4/8/2026 314 - 24 Chev Silv #27MGTW Enterprise FM Trust 400-0000-4810 829.07 4/8/2026 134 - 23 Chev Silv #25WNKR Enterprise FM Trust 400-0000-4810 781.31 4/8/2026 203 - 23 Chev Silv #26RPC3 Enterprise FM Trust 700-0000-4811 87.35 4/8/2026 301 - 24 Chev Silv #27MGR8 Enterprise FM Trust 400-0000-4810 573.84 4/8/2026 801 - 24 Chry Paci #2754MQ Enterprise FM Trust 400-0000-4810 716.39 4/8/2026 204 - 23 Chev Tahoe #25WDVL Enterprise FM Trust 400-0000-4810 819.20 4/8/2026 402 - 23 Chev Silv #25XGMF Enterprise FM Trust 701-0000-4811 86.54 4/8/2026 314 - 24 Chev Silv #27MGTW Enterprise FM Trust 400-0000-4810 672.00 4/8/2026 603 - 25 Chev Equi #28CM4H Enterprise FM Trust 701-0000-4811 33.09 4/8/2026 307 - 23 Chev Equinox #262P8K Enterprise FM Trust 400-0000-4811 259.86 4/8/2026 410 - 24 GMC Sier #27NDJB Enterprise FM Trust 400-0000-4811 37.22 4/8/2026 408 - 22 Chev Silv #25G89X Enterprise FM Trust 400-0000-4810 829.09 4/8/2026 132 - 23 Chev Silv #25WNCN Enterprise FM Trust 400-0000-4811 105.15 4/8/2026 132 - 23 Chev Silv #25WNCN Enterprise FM Trust 400-0000-4810 692.22 4/8/2026 214 - 22 Chev Silv #25G5D2 Enterprise FM Trust 700-0000-4811 82.43 4/8/2026 303 - 24 Chev Silv #27MGR7 Enterprise FM Trust 701-0000-4811 86.88 4/8/2026 306 - 24 Chev Silv #27MGRB Enterprise FM Trust 400-0000-4810 703.07 4/8/2026 140 - 22 Chev Silv #25G5J6 Enterprise FM Trust 400-0000-4810 684.82 4/8/2026 405 - 22 Chev Silv #25G5QQ Enterprise FM Trust 400-0000-4811 259.80 4/8/2026 404 - 24 GMC Sier #27NDJJ Enterprise FM Trust 400-0000-4810 716.39 4/8/2026 202 - 23 Chev Tahoe #25WDVJ Enterprise FM Trust 400-0000-4811 219.56 4/8/2026 801 - 24 Chry Paci #2754MQ Enterprise FM Trust 400-0000-4811 107.35 4/8/2026 403 - 23 Chev Silv #25XGMK Enterprise FM Trust 400-0000-4810 820.12 4/8/2026 505 - 23 Chev Silv #26RP8Z Enterprise FM Trust 400-0000-4811 21.32 4/8/2026 201 - 22 GMC Yuko #25MPSN 35,532.80 4/8/2026 Enterprise FM Trust 35,532.80 Erdmann Thomas 101-1220-4240 157.25 4/8/2026 Duty Boot Reimbursement 157.25 4/8/2026 AP - Check Detail (4/21/2026)Page 10 of 30 85 Last Name Acct 1 Amount Check Date Description Erdmann Thomas 101-1220-4381 330.27 4/15/2026 Mileage to Leadership Conference and Meals 330.27 4/15/2026 Erdmann Thomas 487.52 Fatturi Ana 101-1220-4381 276.44 4/8/2026 Mileage & Dinner at Leadership Conference 276.44 4/8/2026 Fatturi Ana 276.44 Ferguson Waterworks #2518 700-0000-4550 701.30 4/16/2026 curb box lids and supplies Ferguson Waterworks #2518 700-0000-4550 70.13 4/16/2026 curb box repair top 771.43 4/16/2026 Ferguson Waterworks #2518 771.43 FLEX TITLE COMPANY 700-0000-2020 1.06 4/15/2026 Refund Check 098165-000, 9041 RIVER ROCK DRIVE N FLEX TITLE COMPANY 700-0000-2020 10.05 4/15/2026 Refund Check 098165-000, 9041 RIVER ROCK DRIVE N FLEX TITLE COMPANY 720-0000-2020 10.98 4/15/2026 Refund Check 098165-000, 9041 RIVER ROCK DRIVE N FLEX TITLE COMPANY 701-0000-2020 13.83 4/15/2026 Refund Check 098165-000, 9041 RIVER ROCK DRIVE N 35.92 4/15/2026 FLEX TITLE COMPANY 35.92 Game One 101-1550-4120 2,543.39 4/16/2026 New bases for Lake Ann Ballfields - Replacements Game One 101-1766-4128 539.17 4/16/2026 Adult Slow Pitch Softballs 3,082.56 4/16/2026 Game One 3,082.56 GOPHER STATE ONE-CALL INC 701-0000-4300 234.90 4/16/2026 Utility locates-March GOPHER STATE ONE-CALL INC 700-0000-4300 234.90 4/16/2026 Utility locates-March AP - Check Detail (4/21/2026)Page 11 of 30 86 Last Name Acct 1 Amount Check Date Description 469.80 4/16/2026 GOPHER STATE ONE-CALL INC 469.80 GoTo Communications Inc 701-0000-4310 58.49 4/8/2026 Telephone & Communication Charges GoTo Communications Inc 101-1312-4310 191.48 4/8/2026 Telephone & Communication Charges GoTo Communications Inc 101-1550-4310 51.19 4/8/2026 Telephone & Communication Charges GoTo Communications Inc 700-0000-4310 58.49 4/8/2026 Telephone & Communication Charges GoTo Communications Inc 101-1170-4310 2,420.76 4/8/2026 Telephone & Communication Charges 2,780.41 4/8/2026 GoTo Communications Inc 2,780.41 GRANICUS INC 101-1125-4221 9,217.74 4/16/2026 Granicus streaming encoding agenda software 9,217.74 4/16/2026 GRANICUS INC 9,217.74 GRAYBAR 101-1550-4120 838.80 4/16/2026 LA Ballfield Bulbs (replacements) 838.80 4/16/2026 GRAYBAR 838.80 GS DIRECT INC 101-1120-4110 224.79 4/16/2026 Plotter paper 224.79 4/16/2026 GS DIRECT INC 224.79 Guard Guys, LLC 101-1120-4352 111.80 4/9/2026 Background Check 111.80 4/9/2026 AP - Check Detail (4/21/2026)Page 12 of 30 87 Last Name Acct 1 Amount Check Date Description Guard Guys, LLC 111.80 Hagberg Home Service LLC 101-0000-2073 500.00 4/16/2026 Erosion escrow 6880 Nez Perce Dr #686109 500.00 4/16/2026 Hagberg Home Service LLC 500.00 Hance Kelly 202-0000-3830 200.00 4/15/2026 Selling cemetery plot back to the city - Kelly Hance 200.00 4/15/2026 Hance Kelly 200.00 HENKEL GREGORY JOHN 700-0000-2020 18.66 4/15/2026 Refund Check 005684-000, 8699 MARY JANE CIRCLE HENKEL GREGORY JOHN 700-0000-2020 1.60 4/15/2026 Refund Check 005684-000, 8699 MARY JANE CIRCLE HENKEL GREGORY JOHN 720-0000-2020 16.52 4/15/2026 Refund Check 005684-000, 8699 MARY JANE CIRCLE HENKEL GREGORY JOHN 701-0000-2020 31.20 4/15/2026 Refund Check 005684-000, 8699 MARY JANE CIRCLE 67.98 4/15/2026 HENKEL GREGORY JOHN 67.98 Houston Engineering Inc 101-1310-4300 789.50 4/9/2026 Standard Detail Updates 789.50 4/9/2026 Houston Engineering Inc 789.50 HUELIFE 101-1120-4374 5,575.00 4/16/2026 HUE LIFE Insights certification for Matt Unmacht 5,575.00 4/16/2026 HUELIFE 5,575.00 I & S Group, Inc 701-6064-4303 187.12 4/16/2026 Sanitary @ 5% I & S Group, Inc 720-6064-4303 411.68 4/16/2026 Storm @ 11% AP - Check Detail (4/21/2026)Page 13 of 30 88 Last Name Acct 1 Amount Check Date Description I & S Group, Inc 601-6064-4303 2,956.58 4/16/2026 PMP @ 79% I & S Group, Inc 700-6064-4303 187.12 4/16/2026 Water @ 5% 3,742.50 4/16/2026 I & S Group, Inc 3,742.50 INDEPENDENT SCHOOL DIST 112 101-1530-4322 1,280.68 4/16/2026 Jan-Mar Sewer/Water INDEPENDENT SCHOOL DIST 112 101-1530-4320 6,982.11 4/16/2026 Jan-Mar Electricity INDEPENDENT SCHOOL DIST 112 101-1530-4321 8,479.39 4/16/2026 Jan Mar Gas 16,742.18 4/16/2026 INDEPENDENT SCHOOL DIST 112 16,742.18 Indigo Signs 101-1220-4240 157.95 4/16/2026 Par Tags 157.95 4/16/2026 Indigo Signs 157.95 Infosend, Inc 701-1130-4111 279.87 4/9/2026 February Statement Infosend, Inc 700-1130-4111 279.88 4/9/2026 February Statement Infosend, Inc 720-1130-4111 279.87 4/9/2026 February Statement Infosend, Inc 701-1130-4330 931.95 4/9/2026 February Postage Infosend, Inc 720-1130-4330 931.95 4/9/2026 February Postage Infosend, Inc 700-1130-4330 931.96 4/9/2026 February Postage 3,635.48 4/9/2026 Infosend, Inc 720-1130-4111 306.93 4/16/2026 March Statement Infosend, Inc 720-1130-4330 1,012.70 4/16/2026 March Postage Infosend, Inc 701-1130-4330 1,012.70 4/16/2026 March Postage Infosend, Inc 700-1130-4330 1,012.70 4/16/2026 March Postage Infosend, Inc 700-1130-4111 306.94 4/16/2026 March Statement Infosend, Inc 701-1130-4111 306.94 4/16/2026 March Statement 3,958.91 4/16/2026 AP - Check Detail (4/21/2026)Page 14 of 30 89 Last Name Acct 1 Amount Check Date Description Infosend, Inc 7,594.39 KANGAS LISA 720-0000-2020 0.62 4/15/2026 Refund Check 021056-000, 2844 CENTURY TRAIL KANGAS LISA 700-0000-2020 1.87 4/15/2026 Refund Check 021056-000, 2844 CENTURY TRAIL KANGAS LISA 700-0000-2020 0.20 4/15/2026 Refund Check 021056-000, 2844 CENTURY TRAIL KANGAS LISA 701-0000-2020 2.58 4/15/2026 Refund Check 021056-000, 2844 CENTURY TRAIL 5.27 4/15/2026 KANGAS LISA 5.27 KELLINGTON CONSTRUCTION 414-4010-4702 159,885.00 4/16/2026 Pay App #14 Civic Campus 159,885.00 4/16/2026 KELLINGTON CONSTRUCTION 159,885.00 Keys Well Drilling Co 700-7025-4751 45,752.00 4/9/2026 Well 8 & 11 Rehab Project #25-11 45,752.00 4/9/2026 Keys Well Drilling Co 45,752.00 KIMLEY HORN AND ASSOCIATES INC 601-6057-4303 26,475.00 4/16/2026 Market Blvd 26,475.00 4/16/2026 KIMLEY HORN AND ASSOCIATES INC 26,475.00 Kurilla Contracting Company 720-7025-4751 61,773.75 4/9/2026 2025 Pond Maintenance Project 61,773.75 4/9/2026 Kurilla Contracting Company 61,773.75 Lano Equipment 400-4153-4705 62,959.04 4/9/2026 L28 Bobcat Loader bucket broom snow blower blade AP - Check Detail (4/21/2026)Page 15 of 30 90 Last Name Acct 1 Amount Check Date Description 62,959.04 4/9/2026 Lano Equipment 62,959.04 LEAGUE OF MN CITIES INS TRUST 101-1170-4483 4,801.40 4/16/2026 damages to vehicle hit by city vehicle 4,801.40 4/16/2026 LEAGUE OF MN CITIES INS TRUST 4,801.40 LEINES SONJA F.700-0000-2020 1.68 4/15/2026 Refund Check 015757-000, 2734 CENTURY TRAIL LEINES SONJA F.700-0000-2020 8.51 4/15/2026 Refund Check 015757-000, 2734 CENTURY TRAIL LEINES SONJA F.701-0000-2020 21.94 4/15/2026 Refund Check 015757-000, 2734 CENTURY TRAIL LEINES SONJA F.720-0000-2020 5.28 4/15/2026 Refund Check 015757-000, 2734 CENTURY TRAIL 37.41 4/15/2026 LEINES SONJA F. 37.41 LVC Companies Inc 700-7019-4510 2,974.09 4/9/2026 EWTP-Work on Fire WatchPanel 2,974.09 4/9/2026 LVC Companies Inc 2,974.09 Macqueen Emergency Group 201-0000-4705 1,179.08 4/9/2026 New Nozzles 1,179.08 4/9/2026 Macqueen Emergency Group 1,179.08 Marco Inc 701-0000-4410 111.00 4/15/2026 Konica copier Marco Inc 101-1170-4410 832.50 4/15/2026 Konica copier Marco Inc 700-0000-4410 111.00 4/15/2026 Konica copier Marco Inc 720-0000-4410 55.50 4/15/2026 Konica copier AP - Check Detail (4/21/2026)Page 16 of 30 91 Last Name Acct 1 Amount Check Date Description 1,110.00 4/15/2026 Marco Inc 1,110.00 MCCLELLAN MASON R.720-0000-2020 13.06 4/15/2026 Refund Check 105858-000, 1525 HEMLOCK WAY MCCLELLAN MASON R.701-0000-2020 16.44 4/15/2026 Refund Check 105858-000, 1525 HEMLOCK WAY MCCLELLAN MASON R.700-0000-2020 1.26 4/15/2026 Refund Check 105858-000, 1525 HEMLOCK WAY MCCLELLAN MASON R.700-0000-2020 6.37 4/15/2026 Refund Check 105858-000, 1525 HEMLOCK WAY 37.13 4/15/2026 MCCLELLAN MASON R. 37.13 MCGINTY CHRISTOPHER 700-0000-2020 19.96 4/15/2026 Refund Check 095305-000, 6310 STAGHORN LANE MCGINTY CHRISTOPHER 701-0000-2020 33.51 4/15/2026 Refund Check 095305-000, 6310 STAGHORN LANE MCGINTY CHRISTOPHER 700-0000-2020 0.85 4/15/2026 Refund Check 095305-000, 6310 STAGHORN LANE MCGINTY CHRISTOPHER 720-0000-2020 12.08 4/15/2026 Refund Check 095305-000, 6310 STAGHORN LANE 66.40 4/15/2026 MCGINTY CHRISTOPHER 66.40 MERLINS ACE HARDWARE 700-0000-4550 59.88 4/16/2026 Cored Plug 1/4 MPT MERLINS ACE HARDWARE 700-0000-4150 15.99 4/16/2026 Map Pro Gas MERLINS ACE HARDWARE 700-7019-4150 19.96 4/16/2026 Cored Plug 1/4 MPT MERLINS ACE HARDWARE 101-1550-4120 179.83 4/16/2026 Clamp Oil Chainsaw Loop Paint Lubricant MERLINS ACE HARDWARE 101-1320-4260 49.99 4/16/2026 2 in 1 File Guide 325.65 4/16/2026 MERLINS ACE HARDWARE 325.65 Metronet Holdings, LLC 700-7043-4310 56.61 4/8/2026 Telephone & Communication Charges 56.61 4/8/2026 Metronet Holdings, LLC 101-1190-4310 106.50 4/15/2026 Telephone & Communication Charges AP - Check Detail (4/21/2026)Page 17 of 30 92 Last Name Acct 1 Amount Check Date Description 106.50 4/15/2026 Metronet Holdings, LLC 163.11 METROPOLITAN COUNCIL 701-0000-4509 264,887.91 4/9/2026 wastewater service-May 2026 264,887.91 4/9/2026 METROPOLITAN COUNCIL 264,887.91 Meyer John & Leigh 101-0000-2073 500.00 4/16/2026 Erosion escrow 6851 Utica Ln #708279 500.00 4/16/2026 Meyer John & Leigh 500.00 Midwest Pump Works 701-0000-4551 49.00 4/9/2026 Halliday Padlock Bar 49.00 4/9/2026 Midwest Pump Works 49.00 Minnesota Ground Control LLC 601-6040-4300 3,420.92 4/9/2026 City @ 25% Minnesota Ground Control LLC 601-6140-4300 10,262.75 4/9/2026 County @75% 13,683.67 4/9/2026 Minnesota Ground Control LLC 13,683.67 MINNESOTA PETROLEUM SERVICE INC 101-1370-4530 228.00 4/9/2026 lift inspection 228.00 4/9/2026 MINNESOTA PETROLEUM SERVICE INC 228.00 MN Board of Water and Soil Resources 720-0000-4300 2,033.71 4/15/2026 Wetland Banking Credits Sale AP - Check Detail (4/21/2026)Page 18 of 30 93 Last Name Acct 1 Amount Check Date Description 2,033.71 4/15/2026 MN Board of Water and Soil Resources 2,033.71 MN DEPT OF HEALTH 416-0000-4300 550.00 4/8/2026 Construction Plan Review Application 550.00 4/8/2026 MN DEPT OF HEALTH 550.00 MN DEPT OF LABOR AND INDUSTRY 101-0000-2022 3,972.32 4/9/2026 March 2026 Surcharge MN DEPT OF LABOR AND INDUSTRY 101-1250-3818 -79.45 4/9/2026 March 2026 Surcharge 3,892.87 4/9/2026 MN DEPT OF LABOR AND INDUSTRY 3,892.87 MN TRUCKING ASSOCIATION 101-1320-4140 410.37 4/9/2026 inspection forms 410.37 4/9/2026 MN TRUCKING ASSOCIATION 410.37 NAPA AUTO & TRUCK PARTS 101-1320-4120 185.99 4/9/2026 filters / wiper blades 185.99 4/9/2026 NAPA AUTO & TRUCK PARTS 101-1550-4120 64.20 4/16/2026 wiper blades /grease caps / bulb NAPA AUTO & TRUCK PARTS 101-1370-4170 41.94 4/16/2026 oil 106.14 4/16/2026 NAPA AUTO & TRUCK PARTS 292.13 NOVEL SOLAR THREE, LLC 700-0000-4320 5,124.85 4/15/2026 Electric Charges NOVEL SOLAR THREE, LLC 101-1350-4320 107.13 4/15/2026 Electric Charges NOVEL SOLAR THREE, LLC 701-0000-4320 2,802.47 4/15/2026 Electric Charges AP - Check Detail (4/21/2026)Page 19 of 30 94 Last Name Acct 1 Amount Check Date Description 8,034.45 4/15/2026 NOVEL SOLAR THREE, LLC 8,034.45 NvoicePay 101-1130-4300 712.70 4/16/2026 Payment processing-March 712.70 4/16/2026 NvoicePay 712.70 Oneloveyoga 101-1611-4345 300.00 4/9/2026 FebFest Snow Yoga 300.00 4/9/2026 Oneloveyoga 300.00 O'Reilly Automotive Inc 101-1550-4120 7.83 4/16/2026 16oz Rain-X O'Reilly Automotive Inc 101-1220-4140 87.42 4/16/2026 Brake Pads Cermic Pads O'Reilly Automotive Inc 101-1220-4140 -328.32 4/16/2026 Returns - Core Water Pump Trans Bag O'Reilly Automotive Inc 700-0000-4120 101.78 4/16/2026 Ful-Basecoat Reducer O'Reilly Automotive Inc 700-0000-4140 36.26 4/16/2026 Sandpaper O'Reilly Automotive Inc 700-0000-4140 17.77 4/16/2026 Masterpro Refinishing O'Reilly Automotive Inc 101-1550-4120 11.75 4/16/2026 16oz Liquid Wax O'Reilly Automotive Inc 101-1220-4140 6.85 4/16/2026 LTR Well O'Reilly Automotive Inc 101-1550-4140 254.19 4/16/2026 Core Return Battery Core Charge 195.53 4/16/2026 O'Reilly Automotive Inc 195.53 Ott Travis 101-1538-4343 310.92 4/16/2026 Q1 Youth TKD Ott Travis 101-1539-4343 163.50 4/16/2026 Q1 Adult TKD 474.42 4/16/2026 Ott Travis 474.42 AP - Check Detail (4/21/2026)Page 20 of 30 95 Last Name Acct 1 Amount Check Date Description Outdoor Link Inc 101-1520-4359 26.16 4/16/2026 LC Per MN Statute 471.425 Outdoor Link Inc 101-1600-4130 1,744.00 4/16/2026 Lake Ann Ballfield Lighting Controller 1,770.16 4/16/2026 Outdoor Link Inc 1,770.16 P & L AUTOMOTIVE 101-1320-4120 400.00 4/9/2026 undercoating 400.00 4/9/2026 P & L AUTOMOTIVE 400.00 PATCHIN MESSNER 601-6058-4701 1,896.25 4/16/2026 TH 41/MMSW -Property Appraisal 1,896.25 4/16/2026 PATCHIN MESSNER 1,896.25 PDCM/SCSU-DDP 101-1560-4343 453.00 4/16/2026 55 Alive Driver Safety Class 453.00 4/16/2026 PDCM/SCSU-DDP 453.00 Perfection Plus, Inc 101-1190-4511 105.79 4/9/2026 cleaning services for March 1 105.79 4/9/2026 Perfection Plus, Inc 105.79 PLAYPOWER LT FARMINGTON 101-1550-4120 1,645.00 4/16/2026 equip repair 1,645.00 4/16/2026 PLAYPOWER LT FARMINGTON 1,645.00 AP - Check Detail (4/21/2026)Page 21 of 30 96 Last Name Acct 1 Amount Check Date Description Potentia MN Solar 101-1170-4320 123.13 4/8/2026 Electric Charges Potentia MN Solar 101-1190-4320 2,821.72 4/8/2026 Electric Charges Potentia MN Solar 700-0000-4320 1,369.92 4/8/2026 Electric Charges Potentia MN Solar 101-1170-4320 100.91 4/8/2026 Electric Charges Potentia MN Solar 700-0000-4320 945.56 4/8/2026 Electric Charges Potentia MN Solar 101-1190-4320 2,205.88 4/8/2026 Electric Charges 7,567.12 4/8/2026 Potentia MN Solar 7,567.12 PRECISE MRM LLC 101-1320-4310 315.00 4/16/2026 AVL plow trucks 315.00 4/16/2026 PRECISE MRM LLC 315.00 Premium Waters, Inc 101-1550-4120 4.38 4/16/2026 Lake Ann Water 4.38 4/16/2026 Premium Waters, Inc 4.38 PUMP AND METER SERVICE INC 402-1316-4706 27,603.22 4/9/2026 fuel dispensers 27,603.22 4/9/2026 PUMP AND METER SERVICE INC 27,603.22 Ready Watt Electric 101-1220-4533 5,715.00 4/16/2026 Siren Maintenance on all City Sirens 5,715.00 4/16/2026 Ready Watt Electric 5,715.00 Renn Scott 101-0000-2073 500.00 4/16/2026 Erosion escrow 4080 White Oak Ln #701089 AP - Check Detail (4/21/2026)Page 22 of 30 97 Last Name Acct 1 Amount Check Date Description 500.00 4/16/2026 Renn Scott 500.00 Rent N Save Portable Services 101-1611-4410 386.30 4/16/2026 FebFest 2026 portable restrooms Rent N Save Portable Services 101-1550-4400 1,157.75 4/16/2026 portable restrooms 1,544.05 4/16/2026 Rent N Save Portable Services 1,544.05 ROADKILL ANIMAL CONTROL 101-1320-4300 477.00 4/16/2026 road side clean up roadkill 477.00 4/16/2026 ROADKILL ANIMAL CONTROL 477.00 RYAN PAUL & ALISON 700-0000-2020 1.32 4/15/2026 Refund Check 105154-000, 7320 CACTUS CURVE RYAN PAUL & ALISON 701-0000-2020 17.22 4/15/2026 Refund Check 105154-000, 7320 CACTUS CURVE RYAN PAUL & ALISON 700-0000-2020 9.60 4/15/2026 Refund Check 105154-000, 7320 CACTUS CURVE RYAN PAUL & ALISON 720-0000-2020 13.67 4/15/2026 Refund Check 105154-000, 7320 CACTUS CURVE 41.81 4/15/2026 RYAN PAUL & ALISON 41.81 SCU PROPERTY 4, LLC 720-0000-2020 5.12 4/15/2026 Refund Check 102284-002, 6970 CHAPARRAL LANE SCU PROPERTY 4, LLC 700-0000-2020 2.50 4/15/2026 Refund Check 102284-002, 6970 CHAPARRAL LANE SCU PROPERTY 4, LLC 701-0000-2020 6.46 4/15/2026 Refund Check 102284-002, 6970 CHAPARRAL LANE SCU PROPERTY 4, LLC 700-0000-2020 0.50 4/15/2026 Refund Check 102284-002, 6970 CHAPARRAL LANE 14.58 4/15/2026 SCU PROPERTY 4, LLC 14.58 SEH 101-1520-4359 433.06 4/9/2026 LC Per MN Statute 471.425 SEH 410-4410-4300 14,435.25 4/9/2026 Lake Ann Park Preserve AP - Check Detail (4/21/2026)Page 23 of 30 98 Last Name Acct 1 Amount Check Date Description SEH 410-4410-4751 13,571.32 4/9/2026 Lake Ann Park Preserve 28,439.63 4/9/2026 SEH 28,439.63 SINGER DONALD 700-0000-2020 8.51 4/15/2026 Refund Check 016733-000, 600 LYMAN BLVD SINGER DONALD 720-0000-2020 17.44 4/15/2026 Refund Check 016733-000, 600 LYMAN BLVD SINGER DONALD 700-0000-2020 1.68 4/15/2026 Refund Check 016733-000, 600 LYMAN BLVD SINGER DONALD 701-0000-2020 21.97 4/15/2026 Refund Check 016733-000, 600 LYMAN BLVD 49.60 4/15/2026 SINGER DONALD 49.60 SPAIN MARK & ALEISA 720-0000-2020 14.09 4/15/2026 Refund Check 105712-000, 9064 MILLS LANE 14.09 4/15/2026 SPAIN MARK & ALEISA 14.09 Sports Facilities Companies LLC 416-0000-4300 10,000.00 4/9/2026 Development contract 10,000.00 4/9/2026 Sports Facilities Companies LLC 10,000.00 Springbrook 720-0000-4358 75.06 4/9/2026 CivicPay Transaction Fee Springbrook 700-0000-4358 150.12 4/9/2026 CivicPay Transaction Fee Springbrook 701-0000-4358 150.12 4/9/2026 CivicPay Transaction Fee 375.30 4/9/2026 Springbrook 375.30 SRF CONSULTING GROUP INC 601-6058-4303 128.73 4/16/2026 TH41/MMSW Roundabout AP - Check Detail (4/21/2026)Page 24 of 30 99 Last Name Acct 1 Amount Check Date Description 128.73 4/16/2026 SRF CONSULTING GROUP INC 128.73 SUBURBAN CHEVROLET 101-1550-4140 41.86 4/16/2026 Turn signal switch 41.86 4/16/2026 SUBURBAN CHEVROLET 41.86 SUBURBAN RATE AUTHORITY 101-1310-4365 3,048.00 4/8/2026 2026 SRA Membership Assessment 3,048.00 4/8/2026 SUBURBAN RATE AUTHORITY 3,048.00 SUMMIT FIRE PROTECTION 700-7043-4510 484.00 4/9/2026 service call fire panel SUMMIT FIRE PROTECTION 101-1220-4510 374.00 4/9/2026 service call fire panel 858.00 4/9/2026 SUMMIT FIRE PROTECTION 858.00 TBEI, Inc 400-4108-4704 138,384.00 4/9/2026 #103 box sander prewet hydraulics plow & wing und 138,384.00 4/9/2026 TBEI, Inc 138,384.00 TimeSaver Off Site Secretarial, Inc 101-1125-4300 178.00 4/16/2026 Planning Commission minutes 3.17.26 TimeSaver Off Site Secretarial, Inc 101-1125-4300 219.50 4/16/2026 Park & Rec Commission minutes 3.24.26 TimeSaver Off Site Secretarial, Inc 101-1125-4300 178.00 4/16/2026 City Council minutes 3.23.26 575.50 4/16/2026 AP - Check Detail (4/21/2026)Page 25 of 30 100 Last Name Acct 1 Amount Check Date Description TimeSaver Off Site Secretarial, Inc 575.50 TITLESMART 700-0000-2020 0.30 4/15/2026 Refund Check 105828-000, 3840 LESLEE CURVE TITLESMART 700-0000-2020 1.54 4/15/2026 Refund Check 105828-000, 3840 LESLEE CURVE TITLESMART 701-0000-2020 3.97 4/15/2026 Refund Check 105828-000, 3840 LESLEE CURVE TITLESMART 720-0000-2020 3.15 4/15/2026 Refund Check 105828-000, 3840 LESLEE CURVE 8.96 4/15/2026 TITLESMART 8.96 TK Elevator Corporation 414-4010-4702 8,155.90 4/9/2026 Pay App #5 Civic Campus - Final 8,155.90 4/9/2026 TK Elevator Corporation 8,155.90 TRADEMARK TITLE SERVICES 720-0000-2020 24.29 4/15/2026 Refund Check 103031-000, 2195 LAKE HARRISON ROAD TRADEMARK TITLE SERVICES 700-0000-2020 45.83 4/15/2026 Refund Check 103031-000, 2195 LAKE HARRISON ROAD TRADEMARK TITLE SERVICES 700-0000-2020 2.35 4/15/2026 Refund Check 103031-000, 2195 LAKE HARRISON ROAD TRADEMARK TITLE SERVICES 701-0000-2020 91.77 4/15/2026 Refund Check 103031-000, 2195 LAKE HARRISON ROAD 164.24 4/15/2026 TRADEMARK TITLE SERVICES 164.24 TRAFFIC CONTROL CORPORATION 101-1350-4566 4,800.00 4/16/2026 Annual intersection maintenance 4,800.00 4/16/2026 TRAFFIC CONTROL CORPORATION 4,800.00 USA BLUE BOOK 700-7043-4160 991.84 4/16/2026 chemicals USA BLUE BOOK 700-7019-4160 760.24 4/16/2026 chemicals 1,752.08 4/16/2026 AP - Check Detail (4/21/2026)Page 26 of 30 101 Last Name Acct 1 Amount Check Date Description USA BLUE BOOK 1,752.08 VERIZON WIRELESS 101-1220-4310 645.99 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1312-4310 115.23 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1320-4310 321.97 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1550-4310 429.58 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1250-4310 292.15 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1160-4310 76.82 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1170-4310 147.60 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 700-0000-4310 491.03 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 720-0000-4310 211.31 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1120-4310 131.85 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 701-0000-4310 351.92 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1530-4310 38.41 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1600-4310 236.83 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1420-4310 173.68 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1310-4310 228.07 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1540-4310 40.01 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1520-4310 55.81 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1370-4310 101.14 4/8/2026 Telephone & Communication Charges VERIZON WIRELESS 101-1110-4310 40.01 4/8/2026 Telephone & Communication Charges 4,129.41 4/8/2026 VERIZON WIRELESS 4,129.41 Vickerman Tyler 101-1250-4360 130.00 4/8/2026 Exam Fee License Fee 130.00 4/8/2026 Vickerman Tyler 130.00 WALKER MICHAEL T. & KIMBERLY 700-0000-2020 12.97 4/15/2026 Refund Check 099345-000, 8042 AUTUMN RIDGE WAY WALKER MICHAEL T. & KIMBERLY 700-0000-2020 2.57 4/15/2026 Refund Check 099345-000, 8042 AUTUMN RIDGE WAY WALKER MICHAEL T. & KIMBERLY 720-0000-2020 6.89 4/15/2026 Refund Check 099345-000, 8042 AUTUMN RIDGE WAY WALKER MICHAEL T. & KIMBERLY 701-0000-2020 33.47 4/15/2026 Refund Check 099345-000, 8042 AUTUMN RIDGE WAY 55.90 4/15/2026 AP - Check Detail (4/21/2026)Page 27 of 30 102 Last Name Acct 1 Amount Check Date Description WALKER MICHAEL T. & KIMBERLY 55.90 Waste Management of Minnesota, Inc 101-1190-4329 360.59 4/16/2026 Garbage service-April Waste Management of Minnesota, Inc 101-1220-4329 87.48 4/16/2026 Garbage service-April Waste Management of Minnesota, Inc 701-0000-4329 18.81 4/16/2026 Garbage Service-April Waste Management of Minnesota, Inc 101-1550-4329 737.42 4/16/2026 Garbage Service-April Waste Management of Minnesota, Inc 101-1170-4329 195.78 4/16/2026 Garbage service-April Waste Management of Minnesota, Inc 700-0000-4329 18.81 4/16/2026 Garbage Service-April Waste Management of Minnesota, Inc 101-1312-4329 150.51 4/16/2026 Garbage Service-April 1,569.40 4/16/2026 Waste Management of Minnesota, Inc 1,569.40 WATERMARK TITLE AGENCY 720-0000-2020 28.19 4/15/2026 Refund Check 104293-000, 7136 PEARL DRIVE WATERMARK TITLE AGENCY 701-0000-2020 59.39 4/15/2026 Refund Check 104293-000, 7136 PEARL DRIVE WATERMARK TITLE AGENCY 700-0000-2020 27.25 4/15/2026 Refund Check 104293-000, 7136 PEARL DRIVE WATERMARK TITLE AGENCY 700-0000-2020 2.72 4/15/2026 Refund Check 104293-000, 7136 PEARL DRIVE 117.55 4/15/2026 WATERMARK TITLE AGENCY 117.55 WELU JOSEPH 700-0000-2020 268.94 4/15/2026 Refund Check 100706-000, 7135 GUNFLINT TRAIL WELU JOSEPH 720-0000-2020 293.72 4/15/2026 Refund Check 100706-000, 7135 GUNFLINT TRAIL WELU JOSEPH 701-0000-2020 369.90 4/15/2026 Refund Check 100706-000, 7135 GUNFLINT TRAIL WELU JOSEPH 700-0000-2020 28.37 4/15/2026 Refund Check 100706-000, 7135 GUNFLINT TRAIL 960.93 4/15/2026 WELU JOSEPH 960.93 WSB & ASSOCIATES INC 701-0000-4706 363.63 4/9/2026 Lake Ann Beach Improvements WSB & ASSOCIATES INC 720-0000-4706 1,030.29 4/9/2026 Lake Ann Beach Improvements WSB & ASSOCIATES INC 420-4153-4706 1,575.73 4/9/2026 Lake Ann Beach Improvements WSB & ASSOCIATES INC 601-6040-4300 1,006.82 4/9/2026 City @ 25% WSB & ASSOCIATES INC 720-7025-4300 24,541.50 4/9/2026 2025 Pond Maintenance WSB & ASSOCIATES INC 720-0000-4300 342.00 4/9/2026 WCA Support WSB & ASSOCIATES INC 101-1311-4306 1,040.00 4/9/2026 GIS Support Services AP - Check Detail (4/21/2026)Page 28 of 30 103 Last Name Acct 1 Amount Check Date Description WSB & ASSOCIATES INC 410-0000-4706 3,090.85 4/9/2026 Lake Ann Beach Improvements WSB & ASSOCIATES INC 720-0000-4300 3,772.25 4/9/2026 Water Resources Support Services WSB & ASSOCIATES INC 601-6140-4300 3,020.48 4/9/2026 County @75% 39,783.55 4/9/2026 WSB & ASSOCIATES INC 39,783.55 WW GRAINGER INC 101-1312-4150 282.60 4/9/2026 custodian work cart WW GRAINGER INC 101-1170-4150 282.60 4/9/2026 custodian work cart WW GRAINGER INC 101-1190-4150 282.60 4/9/2026 custodian work cart WW GRAINGER INC 700-7043-4120 1,284.73 4/9/2026 fan/motor and supplies 2,132.53 4/9/2026 WW GRAINGER INC 700-7043-4120 111.82 4/16/2026 thermostat supplies WW GRAINGER INC 700-0000-4550 146.92 4/16/2026 well hr meter WW GRAINGER INC 700-7043-4120 329.34 4/16/2026 thermostat supplies WW GRAINGER INC 700-7019-4120 28.46 4/16/2026 new thermostat 616.54 4/16/2026 WW GRAINGER INC 2,749.07 XCEL ENERGY INC 701-0000-4320 153.96 4/8/2026 Electric Charges XCEL ENERGY INC 700-0000-4320 153.96 4/8/2026 Electric Charges XCEL ENERGY INC 101-1312-4320 1,231.68 4/8/2026 Electric Charges 1,539.60 4/8/2026 XCEL ENERGY INC 1,539.60 Xuan Tuyet Doan-Nguyen Jennifer 101-1538-4343 474.42 4/16/2026 Q1 Tae Kwon Do Instruction 474.42 4/16/2026 Xuan Tuyet Doan-Nguyen Jennifer 474.42 Zoho Corporation 101-1160-4205 270.00 4/9/2026 Single license service desk Facilities AP - Check Detail (4/21/2026)Page 29 of 30 104 Last Name Acct 1 Amount Check Date Description 270.00 4/9/2026 Zoho Corporation 270.00 1,145,649.23 AP - Check Detail (4/21/2026)Page 30 of 30 105 City Council Item April 27, 2026 Item Approve a Conditional Use Permit for a Contractor's Yard located at 1480 Park Road File No.Planning Case #2026-05 Item No: D.7 Agenda Section CONSENT AGENDA Prepared By Rachel Arsenault, Associate Planner Reviewed By Laurie Hokkanen SUGGESTED ACTION “The Chanhassen City Council approves the conditional use permit for a contractor’s yard at 1480 Park Road, subject to staff conditions.” Motion Type Simple Majority Vote of members present Strategic Priority Development & Redevelopment SUMMARY Applicant is requesting a conditional use permit for a contractor’s yard at the property located at 1480 Park Road. BACKGROUND The property currently has an office building located on the west side of the property with a parking lot spanning the east side and wrapping around the back of the building. There is a chain-link fence separating the front portion of the parking lot from the rest for storage of trailers and trucks. This property is currently not conforming with code, as a different contractor is operating out of the premises without a conditional use permit. The conditional use permit application and subsequent construction will bring the property into compliance with the sale of the property to new ownership. 106 DISCUSSION BUDGET RECOMMENDATION The Chanhassen Planning Commission adopted findings of fact and recommendation for approval of the requested conditional use permit, subject to the conditions outlined in the staff report. ATTACHMENTS Development Application Narrative Survey Plan Set Architectural Elevations Staff Report Conditional Use Permit CUP Findings of Fact 107 108 109 110 111 11 2 PROJECT LOCATION SITE MINNESOTA STEINHAGEN ENTERPRISES INDUSTRIAL SITE IMPROVEMENT PROJECT CHANHASSEN, MN CITY OF CHANHASSENCARVER COUNTY SIT E SITE SITE INDEX OF CIVIL SITE DRAWINGS: CI V I L E N G I N E E R I N G SI T E D E S I G N 8815 Tiller Ave. NYA, MN 55397 Al Steinhagen 952-657-2294 al@steinhagenent.com 11 3 PROPERTY DESCRIPTION LEGEND: SITE PLAN NOTES SETBACK: SITE DATA: GENERAL NOTES PARKING DATA KEY NOTES: INDEX OF CIVIL SITE DRAWINGS: CI V I L E N G I N E E R I N G SI T E D E S I G N 8815 Tiller Ave. NYA, MN 55397 Al Steinhagen 952-657-2294 al@steinhagenent.com PROJECT LOCATION SURVEY DATA 11 4 LEGEND: INDEX OF CIVIL SITE DRAWINGS: CI V I L E N G I N E E R I N G SI T E D E S I G N 8815 Tiller Ave. NYA, MN 55397 Al Steinhagen 952-657-2294 al@steinhagenent.com SURVEY DATA 11 5 LEGEND: INDEX OF CIVIL SITE DRAWINGS: CI V I L E N G I N E E R I N G SI T E D E S I G N 8815 Tiller Ave. NYA, MN 55397 Al Steinhagen 952-657-2294 al@steinhagenent.com SURVEY DATA PROPERTY DESCRIPTION PROJECT LOCATION EROSION CONTROL INSTALLATION SCHEDULE EROSION CONTROL NOTES EROSION CONTROL MAINTENANCE SCHEDULE VEGETATION GROUND COVER RESTORATION POLLUTION PREVENTION NOTES 11 6 LEGEND: DEMOLITION NOTES INDEX OF CIVIL SITE DRAWINGS: CI V I L E N G I N E E R I N G SI T E D E S I G N 8815 Tiller Ave. NYA, MN 55397 Al Steinhagen 952-657-2294 al@steinhagenent.com SURVEY DATA PROPERTY DESCRIPTION PROJECT LOCATION 11 7 BITUMINOUS PAVEMENTCONCRETE PAVEMENT - LIGHT DUTY CONCRETE PAVEMENT - HEAVY DUTY INDEX OF CIVIL SITE DRAWINGS: CI V I L E N G I N E E R I N G SI T E D E S I G N 8815 Tiller Ave. NYA, MN 55397 Al Steinhagen 952-657-2294 al@steinhagenent.com CONCRETE VALLEY GUTTER 11 8 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S $UFKLWHFWXUDO,QIRUPDWLRQ $UFKLWHFWXUDO3ODQV $UFKLWHFWXUDO(OHYDWLRQV $UFKLWHFGWXUDO6HFWLRQV $UFKLWHFWXUDO:DOO6HFWLRQV'HWDLOV $UFKLWHFWXUDO,QWHULRU'HWDLOV $UFKLWHFWXUDO5HIOHFWHG&HLOLQJ3ODQV $UFKLWHFWXUDO'HWDLOV &LYLO 6WUXFWXUDO 0HFKDQLFDO(OHFWULFDO 3OXPELQJ 0(3 $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ 6 6 6 6 6 6 0(3 6+((7,1'(; &RYHU &RGH,QIR 'RRU6FKHGXOH 2XWOLQH6SHFLILFDWLRQV 2XWOLQH6SHFLILFDWLRQV )ORRU6WRU\3ODQ'HPROLWLRQ )LUVW6WRU\3ODQ1HZ 5RRI3ODQ ([WHULRU(OHYDWLRQV1HZ ([WHULRU(OHDYDWLRQV(QODUJHG %XLOGLQJ6HFWLRQV :DOO6HFWLRQV'HWDLOV ,QWHULRU(OHYDWLRQV 5HIOHFWHG&HLOQJ3ODQV 5HIOHFWHG&HLOLQJ3ODQ1HZ $UFKLWHFWXUDO'HWDLOV ,VVXHGE\*HQHUDO&RQWUDFWRU2ZQHU &RQFHSWXDO5RRI)UDPLQJ3ODQ )RXQGDWLRQ3ODQ 5RRI)UDPLQJ3ODQ 6HFWLRQV 'HWDLOV 6HFWLRQV 'HWDLOV 6HFWLRQV 'HWDLOV 0HFKDQLFDO(OHFWULFDO 3OXPELQJ 'DWH,VVXHG 3UHOLP 3UHOLP 3UHOLP 3UHOLP 3UHOLP 3UHOLP 3UHOLP 3UHOLP 3UHOLP 3UHOLP 3UHOLP 3UHOLP 1RW,VVXHG 3UHOLP 3UHOLP 1RW,VVXHG 1RW,VVXHG 1RW,VVXHG 1RW,VVXHG 1RW,VVXHG 1RW,VVXHG 1RW,VVXHG 1RW,VVXHG 'HVLJQ%XLOG'HIHUUHG6XEPLWWDO 3KRWR6RXWKHDVW 3KRWR(DVW 3KRWR1RUWKHDVW 0HWDO6DOHV0LQL%DWWHQ66 &ORS\2YHUKHDG'RRUV 6WHLQKDJHQ&KDQKDVVHQ6(9LHZ 6WHLQKDJHQ&KDQKDVVHQ1($HULDO %$6(%,' 5(3/$&((;,6767$1',1* 6($007/522) $/7(51$7( 5(3$,17 $//(;,67%/8( 3$,17('&086+$//%( 3$,17('5(' 11 9 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S 5 ),5((;7(1*8,6+(5',67$1&( 5 ),5((; 7(1 *8,6+(5',67 $1 &( 5 ) , 5 ( ( ; 7 ( 1 * 8 , 6 + ( 5 ' , 6 7 $ 1 & ( 5 ),5 ((;7 (1 *8 ,6 +(5 ',6 7 $1 &( 75$9(/',67$1&()5207+,6 32,1772(;,7 %86,1(66 *5283% 2&&83$1&< 6) 6725$*(*52836 0RGHUDWHKD]DUG 6 :$5(+286( 027259(+,&/( 5(3$,5 6) (;7 (;7 ( ; 7 (;7 (;,7 (;,7 (;,7 (;,7 (;,7 (;,7 6&$/( )LUVW6WRU\&RGH /LIH6DIHW\3ODQ %8,/',1*&2'($1$/<6,6 0LQQHVRWD6WDWH%XLOGLQJ&RGH 7KLVLVDQDGDSWLYHUHXVHRIDQH[LVWLQJEXLOGLQJFXUUHQWO\XVHGIRUGLVDVWHUUHVWRUDWLRQFRQVWUXFWLRQ FRQWUDFWRU,W VFXUUHQWXVHLQFOXGHGVRIILFHVSDFHVKRZURRPVSDFHYHKLFOHVWRUDJHDQGZDUHKRXVH 3URSRVHGXVHZLOOEHGHPROWLRQFRQWUDFWRURIILFHYHKLFOHVWRUDJHDQGZDUHKRXVH &KDSWHU2&&83$1&<&/$66,),&$7,21$1'86( 6HFWLRQ %86,1(66*5283%2FFXSDQF\ 6HFWLRQ 6725$*(*52832FFXSDQF\ 0RGHUDWHKD]DUG0RWRU6 :DUHKRXVH 9HKLFOH5HSDLU*DUDJH )LUVW RQO\ 6WRU\ *URXS% 6) *URXS6 VI 7RWDO*URVV)LUVW6WRU\%XLOGLQJ)RRWSULQW VI &KDSWHU*(1(5$/%8,/',1*+(,*+76$1'$5($6 7DEOH$OORZDEOH%XLOGLQJ+HLJKW,Q)HHW$ERYH*UDGH3ODQH % 66SULQNOHUHG7\SH,,%&RQVWUXFWLRQ +HLJKW$OORZHG +HLJKW$FWXDO 7DEOH$OORZDEOH1XPEHURI6WRULHV$ERYH*UDGH3ODQH %6SULQNOHUHG7\SH,,%&RQVWUXFWLRQ6WRULHV$OORZHG6WRU\$FWXDO 66SULQNOHUHG7\SH,,%&RQVWUXFWLRQ6WRULHV$OORZHG6WRU\$FWXDO 7DEOH$OORZDEOH$UHD)DFWRULQ6TXDUH)HHW 6) %6WRU\6SULQNOHUHG7\SH,,%&RQVWXUFWLRQ VI$OORZHGVI$FWXDO 66WRU\6SULQNOHUHG7\SH,,%&RQVWUXFWLRQVI$OORZHGVI$FWXDO 7DEOH1RQVHSDUDWHG2FFXSDQFLHV 7KLVLVFRQVLGHUHGDQRQVHSDUDWHGRFFXSDQF\ ,WHP2FFXSDQF\&ODVVLILFDWLRQ7KHPRVWUHVWULFWLYHSURYLVLRQVRI&KDSWHU ZLOOEH DSSOLHGWRWKH*URXS62FFXSDQF\ 67RWDO$OORZHG6) 6)$FWXDO6% 6) 7DEOH5HTXLUHG6HSDUDWLRQRI2FFXSDQFLHV 1R2FFXSDQF\VHSDUDWLRQVUHTXLUHG &KDSWHU7<3(62)&216758&7,21 7DEOH)LUH5HVLVWDQFH5HTXLUHPHQWVIRU%XLOGLQJ(OHPHQWV 7\SH,,1RQFRPEXVWDEOH1RILUHUDWLQJUHTXLUHG 6HFWLRQ7\SH,,% 6WUXFWXDO(OHPHQWV([WHULRU:DOOVDQG,QWHULRU:DOOVDUHQRQFRPEXVWDEOH 7DEOH)LUH5HVLVWDQFH5DWLQJ5HTXLUHPHQWV)RU([WHULRU:DOOV%DVHG2Q)LUH 6HSDUDWLRQ'LVWDQFH $OOVLGHVDUHRSHQRYHU 1RUDWLQJUHTXLUHG &KDSWHU),5($1'602.(3527(&7,21)($785(6 1RUHDTXLUHPHQWVEDVHGXSRQRFFXSDQF\FRQVWUXFWLRQW\SHDQGH[WHULRUZDOOVHSDUDWLRQ GLVWDQFHV &KDSWHU,17(5,25),1,6+(6 7DEOH,QWHULRU:DOODQG&HLOLQJ)LQLVK5HTXLUHPHQWVE\2FFXSDQF\ %2FFXSDQF\6SULQNOHUHG ,QWHULRUH[LWVWDLUZD\VDQGUDPSVDQGH[LWSDVVDJHZD\V &ODVV% &RUULGRUVDQGHQFRVXUHIRUH[LWDFFHVVVWDLUZD\DQGUDPSV &ODVV& 5RRPVDQGHQFORVHGVSDFH &ODVV& 62FFXSDQF\6SULQNOHUHG ,QWHULRUH[LWVWDLUZD\VDQGUDPSVDQGH[LWSDVVDJHZD\V &ODVV& &RUULGRUVDQGHQFRVXUHIRUH[LWDFFHVVVWDLUZD\DQGUDPSV &ODVV& 5RRPVDQGHQFORVHGVSDFH &ODVV& &KDSWHU ),5(3527(&7,21$1'/,)(6$)(7<6<67(0 6 6HFWLRQ $XWRPDWLF6SULQNOHU6\VWHPV 7KHHQWLUHH[LVLQJEXLOGLQJLVHTXLSHGZLWKDQDXWRPDWLFILUHVXSSUHVVLRQ VSULQNOHU V\VWHP 7KLVV\VWHPZLOOEHXSGDWHGEDVHGXSRQQHZXVHDQGOD\RXW &KDSWHU0($162)(*5(66 7DEOH0D[LPXP)ORRU$UHD$OORZDQFHV3HU2FFXSDQW %XVLQHVV$UHDV VIJURVVVI RFFXSDQWV :DUHKRXVHV VIJURVV VI RFFXSDQWV 7RWDO&DOFXODWHG2FFXSDQW/RDG 2FFXSDQWV &KDSWHU 3/80%,1*6<67(06 6HFWLRQ )L[WXUH&DOFXODWLRQ &DOFXODWHG2FFXSDQW/RDG2YHUDOO PDOHDQGIHPDOH 7DEOH %XVLQHVV :DWHU&ORVHWV HDFKVH[UHTXLUHGSURYLGHG /DYLWRULHV HDFKVH[UHTXLUHGSURYLGHG 'ULQNLQJ)RXQWDLQ([LVWLQJGULQNLQJIRXQWDLQVWRUHPDLQ 6HUYLFH6LQN UHTXLUHG([LVWLQJWRUHPDLQ 0,11(627$3529,6,216727+(0,11(627$67$7(%8,/',1*&2'( 6HFWLRQ5HF\OLQJ6SDFH 7DEOH$0LQLPXP5HF\OLQJ6SDFH5HTXLUHPHQWV $OO2WKHUV [ VI VIUHTXLUHG 6HH&RGH3ODQ""""""""""""""""""""""""""""""" 0LQQHVRWD$FFHVVLELOLW\&RGH 7KLVSURMHFWLVVXEMHFWWRDQGPXVWIROORZDOOUHTXLUHPHQWVRIWKH0LQQHVRWD$FFHVVLELOLW\&RGH 01%XLOGLQJ&RGH&KDSWHUDQGWKH,&&$16,$ +9$&3OXPELQJ(OHFWULFDO 7KLVLVDGHVLJQEXLOGGHOLYHU\FRQWUDFW$SSOLFDEOHVXEFRQWUDFWRUVZLOOLQFOXGHDOOGHVLJQDQGHQJLQHHULQJ IRUWKHLUV\VWHPV 12 0 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S '2256&+('8/( ,' '$([LVW '%([LVW '&([LVW '$([LVW '% '([LVW '([LVW '([LVW '([LVW '([LVW '([LVW '([LVW '([LVW '([LVW '([LVW '([LVW '([LVW '([LVW '([LVW ' ([LVW '(;,67 '$ '% '& '$ '% '&([LVW '([LVW ' '$ '% '$ '% '& '' '( 'HPR G'RRU '225 : +7 7<3( +0 2+' 2+' +0 +0 +0 +0 2+' +0 2+' 2+' 2+' 2+' +0 )5$0( 7<3( +0) +0) +0) +0) +0) +0) +0) +':5 *5283 127(6 $66&+(' $6 6 & + ( ' $66&+(' $6 6 & + ( ' $66&+(' $6 6 & + ( ' $66&+(' $6 6 & + ( ' $66&+(' $6 6 & + ( ' 2 3 ( 1 , 1 * 2 3 ( 1 , 1 * 2 3 ( 1 , 1 * 2 3 ( 1 , 1 * 2 3 ( 1 , 1 * 23(1,1* 23(1,1* 23(1,1* 23(1,1* 23(1,1* )/86+ ,168/+0 '5 +0)5$0( 635$<)2$0 ,168/$7('# (;7 /2&$7,216 )/86++0 '225 ** )/86++0 '225 ,168/ 6(&7,21$/ 29(5+($' '225 %$6(%,' 52:6 )8// 9,6,21 */$66 %$6(%,' 52:)8// 9,6,21 */$66 81,68/$7(' 6(&7,21$/ 29(5+($' '225 $/7(51$7( ;&87,1 /,7(66+2:1 '$6+(' ,168/ 6(&7,21$/ 29(5+($' '225 %$6(%,' 52:6 )8// 9,6,21 */$66 +2//2:0(7$/ )5$0( +0) +0 .(<72*/$667<3( * 7HPSHUHG*ODVV * ,QVXODWHG7HPSHUHG*ODVV * ,QVXODWHG*ODVV +0+0 +0) * +0) 2+'2+' 2+'2+'2+' * * * * * * * * * * * * * * * * * * * * * * * * * * * * 6&$/( 'RRU )UDPH7\SHV 'RRU+DUGZDUH %XWW+LQJHV D $FFHSWDEOH0DQXIDFWXUHV ,YHV6WDQOH\+DJHURU3%% E +LQJH4XDQWLWLHV L KLQJHVIRUGRRUVXSWR LQFKHVDGGLWLRQDOKLQJHIRUHYHU\LQFKHVRYHU LQFKHV LLKLQJHVIRUGXWFKRSHQLQJWKURXJK LQFKHVKLJK F 7\SHV L6WDQGDUGZHLJKWSODLQEHDULQJKLQJHV ,QWHULRUGRRUVWKURXJKLQFKHVZLGHZLWKRXWFORVHU LL6WDQGDUGZHLJKWEDOOEHDULQJKLQJHV ,QWHULRURSHQLQJVRYHULQFKHVWKURXJKLQFKHVZLGH ,QWHULRURSHQLQJVWKURXJKLQFKHVZLGHZLWKDGRRUFORVHU LLL+HDY\ZHLJKWEDOOEHDULQJKLQJHV ,QWHULRURSHQLQJVRYHULQFKHVZLGH 3XEOLFYHVWLEXOHRSHQLQJVDWH[WHULRUGRRUV ([WHULRURXWVZLQJSXEOLFRSHQLQJV ([WHULRURXWVZLQJQRQSXEOLFHQWUDQFHRSHQLQJVRYHULQFKHVZLGH LY2LOLPSUHJQDWHGKLQJHVQRWDFFHSWDEOH +LQJHVL]HV ôµ[ôµIRUöµWKLFNGRRUV )OXVK%ROWVDQG'XVW3URRI6WULNHV D $FFHSWDEOH0DQXIDFWXUHV ,YHV'RRU&RQWUROVRU+DJHU E 3URYLGHWZRµURGVIRUPDQXDOIOXVKEROWVIRUGRRUV·µRUOHVV3URYLGHDXWRPDWLFIOXVKEROWVZKHUH UHTXLUHGWRPDLQWDLQHJUHVVUHTXLUHPHQWVRQSDLUVRIGRRUVDQGDWODEHOHGGRRUV ([LW'HYLFHV D $FFHSWDEOHPDQXIDFWXUHV L :LGH6W\OH3XVK3DG 9RQ'XSULQ 6HULHV0RQDUFK6HULHVRU3UHFLVLRQ6HULHV LL1DUURZ6W\OH3XVK3DG 9RQ'XSULQ6HULHV0RQDUFK6HULHVRU3UHFLVLRQ6HULHV LLL/HYHU7ULP 9RQ'XSULQ 6HULHV0RQDUFK6HULHVRU3UHFLVLRQ &6HULHV LY3XOO7ULP 9RQ'XSULQ 6HULHV0RQDUFK9DQJXDUG6HULHVRU3UHFLVLRQ&6HULHV E 3URYLGHGHDGORFNLQJODWFKEROWVWRLQVXUHVHFXULW\ /RFNV /DWFKHV D 3URYLGHOHYHUKDQGOHVFRPSO\LQJZLWK$'$DQGDSSOLFDEOHDFFHVVLELOLW\FRGHVDWDOOORFDWLRQV E $FFHSWDEOH0DQXIDFWXUHV*UDGH&\OLQGULFDO 6FKODJH$/6HULHV1(3)DOFRQ%6HULHV4RU6DUJHQW /LQH/3 &\SKHU/RFN D (TXDOWR6FKODJH$'2IIOLQH(OHFWURQLF/RFN&RPSDWLEOHZLWKPDVWHUNH\V\VWHPDQGH[LVWGHYLFH 3XOOV3XVKEDUV3XVK3XOO3ODWHV D $FFHSWDEOH0DQXIDFWXUHV %XUQV+DJHURU,YHV E 6WUDLJKW3XOO µGLDµFWF F 2IIVHW'RRU3XOO µGLDµFWF G 3XOO3XVKEDU µGLDµFWF3XOO H 2IIVHW3XOO3XVKEDU µGLDµ3XOO I 3XVKSODWH µ[µ J 3XOOSODWH µGLDµFWF[[µ &RRUGLQDWRUV D %DU&RRUGLQDWRU ,YHV&25[)/'RRU&RQWUROV[)LOOHURU+DJHU '[ ) E 0RXQWLQJ%UDFNHW ,YHV0%6HULHV'RRU&RQWUROV$%&6HULHVRU+DJHU 6HULHV F 3URYLGHFRRUGLQDWRUVDWDOOSDLUVRIGRRUVKDYLQJDXWRPDWLFIOXVKEROWVDQGFORVHUVRQWKHLQDFWLYHOHDIDQG IRUSDLUVRIGRRUVKDYLQJYHUWLFDOURGPRUWLVHH[LWGHYLFHFRPELQDWLRQVZLWKRYHUODSSLQJDVWUDJDOV &ORVHUV D $FFHSWDEOH0DQXIDFWXUHV /&1'RU0DWLF6&6DUJHQW .LFN3ODWHVDQG0RS3ODWHV D 0HWDOµKLJK[WKLFN[µOHVVWKDQGRRUZLGWK 2YHUKHDG6WRSV D +HDY\'XW\6XUIDFH0RXQW *O\QQ-RKQVRQ*- 6HULHV5L[VRQ 6HULHVRU6DUJHQW :DOO6WRSVDQG+ROGHUV D :URXJKW&RQYH[RU&RQFDYH%XPSHU ,YHV+DJHURU%XUQV E $XWRPDWLF:DOO+ROGHUQRWXVHG 0DJQHWLF+ROGHUV D $FFHSWDEOH0DQXIDFWXUHV /&1 'RUPD(0) (06 E 3URYLGHZKHUHQRWHGLQ'RRU6FKHGXOHDQG+DUGZDUH*URXS:KHUHZDOOPRXQWHGPDJQHWLFKROGHUVDUH QRWIHDVLEOHWRGXHORFDWLRQRIZDOORQSODQSURYLGHRYHUKHDGKROGRSHQ´)LUH/LIH6DIHW\&ORVHU+ROGHUµ F &RRUGLQDWHDOOPDJQHWLFKROGHUVZLWKILUHDODUPV\VWHPHOHFWULFDOFRQWUDFWRU :HDWKHUVWULSSLQJ*DVNHWLQJ D $FFHSWDEOH0DQXIDFWXUHV 3HPNR1*3RU5HHVH 7KUHVKROGV D 6DGGOH7KUHVKROGV 3HPNR1*3RU5HHVH6 )LQLVKHV D %XWWV LQWHULRU 86' E )OXVK%ROWV([LW'HYLFHV/RFNVDQG/DWFKHV0LVF 86' F 3XOOVDQG3XVK3ODWHV%DUVSURWHFWLYHSODWHVRYHUKHDGVWRSVZDOOVWRSVDQGKROGHUV 86' G &RRUGLQDWRUV 3ULPHSDLQWHGRUPLOODOXP H &ORVHUV 3RZGHU&RDW$OXP I 7KUHVKROGV PLOODOXP .H\LQJ D $FFHSWDEOH0DQXIDFWXUHV 6FKODJHRU6DUJHQW6LJQDWXUH E 3URYLGHDOOORFNVDQGF\OLQGHUVXWLOL]LQJDSDWHQWHGNH\ZD\WRSUHYHQWPDQXIDFWXULQJDQGGLVWULEXWLRQRI DIWHUPDUNHWNH\EODQNVE\DQ\RQHRWKHUWKDQIDFWRU\DXWKRUL]HGGHDOHUV F $OOORFNVXQGHUWKLVVHFWLRQVKDOOEHNH\HGDVGLUHFWHGE\WKHRZQHUWRDQHZ5HVWULFWHG3DWHQWHG*UDQG 0DVWHU.H\6\VWHP G .H\LQJVKDOOEHE\ORFNPDQXIDFWXUHUZKHUHSHUPDQHQWUHFRUGVVKDOOEHNHSW H )XUQLVK NH\VSHUF\OLQGHU$FWXDOFXWNH\VDVSHURZQHU (OHFWURQLF6WULNHV D 3URYLGHHOHFWURQLFVWULNHVDWGRRUVQRWHGRQ'RRU6FKHGXOHIRUVHFXULW\V\VWHP 'RRU6FKHGXOH+DUGZDUH*URXS6FKHGXOH D *URXS([WHULRU6HUYLFH'RRUV L%XWWV7KUHVKROG2YHUKHDG6WRS&ORVHUV:HDWKHUVWULS6ZHHS/RFNVHWF\OLQGHU F *URXS,QWHULRU6WRUDJH5RRP'RRUV LSD\U%XWWV6WRUH5RRP/RFNVHW2YHUKHDG6WRS I *URXS,QWHULRU+03DVVDJH'RRUV LSDLU%XWWV/DWFKVHW7KUHVKROG6PRNH6WULSSLQJ2YHUKHDG6WRS 12 1 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S ',9,6,21*HQHUDO5HTXLUHPHQWV *HQHUDO5HTXLUHPHQWV 1RWHV 'UDZLQJGLVFUHSDQFLHVPXVWEHEURXJKWWRWKHDWWHQWLRQRIWKH$UFKLWHFWEHIRUHSURFHHGLQJ'LPHQVLRQVPXVW EHYHULILHGLQWKHILHOG7KHVHVWUXFWXUHVDUHGHVLJQHGWREHVWDEOHDQGVHOIVXSSRUWLQJZKHQFRPSOHWH,WLVWKH*&·V UHVSRQVLELOLW\WRGHWHUPLQHPHDQV PHWKRGVRIFRQVWUXFWLRQWRSURYLGHVWDELOLW\IRUWKHEXLOGLQJ LW·VFRPSRQHQWV GXULQJHUHFWLRQ7KLVLQFOXGHVDQ\WHPSRUDU\EUDFLQJVKRULQJJX\VRUWLHGRZQV $OWHUQDWHV $/7(51$7($ %DVH%LG 5HSODFHH[LVWLQJVWDQGLQJVHDPPHWDOURRIZLWKQHZVWDQGLQJVHDPPHWDOURRI $OWHUQDWH /HDYHH[LVWLQJVWDQGLQJVHDPPHWDOURRIDQGUHSDLQW $/7(51$7($ %DVH%LG 3URYLGHIXOOYLHZJODVVVHFWLRQVDWRYHUKHDGGRRUV $OWHUQDWH 2PLWIXOOYLHZJODVVDQGSURYLGH[FXWLQYLVLRQOLWHV $/7(51$7($ %DVH%LG 'U\)DOOSDLQWDOOH[SRVHGURRIVWHHOMRLVWVWHHOEHDPVDQGPHWDOURRIGHFNLQJ $OWHUQDWH /HDYHH[LVWLQJH[SRVHGURRIVWUXFWXUHXQSDLQWHG 9ROXQWDU\$OWHUQDWHV,QDGGLWLRQWRWKHEDVHELGWKH2ZQHUZLOOFRQVLGHUYROXQWDU\DOWHUQDWHVIRUSURGXFWV PDWHULDOVDQGZRUNZKLFKPD\UHGXFHWKHFRVWV3ULRUDSSURYDOIRUYROXQWDU\DOWHUQDWHVDQGDSSURYHG VXEVWLWXWLRQVWRWKHEDVHELGVKDOOEHVXEPLWWHGWRWKH$UFKLWHFWSULRUWRVXEPLWWLQJDELGDQGVKDOOEHDVSHU VHFWLRQ6XEVWLWXWLRQV3URFHGXUHV$//%,'66+$//+$9(%$6(%,'$63(57+(3/$16$1' 63(&,),&$7,2192/817$5<$/7(51$7(6+$//68%75$&7)52025$''727+(%$6(%,' 6KRS'UDZLQJV3URGXFW'DWDDQG6DPSOHV 3')(OHFWURQLFRIWKHIROORZLQJVKDOOEHVXEPLWWHGWRWKHDUFKLWHFWIRUDSSURYDO 5HLQIRUFLQJ6WHHO UHEDU &RQFUHWH0L['HVLJQ 6WHHOFROXPQVEHDPVEDUMRLVWDQGRWKHUVWUXFWXUDOVWHHOFRPSRQHQWV 'RRUVGRRUIUDPHVDQGGRRUKDUGZDUH,QWHULRUERUURZOLWHV*OD]LQJ :LQGRZV 3UHFDVW&RQFUHWH:DOO3DQHOV 5RRI$VVHPEO\ &DELQHW&DVHZRUN 'HVLJQ%XLOGPHFKDQLFDOSOXPELQJHOHFWULFDOILUHVSULQNOHUIL[WXUHVHWF ([WHULRUPDWHULDOILQLVKDQGFRORUVHOHFWLRQVVXFKDVURRILQJVLGLQJSUHILQPHWDOFDXONLQJHWF ,QWHULRUPDWHULDOILQLVKDQGFRORUVHOHFWLRQVVXFKDVIORRULQJSDLQWHWF 5HJXODWRU\5HTXLUHPHQWV 7KH*HQHUDO&RQWUDFWRUZLOOVXEPLWWKHSODQVDQGSD\WKHIHHVUHTXLUHGIRUDEXLOGLQJFRGHSODQUHYLHZDQG EXLOGLQJSHUPLW7KH*HQHUDO&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUFRRUGLQDWLQJDOOLQVSHFWLRQVDQGFRPPXQLFDWLRQVZLWK WKHEXLOGLQJRIILFLDO V RQFHVDLG*HQHUDO&RQWUDFWRULVXQGHUFRQWUDFWIRUFRQVWUXFWLRQ7KH2ZQHUZLOOSD\IRUDOO6HZHU $FFHVV&KDUJHV 6$& :DWHU$FFHVV&KDUJHV :$& SDUNGHGLFDWLRQIHHVDQGRUDQ\RWKHUFLW\IHHVGLUHFWO\WRWKH &LW\ &RGH5HTXLUHG6SHFLDO,QVSHFWLRQVDQG3URFHGXUHV ,WVKDOOEHWKHUHVSRQVLELOLW\RIWKH*HQHUDO&RQWUDFWRUDQGDSSOLFDEOHVXEFRQWUDFWRUVWRQRWLI\WKHRZQHULQ DGYDQFH PLQLPXPGD\V ZKHQWKHLUZRUNLVUHDG\IRUVSHFLDOLQVSHFWLRQ 7KHRZQHUZLOOEHUHVSRQVLEOHIRUREWDLQLQJDWKLUGSDUW\VSHFLDOLQVSHFWRUDQGIRUSD\LQJIRUFRVWVRIWKHVSHFLDO LQVSHFWRU·VVHUYLFHV$VSHFLDOLQVSHFWRUZLOOEHUHWDLQHGE\WKH2ZQHUSULRUWRVWDUWRIFRQVWUXFWLRQ 6HHVWUXFWXUDOSODQVIRUDVSHFLDOLQVSHFWLRQVVFKHGXOH ',9,6,21([LVWLQJ&RQGLWLRQV 6LWH6XUYH\ 7KH&LYLO'UDZLQJVZHUHSUHSDUHGE\&LYLOH6LWH'HVLJQXQGHUDVHSDUDWHFRQWUDFWGLUHFWO\ZLWKWKH2ZQHU 7KH\DUHIRUUHIHUHQFHDQGFRRUGLQDWLRQSXUSRVHVRQO\0LFKDHO-7KRPDV$UFKLWHFW//&DVVXPHVQR UHVSRQVLELOLW\IRUWKHLUFRQWHQWV 6LWHZRUNXQGHUWKLVSURMHFW·VVLWHZRUNSDFNDJHVKDOOLQFOXGHDOOFRQFUHWHZDONVXWLOLWLHVILQDOJUDGLQJVRG ODQGVFDSLQJHWFZLWKLQWKHHVWDEOLVKHGERXQGDULHV ',9,6,21&RQFUHWH &RQFUHWH)RUPLQJ &RQIRUPWRWKHUHTXLUHPHQWVRI$&,$PHULFDQ&RQFUHWH,QVWLWXWH´6SHFLILFDWLRQVIRU6WUXFWXUDO&RQFUHWH IRU%XLOGLQJVµDQ$&,5´5HFRPPHQGHG3UDFWLFHIRU&RQFUHWH)RUPZRUNµ 0DWHULDOIRUFRQFUHWHIRUPVVKDOOEHZRRGRUPHWDORURWKHUDSSURYHGPDWHULDO:RRGIRUPVVKDOOEHVRXQG FOHDQOXPEHUDQGIUHHIURPKROHVRUGHIHFWV([SRVHGFRQFUHWHVKDOOEHIRUPHGZLWKVPRRWKQHZSO\ZRRGRU VWHHO &DUWRQIRUPVWREHELRGHJUDGDEOHSDSHUVXUIDFHWUHDWHGIRUPRLVWXUHUHVLVWDQFHDQGVWUXFWXUDOO\VXIILFLHQWWR VXSSRUWZHLJKWRISODVWLFFRQFUHWHDQGRWKHUVXSHULPSRVHGORDGV 9DSRU%DUULHU DVSHUVHFWLRQ 3URWHFWYDSRUEDUULHUGXULQJSODFLQJRIEDVHILOOUHLQIRUFLQJDQGRU FRQFUHWH5HSDLUSXQFWXUHVDQGWHDUVEHIRUHSODFLQJFRQFUHWH 8QGHU6ODE9DSRU%DUULHU 6KHHWYDSRUEDUULHULQVWDOOHGXQGHULQWHULRUFRQFUHWHVODEVRQDQGEHORZJUDGH &RPSOLHVZLWK$670(&ODVV$ 7KFNQHVV PLO 3URYLGHPDQXIDFWXUHU VUHFRPPHQGHGDFFHVVRULHVSURGXFWVLQFOXGLQJWDSHDGKHVLYHVPDVWLFHWFIRUVHDOLQJ VHDPVDQGSHQHWUDWLRQVLQYDSRUEDUULHU6HDOYDSRUEDUULHUXSRUGRZQWRWKHIRXQGDWLRQZDOOV $SSURYHG0DQXIDFWXUHUV D5DYHQ,QGXVWULHV,QF 9DSRU%ORFN E6WHJR,QGXVWULHV//& 6WHJR:UDS9DSRU%DUULHUPLO F:50HDGRZV,QF 3HUPLQDWRUPLO &RQFUHWH)LQLVKLQJ ,QWHULRU&RQFUHWH6ODEVWREH7URZHOILQLVKHGWRFRPSO\ZLWK$&,6HFWLRQ7ROHUDQFHYDULDWLRQRIQRW PRUHWKDQõLQFKLQIHHW D $OOH[SRVHGFRQFUHWHIORRUVVFKHGXOHGWREHOHIWH[SRVHGVKDOOUHFHLYHD/LTXLG'HQVLILHU+DUGQHUHTXDO WR/ 0&RQVWUXFWLRQ&KHPLFDOV,QF )*6+DUGHQHU3OXV ([WHULRU&RQFUHWH:DONVDQG0LVFHOODQHRXV6ODEVRQ*UDGHVKDOOEHµLQFKHVWKLFNXQOHVVLQGLFDWHGRWKHUZLVH &RQWUROMRLQWVVKDOOEHVFRUHGZLWKILQLVKLQJWRROWRõGHSWKRIVODEWKLFNQHVV([SDQVLRQMRLQWVZKHUHVODEVDEXW EXLOGLQJVKDOOEHIRUPHGZLWKôLQFKWKLFNH[SDQVLRQMRLQWILOOHUFDXONDIWHUFRQFUHWHKDVFXUHGIRUGD\V%URRP ILQLVK &XUEVDQG*XWWHUVDVSHU&LYLO3ODQVDQG6SHFLILFDWLRQV &RQFUHWH3HQHWUDWLQJ6HDOHU &36 IRUXQGHUVLGHRISUHFDVWFRQFUHWHSODQNVDW&DU:DVK7XQQHO D6HDOHUVKDOOEHD7UDQVSDUHQWQRQ\HOORZLQJZDWHURUVROYHQWEDVHGFRDWLQJ E6LODQH6LOR[DQHRU6LOLFRQDWHFRPSRVLWLRQ F3URGXFWVHTXDOWR&RQFUHWH6HDOHUV86$:50HDGRZV,QWUDJXDUGRU*KRVWVKLHOG6LOR[D7HN G$SSO\EHIRUHWKHFRQFUHWHSODQNMRLQWVDUHFDXONHG ',9,6,210DVRQU\ &RQFUHWH8QLW0DVRQU\ 6HH6WUXFWXUDO3ODQV 6SHFLILFDWLRQVIRUVWUXFWXUDOERQGEHDPJURXWLQJDQGUHLQIRUFHPHQWUHTXLUHPHQWV $UFKLWHFWXUDO5HTXLUHPHQWV D µ µ ZLGH[µ µ KLJK[µ µ >RU @Z\WKH6PRRWK)DFHXQLWV E )LQLVK 6WDQGDUGJUH\SDLQWHGLQILHOG F 3URYLGHURFNIDFHVPRRWKDQGIOXWHGSURILOHVWRPDWFKH[LVWLQJ ',9,6,210HWDOV 0HWDO)DEULFDWLRQV 6HFWLRQLQFOXGHVLWHPVRIPLVFHOODQHRXVLURQDQGVWHHOQRWLQGLFDWHGRQWKHVWUXFWXUDOGUDZLQJV 0DWHULDOV D 6WUXFWXUDO6WHHO6KDSHV3ODWHVDQG%DUVDVSHU$670$ E 6WHHO7XELQJ&ROGIRUPHGWREH$670$*UDGH%+RWUROOHGWREH$670$ F 6WHHO6KHHW&ROGUROOHGWREH$670$+RWUROOHGWREH$670$ G 6WHHO3LSHWREH%ODFNVWDQGDUGZHLJKWVFKHGXOHWRFRPSO\ZLWK$670$XQOHVVQRWHG RWKHUZLVH H 6KRS3ULPHU$OOLWHPVWREHVKRSSULPHGDQGVKDOOFRPSO\ZLWK663&3DLQWRUUXVWLQKLELWLYHSULPHU 7RXFKXSSULPHULQILHOGDIWHULQVWDOODWLRQSULRUWRILQDOSDLQWLQJ )DEULFDWLRQ9HULI\GLPHQVLRQVRILWHPVZLWKMRLQWVQHDWO\ILWWHGDQGSURSHUO\VHFXUHG0LOO-RLQWVWRWLJKWILW KDLUOLQHILQLVK&RSHRUPLWHUFRUQHUMRLQWV)RUPMRLQWVH[SRVHGWRZHDWKHUWRH[FOXGHZDWHUSHQHWUDWLRQ*ULQG DOOZHOGMRLQWVVPRRWKSULRUWRSULPLQJ ',9,6,21:RRG3ODVWLFVDQG&RPSRVLWHV $UFKLWHFWXUDO:RRGZRUN &DELQHWV ,QFOXGHV D &XVWRPIDEULFDWHGODPLQDWHGZRRGFDVHZRUNZLWKKDUGZRRGDQGODPLQDWHGZRRGGRRUDQGGUDZHUV IDFHV E &XVWRPIDEULFDWHGODPLQDWHIDFHGSDQHOVOHGJHVWULPZDOOFDSVGHFRUDWLYHSDQHOVPDLOVORWVDQG VKHOYHVDVVKRZQRQWKHGUDZLQJV F 3RVWIRUPHGSODVWLFODPLQDWHGIDFHGFRXQWHUWRSV L (TXDOWR97,QGXVWULHV´:DWHUIDOO(GJHµô5DGLXV(GJH ôµ.LWFKHQ9DQLW\ 6LQJOH5ROO%DUSURILOHDWZLQGRZVWRROORFDWLRQV LL,QWHJUDOµ1RPLQDO µ EDFNVSODVK LLL)LHOGDVVHPEOHG LQVWDOOHGµQRPLQDOVLGHVSODVK V LY)LHOGRUIDFWRU\LQVWDOOHG/DPLQDWHH[SRVHGHGJHILQLVK &RUH%RDUGVKDOOEHDQ\RIWKHIROORZLQJSURGXFWVFRQIRUPLQJWR$:,&XVWRP*UDGH D ,QGXVWULDOJUDGHSDUWLFOHERDUG E 6ROLGOXPEHUFRUH F 3O\ZRRG G 1RDGGHG)RUPDOGHK\GH 3ODVWLF/DPLQDWH)LQLVK)DFHWREHSUHPLXPJUDGHSODVWLFODPLQDWHFRQIRUPLQJWR1(0$/6*3*UDGH LQFKWKLFN D $FFHSWDEOHPDQXIDFWXUHVLQFOXGH L )RUPLFD E &RORU6HOHFWLRQV L ([WHULRURIDOO&DELQHWVWREH)RUPLFD´%ODFN5LIWZRRGµ LL$OOKRUL]RQWDOVXUIDFHVFRXQWHUWRSVZRUNVVXUIDFHVZLQGRZVLOOVHWFWREH)RUPLFD ´6PRNH4XDUWRQHµ 3ODVWLF/DPLQDWH,QWHULRU)DFHWREH%DFNHUVKHHW%. LQFKWKLFN RIVDPHPDQXIDFWXUHUDVIDFHODPLQDWH +DUGZRRGDQG/XPEHU9HQHHUV([SRVHGVXUIDFHVVXFKDVGRRUVGUDZHUVIURQWIUDPHVWREHSODLQVOLFHG0DSOH 6HPLH[SRVHGVXUIDFHVWREHFRPSDWLEOHVSHFLHV &DVHZRUN+DUGZDUH D $GMXVWDEOHVKHOIVWDQGDUGVWREH.QDSHDQG9RJW1REUDFNHWV .QDSHDQG9RJW1R5HFHVV PRXQWLQWRGLYLGHUDQGHQGV$GMXVWDEOHPPVKHOISHJVDQGGULOOHGVXSSRUWKROHVLVDQDFFHSWDEOH VXEVWLWXWLRQ E 'UDZHUVOLGHVWREH.QDSHDQG9RJW0X9RU0X96RIW&ORVH'UDZHU6OLGHV F +LQJHVVKDOOEH%OXP'HJUHH&OLSWRS)XOO2YHUOD\6HOI&ORVLQJFOLSRQVW\OH(XURSHDQKLQJHV1LFNHO ILQLVK G &DWFKHVIRUXQORFNHGLQFKFDVHZRUNGRRUVWREH6WDQOH\1R H &DWFKHVIRUORFNHGöLQFKFDVHZRUNWREH,YHV1R[[D I 'RRUDQGGUDZHUSXOOVWREH/LEHUW\%DXKDXVLQ PP 6WDLQOHVV6WHHO%DU3XOO )DEULFDWLRQ D $OOFDVHZRUNWRFRPSO\ZLWKWKH$PHULFDQ:RRGZRUN,QVWLWXWH $:, &XVWRP*UDGHIOXVKRYHUOD\ FRQVWUXFWLRQ E &DELQHWVVKDOOEHFRQVWUXFWHGZLWKHLWKHUIDFHIUDPHVRUIUDPHOHVVER[FRQVWUXFWLRQ F %R[FRQVWUXFWLRQWREHQROHVVWKDQöLQFKWKLFNIRUFRPSRQHQWVH[FHSWIRUEDFN DJDLQVWZDOO PD\EH õLQFKWKLFN G )OXVKODPLQDWHGRRUVDQGGUDZHUIDFHVVKDOOEHXVHGHOVHZKHUHXQOHVVQRWHGRQWKHSODQV H 'UDZHUVLGHVEDFNDQGVXEIURQWWREHQROHVVWKDQôLQFKWKLFNFRUHPDWHULDOZLWKH[SRVHGHGJHV VHDOHGZLWKVHOIHGJHGODPLQDWH'UDZHUERWWRPQROHVVWKDQõLQFKWKLFNKDUGERDUGRUSO\ZRRG 'UDZHUIURQWVWREHQROHVVWKDQöLQFKHVWKLFNIOXVKRYHUOD\FRQVWUXFWLRQRIODPLQDWHGRUVROLGZRRG 3URYLGH*3YHUWLFDOJUDGHSODVWLFODPLQDWHDWH[SRVHGVLGHVDQGHQGV I (GJLQJRQFDELQHWHGJHVGRRUHGJHVDQGGUDZHUHGJHVPD\EHODPLQDWHRUPDWFKLQJ39& 0LVFHOODQHRXV$FFHVVRULHV D +HDY\GXW\FRXQWHUVXSSRUWEUDFNHWV.QDSHDQG9RJW8OWLPDWH/%UDFNHWµ[µ[µ &RORU %ODFN6SDFHDW·2&PD[DWFRXQWHUDQGYDQLW\ORFDWLRQVVKRZQWREHRSHQEHORZ ZKHUHQR EDVHFDELQHWVDUHVKRZQ ',9,6,217KHUPDO 0RLVWXUH3URWHFWLRQ %RDUG,QVXODWLRQ ([WUXGHG3RO\VW\UHQH%RDUG,QVXODWLRQ $SSURYHG3URGXFWDQG0DQXIDFWXUHUWREH´6W\URIRDPµE\'RZ&KHPLFDO&RRUDSSURYHGHTXDO )RXQGDWLRQ3HULPHWHU OD\HUµWKLFNZLWKDWRWDOPLQLPXP59DOXHRI3URYLGHFRQWLQXRXV·ZLGH KRUL]RQWDOULJLGLQVXODWLRQDWWRSRIIRXQGDWLRQDVVKRZQRQWKHZDOOVHFWLRQV 6HHURRILQJVHFWLRQIRUURRILQVXODWLRQ 6KHHW0HWDO:DOO3DQHOV5RRI3DQHOV )ODVKLQJ 3UHILQLVKHG0HWDO:DOO3DQHOV D(TXDOWR0$&$UFKLWHFWXUDO0HWDOSDQHOV E3URILOH 0HWDO%ORFNZLGH[ JURRYHGLVWDQFH F$670(&ODVV$)LUH5HVLVWDQFH G$670'$0D[LPXP6XVWDLQHG3UHVVXUHDW%UHDN H9HUWLFDO,QVWDOODWLRQ DVVKRZQRQWKHGUDZLQJV I3DQHO'HSWK J3UHSDLQWHGJDOYDQL]HGVWHHO KJDXJH L1RYLVLEOHMRLQWV M1RSHUIRUDWLRQV N\HDUZDUUDQW\ O&RORU 6LJQDWXUH&ROOHFWLRQ$VK4XDUW] 3UHILQLVKHG0HWDO&DSIODVKLQJGULSHGJHIODVKLQJUHJOHWIODVKLQJGRZQVSRXWURRIVFXSSHUHWF D 6KHHW0HWDO $670$JDXJHJDOYDQL]HG*UDGH$* FRDWLQJ SULPHGDQGILQLVKHGRQHVLGHZLWK IOXRURFDUERQFRDWLQJDQGZDVKHGFRDWRQEDFNVLGH L $SSURYHGPDQXIDFWXUHV 0%&,RU0HWDO6DOHV0DQXIDFWXULQJ&RUSRUWDLRQ E )LQLVK &RQIRUPWR$$0$ZLWKQROHVVWKHSHUFHQW$WRFKHP.\QDURU$XVLPRQW+\ODU SRO\YLQ\OLGHIOXRULGHUHVLQV F &RORU6FKHGXOH L 0DWW%ODFN 3UHILQLVKHG0HWDO)DVFLDDQG6RIILWV D $SSURYHG0DQXIDFWXUHU 0%&, E 6RIILW3DQHO JDXJH6PRRWKILQLVK&RQFHDOHG)DVWHQHG1RQYHQWHG):ZLWK%HDGµSDQHO ZLGWKZLWKEHDGµRF7KLFNQHVVôµ F 6WHHO)DVFLD &XVWRPSURILOHVWRSHUDUFKLWHFWXUDOSODQV L &RORU 0DWW%ODFN /RRVH/DLG%DOODVWHG(WK\OHQH3URS\OHQH'LHQH7HUSRO\PHU (3'0 5RRILQJ PLO6XUH7RXJKUHLQIRUFHG(3'0PHPEUDQH 0HPEUDQHDQGLQVXODWLRQORRVHODLGRYHUWKHSUHFDVWFRQFUHWHSODQNRU26%3O\ZRRGVXEVWUDWHDQGKHOGLQSODFH ZLWKPLQLPXPSRXQGVRIEDOODVWSHUVTXDUHIRRWRUDVUHTXLUHGIRUZLQGORDGV $GMRLQLQJVKHHWVRI(3'0VSOLFHGWRJHWKHUSHUPDQXIDFWXUHU VUHTXLUHG &RORU %ODFN ,QVXODWLRQ WDSHUHGDQGIODWHTXDOWR)LUHVWRQH,62 */ULJLGLQVXODWLRQORRVHODLG 0,1,08059$/8(2) QRWDYHUDJH 0LQLPXP\HDUPDQXIDFWXUHUVZDUUDQW\ $FFHVVRULHV SURYLGHGWHUPLQDWLRQEDUVIODVKLQJSLSHERRWVURRIGUDLQVHWFDVUHTXLUHGIRUDFRPSOHWHZDUUDQWHG DVVHPEO\ $SSURYHGPDQXIDFWXUHUV &DUOLVOHPLO6XUH7RXJK)LUHVWRQHRWKHUVDSSURYHGE\DUFKLWHFW )LUHVWRSSLQJ )RUUDWHGZDOODQGIORRUDVVHPEOLHVDVSHUFRGHSODQDQGDVUHTXLUHG -RLQW6HDODQWV ,QWHULRUDQGH[WHULRUFDONLQJDWFRQQHFWLRQRIGLIIHUHQWPDWHULDOVSOXPELQJIL[WXUHFRQQHFWLRQVFRXQWHUWRSV ZDOOFRQQHFWLRQVGRRUZLQGRZFRQQHFWLRQLQWHULRUDQGH[WHULRUZDOOVSODVWLFOLQHUSDQHODVVHPEO\FRQQHFWLRQV WRFRQFUHWH&08HWF QRWHSUHFDVWFRQFUHWHGSDQHOMRLQWFDXONLQJVKDOOEHE\SUHFDVWVXSSOLHU DQGDOOORFDWLRQV ZKHUHZDWHURUPRLVWXUHPD\SRWHQWLDOO\SHQHWUDWHWKHDVVHPEO\ ,QWHULRUMRLQWVLQZHWDUHDV D 6LQJOHFRPSRQHQWHODVWRPHULFVHDODQWFRPSO\ZLWK)HG6SHF776&ODVV$FRPSRXQGHG VSHFLILFDOO\IRUPLOGHZUHVLVWDQFHDQGUHFRPPHQGHGE\WKHPDQXIDFWXUHU&RORUWRPDWFKYDQLW\ FRXQWHURUIL[WXUH QRWZDOO E $FFHSWDEOHPDQXIDFWXUHVDQGSURGXFW L 'RZ&RUQLQJ1R LL*HQHUDO(OHFWULF1R6&66DQLWDU\6HDODQW LLL3HFRUD1R LY:KLWH1R Y6RQQHERUQ2PQLSOXV ,QWHULRUMRLQWVQRWVXEMHFWWRPRYHPHQW D $FU\OLFJHQHUDOSXUSRVHSDLQWDEOHDFU\OLFHPXOVLRQVHDODQWZLWKDSSUR[LPDWHO\SHUFHQW HORQJDWLRQFRPSO\LQJZLWK$670&&RORUVHOHFWHGE\$UFKLWHFW E $FFHSWDEOHPDQXIDFWXUHUVDQGSURGXFW L 7UHPFR$FU\OLF/DWH[ LL6RQQHERUQ%XLOGLQJ3URGXFWV6RQRODF LLL3HFRUD&RUSRUDWLRQ$& LY%RVWLN&RQVWUXFWLRQ3URGXFWV'LY&KHP&DON ([WHULRUXVHLQH[SDQVLRQDQGFRQWUROMRLQWVRISUHFDVWFRQFUHWHURRIDQGIORRUVWUXFWXUHILEHUFHPHQWVLGLQJ PDQXIDFWXUHGVWRQHYHQHHUGRRUVZLQGRZVSHULPHWHUVRWKHUVLPLODUDQGGLVVLPLODUPDWHULDOFRQQHFWVQRW QRWHGRWKHUZLVH D 3RO\XUHWKDQH6HDODQW2QHSDUWXUHWKDQHVHDODQWFRQIRUPLQJWR$670& 7\SH6RU0*UDGH16 &ODVV8VHV170$DQG2&RORUVHOHFWHGE\$UFKLWHFW E $FFHSWDEOHPDQXIDFWXUHUVDQGSURGXFW L %RVWLN&KHP&DON LL3HFRUD'\QDWURO LLL6LND6LNDIOH[D LY6RQQHERUQ6RQRODVWLF13 )RDP%DFNHU5RG D &ORVHG&HOOQRQJDVVLQJEDFNHUURGDVUHFRPPHQGHGE\VHDODQWPDQXIDFWXUHU E $FFHSWDEOHPDQXIDFWXUHUVDQGSURGXFWLQFOXGH$SSOLHG([WUXVLRQ7HFKQRORJLHV,QF´6RI5RGµ &DXONLQJDWSUHFDVWFRQFUHWHZDOOSDQHOVZLOOEHE\WKHSUHFDVWFRQFUHWHPDQXIDFWXUHU ',9,6,212SHQLQJV +ROORZ0HWDO'RRUV )UDPHV ,QFOXGHV1RQUDWHGPHWDOGRRUIUDPHV,QVXODWHGDQGQRQLQVXODWHGPHWDOGRRUV LQVXODWHGDQGQRQLQVXODWHGGRRU YLVLRQNLWV ([WHULRU'RRUV +RWGLSJDOYDQQHDOHGVWHHO$670$&ODVV$JDXJH> PP @KRWGLSSHG JDOYDQQHDOHGVWHHOZLWKFORVHGWRSV D,QFOXGHJDOYDQQHDOHGFRPSRQHQWVDQGLQWHUQDOUHLQIRUFHPHQWVZLWKJDOYDQQHDOHGGRRUV E&ORVHWRSVRIH[WHULRUVZLQJRXWGRRUVWRHOLPLQDWHPRLVWXUHSHQHWUDWLRQ*DOYDQQHDOHGVWHHOWRS FDSVDUHSHUPLWWHG ,QWHULRU'RRUV &ROGUROOHGVWHHO$JDXJH> PP @FROGUROOHGRUJDOYDQQHDOHGVWHHO D,QFOXGHJDOYDQQHDOHGFRPSRQHQWVDQGLQWHUQDOUHLQIRUFHPHQWVJDOYDQQHDOHGGRRUV 'RRUFRUHFRQVWUXFWLRQV D,QWHULRU'RRUV +RQH\FRPE 5HLQIRUFHGVWLIIHQHGVRXQGGHDGHQHGDQGLQVXODWHGZLWKSKHQROIRUPDOGHK\GH IUHH.UDIWKRQH\FRPEFRUHFRPSOHWHO\ILOOLQJWKHLQVLGHRIWKHGRRUVDQGODPLQDWHGWRLQVLGHIDFHVRI ERWKSDQHOVXVLQJFRQWDFWDGKHVLYHDSSOLHGWRERWKSDQHOVDQGKRQH\FRPEFRUH E([WHULRU'RRUV 3RO\VW\UHQH 5HLQIRUFHGVWLIIHQHGVRXQGGHDGHQHGDQGLQVXODWHGZLWKDULJLGSRO\VW\UHQH FRUHERQGHGWRWKHLQVLGHIDFHVRIERWKSDQHOVZLWKFRQWDFWDGKHVLYH$OO3RO\VW\UHQHGRRUVDUHIXOO ZLGWKDQGKHLJKWSRO\VW\UHQHFRUHILOOHG )DFH:HOGHG)UDPHV &RQWLQXRXVIDFHZHOGWKHMRLQWEHWZHHQWKHKHDGDQGMDPEIDFHVDORQJWKHLUOHQJWKHLWKHU LQWHUQDOO\RUH[WHUQDOO\*ULQGSULPHSDLQWDQGILQLVKVPRRWKIDFHMRLQWVZLWKQRYLVLEOHIDFHVHDPV 6HFWLRQDO2YHUKHDG'RRUV ,QFOXGHVFRPSOHWHVXSSO\DQGLQVWDOODWLRQRILQVXODWHGVWHHORYHUKHDGGRRUV (TWR&ORSD\0RGHO : )OXVKSDQHO )XOO$OXPLQXPIUDPHGJODVVSDQHO FRQWLQXRXVDQJOHWUDFN KLOLIWDW KLJKGRRUVKLOLIWDW KLJKGRRUV ([WHQGHG6ROLG6KDIW )LQLVK &XVWRPSDLQWHGWRPDWFKH[WHULRUSUHFDVWFRQFUHWHSDLQWZLWKPDWFKLQJH[WHUQDOYLQ\OZHDWKHUVHDO ,QVXODWHG5YDOXH 6L]HV 3HUSODQV 2SHUDWRU /LIWPDVWHU-/&RPPHUFLDO-DFNVKDIW2SHQHU EXWWRQVWDWLRQSHUGRRU 5HPRWH 3URYLGH /05HPRWHSHU GRRUV ',9,6,21 )LQLVKHV *\SVXP%RDUG$VVHPEOLHV 0DWHULDOV D *\SVXPZDOOERDUGWRFRPSO\ZLWK$670&WDSHUHGHGJHV L )LUHUHVLVWLYHERDUGWREH7\SH;XQOHVVLQGLFDWHGWRVXSSO\PDQXIDFWXUHU·VSURSULHWDU\ILUH UHVLVWLYHODEHOHGERDUGWRFRPSO\ZLWK8/GHVLJQV LL$FFHSWDEOH0DQXIDFWXUHUVLQFOXGH86*6\VWHPVDQG*ROG%RQG $FFHVVRULHV D &RPSO\ZLWK$670&KRWGLSSHGJDOYDQL]HGVWHHOXQOHVVRWKHUZLVHLQGLFDWHG E &RUQHUEHDGWREH7\SH&%[86* F &DVLQJEHDGWREH7\SH/.6VTXDUHQRVHG/VKDSHGEHDGIRUNHUIHGMDPEV2WKHUEHDGV7\SH/&DQG 8VKDSHG G &RQWURO-RLQWHTXDOWR86* 3URYLGHYHUWLFDOLQWHULRUFRQWUROMRLQWVVSDFHGQRJUHDWHUWKDQ·RQ FHQWHUFRQWLQXRXVO\IURPIORRUWRWRSRIZDOODVVHPEO\ H 7HDURIIEHDGWREHµFDVLQJEHDGZLWKµWHDURIIPDVNGHVLJQHGIRUXVHDWZLQGRZMDPEV I 6FUHZVWRFRPSO\ZLWK$670&/HQJWKRIVFUHZVUHTXLUHGWRSHQHWUDWHZRRGIUDPLQJQRWOHVV WKDQLQFK J 1DLOVWRFRPSO\ZLWK$670& K 5HVLOLHQW&KDQQHOVWREH5&DVLQGLFDWHG&RPSO\ZLWK$670$RU$670$ -RLQWUHLQIRUFLQJWDSHDQGFRPSRXQGWRFRPSO\ZLWK$670&DQGJ\SVXPERDUGPDQXIDFWXUHU·V UHFRPPHQGDWLRQV )LQLVK/HYHOVRIMRLQWVLQLQWHULRUJ\SVXPERDUGZRUN D /HYHO2QH L(PEHGWDSHDQGMRLQWFRPSRXQGDWMRLQWVDQGLQWHULRUDQJOHV/HDYHVXUIDFHIUHHRIH[FHVVMRLQW FRPSRXQG7RROPDUNVDQGULGJHDUHDFFHSWDEOH LL8VHDERYHVXVSHQGHGFHLOLQJVDQGZLWKLQRWKHUFRQFHDOHGVSDFHVLIWKHJ\SVXPERDUGDVVHPEO\ LVILUHUDWHGVRXQGUDWHGVRXQGRUVPRNHFRQWUROOHGRUWKHVSDFHVHUYHVDVDQDLUSOHQXP E /HYHO7ZR L(PEHGWDSHDQGMRLQWFRPSRXQGDWMRLQWVDQGLQWHULRUDQJOHV$GGDQRWKHUVHSDUDWHFRDWRI MRLQWFRPSRXQGDSSOLHGRYHUMRLQWVDQJOHVIDVWHQHUVKHDGVDQGDFFHVVRULHV6DQGVPRRWK UHDG\IRUILQLVKPDWHULDOV LL8VHDWORFDWLRQZKHUHWKHJ\SVXPERDUGVHUYHVDVDVXEVWUDWHIRUWKLFNHUPDWHULDOVVXFKDVWLOH ZRRGSDQHOLQJVDQLWDU\SDQHOVHWF F /HYHO7KUHH L(PEHGWDSHDQGMRLQWFRPSRXQGDWMRLQWVDQGLQWHULRUDQJOHV$GGWKUHHVHSDUDWHFRDWVRIMRLQW FRPSRXQGDSSOLHGRYHUMRLQWVDQJOHVIDVWHQHUVKHDGVDQGDFFHVVRULHV$SSO\DQGVDQGVPRRWK IUHHRIWRROPDUNLQJVDQGULGJHV LL 8VHIRUDOOORFDWLRQVVFKHGXOHGWREHH[SRVHGILQLVKHGJ\SVXPERDUG 6XVSHQGHG$FRXVWLFDO&HLOLQJV 7\SH$*HQHUDO8VHDWDOODUHDVH[FHSWZKHUHQRWHGWREHRWKHUW\SH D :HWIRUPHGPLQHUDOILEHUZLWKIDFWRU\DSSOLHGODWH[SDLQW E &ODVV$)ODPH6SUHDGRUOHVV$670( F $FFHSWDEOH0DQXIDFWXUHUDQG3URGXFWWREH$UPVWURQJ)LQH)LVVXUHG 7HJXODU(GJH L $SSURYHG(TXDO 86*5DGDU G 6L]H·[·[µSDQHOV H &RORU:KLWH I *ULGHTXDOWR$UPVWURQJ([SRVHG7HH6\VWHP3UHOXGH;/ZLWKLQFKIDFHSURILOHDQGZKLWHILQLVK ,QVWDOODVSHUPDQXIDFWXUHVUHFRPPHQGDWLRQV 3DLQWLQJ ,QWHULRUDQG([WHULRUSDLQWV\VWHPV $SSURYHGPDQXIDFWXUHV SURYLGHPDQXIDFWXUHUVWRSJUDGHRIPDWHULDO D %HQMDPLQ0RRUH E 6KHUZLQ:LOOLDPV F 'LDPRQG9RJDO G 33* H 3UDWW /DPSHUW I 2O\PSLF &RORUDQGVKHHQVHOHFWLRQWREHVXSSOLHGE\$UFKLWHFW2ZQHU&RQWUDFWRUWRSURYLGHFRPSOHWHFRORUVDPSOH GHFNDQGVDPSOHVZDWFKNLWIRUWKHPDQXIDFWXUHUDQGSURGXFWSURSRVHGSULRUWRFRORUDQGVKHHQVHOHFWLRQV 3DLQWLQJ6FKHGXOH([WHULRU D ([WHULRUJDOYDQL]HGIHUURXVPHWDO L FRDWV(IIHFWR(QDPHO E ([WHULRUJDOYDQL]HGPHWDO L FRDW*DOYDQL]HG0HWDO/DWH[3ULPHU DWIDFWRU\SULPHGORFDWLRQV LL FRDW(IIHFWR(QDPHO F ([WHULRUDOXPLQXPIRU0HFKDQLFDODQG(OHFWULFDO:RUN L FRDW(IIHFWR=LQF&KURPDWH3ULPHU LL (IIHFWR(QDPHO G ([WHULRU3UHFDVW&LQGHU&RQFUHWH0DVRQU\ L &RDW%ORFN)LOOHU3ULPHUHTXDOWR6KHUZLQ:LOOLDPV3UHS5LWH/DWH[%ORFN)LOOHU LL &RDWV([WHULRU$FU\OLF/DWH[3DLQW J 3DUNLQJDQGWUDIILFPDUNLQJV L FRDWWUDIILFSDLQWWRFRPSO\ZLWKORFDODQGVWDWH'27UHTXLUHPHQWV6HH&LYLO'UDZLQJV 3DLQWLQJ6FKHGXOH,QWHULRU D ,QWHULRUXQJDOYDQL]HGIHUURXVPHWDO L 6KRS3ULPHGE\6HFWLRQ&OHDQZLWKKDQGWRROVDQG7RXFKXSLQILHOG LL FRDWV&HOOX7RQH E *\SVXPERDUG&08DQGSUHFDVWFRQFUHWH L FRDW3UR*UHHQ/RZ92&,QWHULRU/DWH[3ULPHU LL FRDW3UR*UHHQ/RZ92&,QWHULRU/DWH[(J6KHO LLL DGGLWLRQDOFRDWDWGDUNHURUKLJKSLJPHQWHGFRORUORFDWLRQVDVGLUHFWHGE\$UFKLWHFWRUDV QHHGHGWRFRYHUSURSHUO\ F &08#RWKHUWKDQ&DU:DVK7XQQHO L FRDW3UR*UHHQ/RZ92&,QWHULRU/DWH[3ULPHU LL FRDW3UR*UHHQ/RZ92&,QWHULRU/DWH[+LJK*ORVV &RORU6HOHFWLRQ D ([WHULRU L6HH'UDZLQJV3ODQV E ,QWHULRU L 7REHVHOHFWHG 12 2 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S 5220),1,6+6&+('8/( 5220 12 1$0( ([LVW9HVW ([LVW5HFHSWLRQ ([LVW2IILFH ([LVW2IILFH ([LVW+DOOZD\ ([LVW2IILFH ([LVW0HQ ([LVW:RPHQ ([LVW+DOOZD\ ([LVW$OFRYH ([LVW6SUQNOU ([LVW2SHQ2II ([LVW2IILFH ([LVW2IILFH ([LVW2IILFH ([LVW2IILFH ([LVW2IILFH ([LVW2IILFH ([LVW2IILFH ([LVW,7 1HZ:DUHKRXVH 0DLQW6KRS 'RFN2II%UHDN ([LVW7OW /QGU\ :DVK$UHD 'RFN *DUDJH )/225 & & & & & & & %$6( 5 1257+ 0$7 0/3 0/3 *% 63 63 0/3 0/3 1257+ ),1 3 ($67 0$7 0/3 0/3 * 63 63 0/3 0/3 ($67 ),1 3 6287+ 0$7 0/3 0/3 *% 63 63 0/3 0/3 6287+ ),1 3 :(67 0$7 0/3 0/3 *% 63 63 0/3 0/3 :(67 ),1 3 &(,/,1* 0$7 (;326(' (;326(' 6$7 6$7 (;326(' (;326(' (;326(' &(,/,1* ),1,6+ 3 3 3 3 3 5(0$5.6 67/678'6# 2&)8//+(,*+7: 6/,375$&.$7723 67/678'6#2& )8//+(,*+7:6/,3 75$&.$7723 (;,67(;7&08 :$// 1(:&08:$// 5,*,',168/: =&+$11(/6 +25=#2& 0(7$//,1(53$1(/ 0/3 0(7$//,1(53$1(/ 0/3 ),%(5*/$66 5(,1)25&('6$1,7$5< 3$1(/ 3$3(5/(66*<3%' 0(7$//,1(53$1(/ 0/3 ($6,'( (;,67,17:$// 0(7$//,1(53$1(/ 03/ 21(6,'(21/< 67/678'6# 2&)8//+(,*+7: 6/,375$&.$7723 0(7$//,1(53$1(/ 0/3 ),%(5*/$66 5(,1)25&('6$1,7$5< 3$1(/ 3$3(5/(66*<3%' 0(7$//,1(53$1(/ 0/3 ::63 :63 :&08 :0/3&08:0/3:0/3 6&$/( :DOO7\SHV ',9,6,216SHFLDOWLHV 6LJQDJH ([WHULRU6XUIDFHDSSOLHGOHWWHUVE\RZQHU ,QWHULRUZD\ILQGLQJVLJQDJHDQGLQWHULRUURRPVLJQDJHHWFVKDOOEHSURYLGHGDVIROORZV D SODVWLFVLJQZLWK´5HVWURRPµ7H[W8QLVH[,QWHUQDWLRQDO6\PERO )LUH([WLQJXLVKHU&DELQHWV 7KLVFRQWUDFWVKDOOSURYLGH6XUIDFH0RXQWHG)LUH([WLQJXLVKHU&DELQHWV D 2XWGRRUSODVWLFH[WLQJXLVKHUFDELQHWVXLWHGIRUKXPLGDQGFRUURVLYHHQYLURQPHQWV E 6XUIDFHPRXQWHG+LJKLPSDFWSRO\VW\UHQH F 6FRUHGSOH[LJODVVEURNHQZLWKDWWDFKHGEUHDNHUEDU G OEVH[WLQJXLVKHUFDSDFLW\ H ,QVLGHGLPHQVLRQ µ;µ;µ I )LQLVKWREHUHG J $FFHSWDEOHPDQXIDFWXUHDQGSURGXFWHTXDOWR 8/,1(+ )LUHH[WLQJXLVKHUV ORFDWHGLQFDELQHWV DQGZDOOKXQJILUHH[WLQJXLVKHUVZLOOEHSURYLGHGDQGLQVWDOOHGWKHE\ 2ZQHU&RQWUDFWRUWRSURYLGHDQGLQVWDOO)LUH([WLQJXLVKHU&DELQHWRQO\ 6FKHGXOHVHH$UFKLWHFWXUDOSODQVIRUORFDWLRQV D 7\SH´)(&µ)LUH([WLQJXLVKHUZLWK6HPL5HFHVVHG&DELQHW L 6HH3ODQVIRUORFDWLRQV E 7\SH´)(;µ:DOOKXQJ IURPEUDFNHW )LUH([WLQJXLVKHU L 6HHSODQVIRUORFDWLRQV ',9,6,21(TXLSPHQW 5HVLGHQWLDO$SSOLDQFHV %UHDN$UHD D 7RS)UHH]HU5HIULJHUDWRU :LWK,FH0DNHU (QHUJ\6WDU&RPSOLDQW FXIWWRWDOFDSDFLW\ 6L]H PD[ µZLGH[µGHHS[µKHLJKW 6WDLQOHVV6WHHO)LQLVK ',9,6,213OXPELQJ &RPPRQ:RUN5HVXOWVIRU3OXPELQJ 7KLVLVDGHVLJQEXLOGSOXPELQJFRQWUDFW,WVKDOOEHWKHUHVSRQVLELOLW\RIWKHSOXPELQJFRQWUDFWRUWRGHVLJQD V\VWHPWRVHUYHWKHSOXPELQJIL[WXUHOD\RXWDVVKRZQDQGWRPHHWDOODSSOLFDEOHFRGHV5HTXLUHGVWDWHDQG PXQLFLSDO DSSURYDOVVKDOOEHXQGHUWKHSOXPELQJFRQWUDFWRU·VVFRSHRIZRUN$OOFRVWVDVVRFLDWHGZLWKD FRPSOHWHV\VWHPGHVLJQPDWHULDOVIL[WXUHVIDXFHWVGUDLQVDQGLQVWDOODWLRQVKDOOEHLQFOXGHGLQWKHELGSULFH$OO FXWWLQJSDWFKLQJILUHVWRSSLQJFDXONLQJHWFDVVRFLDWHGZLWKWKLVZRUNVKDOOEHLQFOXGHG ',9,6,21+HDWLQJ9HQWLODWLQJDQG$LU&RQGLWLRQLQJ +9$& 7KLVLVDGHVLJQEXLOG+9$&SURMHFW,WVKDOOEHWKHUHVSRQVLELOLW\RIWKH+9$&VXEFRQWUDFWRUWRGHVLJQDFRPSOHWH V\VWHPZKLFKPHHWVDOODSSOLFDEOHFRGHV LQFOXGLQJWKH01(QHUJ\&RGH 6DLGVXEFRQWUDFWRUPXVWLQFOXGHWKHFRVWIRUDOO GHVLJQHQJLQHHULQJ SHUPLWV3URYLGH+9$&SOXPELQGGHIHUUHGVXEPLWWDOVVXFKDV+9$&SODQV+9$&HTXLSPHQWGDWD SXPELQJSODQ V SOXPELQJLVRPHWULFVSOXPELQJIL[WXUHGDWDHWF ',9,6,21(OHFWULFDO &RPPRQ:RUN5HVXOWVIRU(OHFWULFDO 7KLVLVDGHVLJQEXLOG(OHFWULFDOFRQWUDFW,WVKDOOEHWKHUHVSRQVLELOLW\RIWKH(OHFWULFDOFRQWUDFWRUWRGHVLJQD V\VWHPWRVHUYHWKHOD\RXWDVVKRZQDQGWRPHHWDOODSSOLFDEOHFRGHV5HTXLUHGVWDWHDQGPXQLFLSDODSSURYDOV VKDOOEHXQGHUWKH(OHFWULFDOFRQWUDFWRU·VVFRSHRIZRUN$OOFRVWVDVVRFLDWHGZLWKDFRPSOHWHV\VWHPGHVLJQ PDWHULDOVDQGLQVWDOODWLRQVKDOOEHLQFOXGHGLQWKHELGSULFH$OOFXWWLQJSDWFKLQJILUHVWRSSLQJFDXONLQJHWF DVVRFLDWHGZLWKWKLVZRUNVKDOOEHLQFOXGHG $OOHOHFWLFDOZRUNUHTXLUHGIRUWKH+9$&HTXLSPHQWVKDOOEHSURYLGHGE\WKHHOHFWULFDOFRQWUDFWRU3URYLGH HOHFWULFDOSRZHUFRQQHFWLRQWRDOOQHZ+9$&HTXLSPHQWSRYLGHGXQGHU'LYLVLRQ 7KHHOHFWULFDOFRQWUDFWRUVKDOOVXSSO\HTXLSPHQWGLVFRQQHFWVUHTXLUHG $OOSRZHUZLULQJVKDOOEHUXQLQFRQGXLWIURPWKHSDQHOERDUWRWKHHTXLSPHQW &RRUGLQDWHZLWKWKH*HQHUDO&RQWUDFWRUIRUDQ+9$&HTXLSPHQWOLVWIURPWKH+9$&FRQWUDFWRUIRUWKH (OHFWULFDOFRQWDFWRUWRXVHWRGHILQHVFRSHRIZRUN $OOGHYLFHVDQGFRYHUSODWHVVKDOOEH*5(<LQFRORU $OOZLULQJLQFOXGLQJFRPPXQLFDWLRQGDWDFDEOHVPXVWEHFRQFHDOHGLQVWXGZDOOVDQGDERYH6XVSHQGHG&HLOLQJ 7LOHV&RQGXLWVXUIDFHPRXQWHGWRLQWHULRUIDFHRISUHFDVWFRQFUHWHZDOOV([SRVHGFRQGXLWQRWDOORZHGDW H[WHULRUIDFHRISUHFDVWFRQFUHWHZDOOV 2WKHU3RZHU5HTXLUHPHQWV D 3URYLGHSRZHUIRURZQHUSURYLGHGRQEXLOGLQJVLJQDJHLQFOXGHLQJDXWRPDWLFGXVNWRGDZQFRQWUROOHU G $OOHOHFWULFDOZRUNUHTXLUHGIRUWKHQHZ+9$&HTXLSPHQWVKDOOEHSURYLGHGE\WKH(OHFWULFDO FRQWUDFWRU3URYLGHHOHFWULFDOSRZHUFRQQHFWLRQWRDOOQHZ+9$&HTXLSPHQWSURYLGHGXQGHU'LYLVLRQ H 7KH(OHFWULFDOFRQWUDFWRUVKDOOVXSSO\HTXLSPHQWGLVFRQQHFWVUHTXLUHG I $OOSRZHUZLULQJVKDOOEHUXQLQFRQGXLWIURPWKHSDQHOERDUGWRWKHHTXLSPHQW J 7KH*HQHUDO&RQWUDFWRUZLOOSURYLGHDQ+9$&HTXLSPHQWOLVWIURPWKH+9$&FRQWUDFWRU V IRUWKH (OHFWULFDOFRQWUDFWRUWRXVHWRGHILQHVFRSHRIZRUN 6XEPLWWDOV D 6XEPLW ZLWKELGSURSRVDO DZULWWHQVXPPDU\RI(OHFWULFDO6\VWHP E 2QFHXQGHUFRQWUDFWVXEPLWGHWDLOHGSODQVFHUWLILHGE\D3URIHVVLRQDO(QJLQHHU RU0DVWHU(OHFWULFLDQ OLFHQVHGLQWKH6WDWHRI0LQQHVRWD3ODQVVKDOOEHVXEPLWWHGWRWKH$UFKLWHFWIRUUHYLHZDQGDSSURYDO SULRUWRFRPPHQFHPHQWRIZRUN ',9,6,21&RPPXQLFDWLRQV 3URYLGHGDWDFDEOLQJWRRIILFHDQGNLRVNGHVNVDWWKH6HUYLFH$GYLVRUDQG6HUYLFH%D\DUHDV ',9,6,21(OHFWURQLF6DIHW\DQG6HFXULW\ )LUH$ODUP D 3URYLGHDILUHDODUPV\VWHPDVUHTXLUHGWRPHHWDOODSSOLFDEOHFRGHV ',9,6,21(DUWKZRUN &RPPRQ:RUN5HVXOWVIRU(DUWKZRUN D 6HH&LYLO'UDZLQJVDQGVSHFLILFDWLRQV ([FDYDWLRQ )LOO )LOOXQGHUFRQFUHWHVODEVVKDOOEHFOHDQ IUHHIURPGHEULV RWKHUGHOHWHULRXVPDWHULDO)LOOVKDOOEHFRPSDFWHGWR DGHQVLW\RIDWOHDVW RIVWDQGDUGSURFWRUPD[LPXPGU\GHQVLW\ $670' &RQWUDFWRUVKDOOYHULI\DIWHU FRQVWUXFWLRQPLQLPXP36)EHDULQJFDSDFLW\ )RRWLQJVVKDOOEHDUXSRQXQGLVWXUEHGVRLORUXSRQVRLOFRPSDFWHGWRDGHQVLW\RIDWOHDVWWKUHHIHHWEHORZWKH EDVHRIWKHIRRWLQJ 6HH&LYLO'UDZLQJVDQG6SHFLILFDWLRQV ',9,6,216LWH8WLOLWLHV 6HH&LYLO(QJLQHHU'UDZLQJV 6SHFLILFDWLRQV ',9,6,216 6HH&LYLO(QJLQHHU'UDZLQJV 6SHFLILFDWLRQV )HQFHVDQG*DWHV 6HH&LYLO(QJLQHHU'UDZLQJV 6SHFLILFDWLRQV .(<725220),1,6+6&+('8/($%%5(9,$7,216 & &RQFUHWH *% *<3%2$5' 3 3DLQW 0/3 0HWDO/LQHU3DQHO 5 5XEEHU 6$7 6XVSHQGHG$FRXVWLF &HLOLQJ 7LOH[ 63 5HLQIRUFHG)LEHUJODVV6DQLWDU\3DQHO .(<725220),1,6+6&+('8/(5(0$5.6 3URYLGHSHQHWUDWLQJVHDOHUDWQRQSROLVKHGVWDQGDUG FRQFUHWHIORRUORFDWLRQV ([SRVHGVWHHOVWUXFWXUH MRLVWVEHDPVDQGFROXPQV VKDOOEH VKRSSULPHGDQGILHOGGU\IDOOSDLQWHG 12 3 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S ' $ '( '$([LVW '%([LVW '([LVW '&([LVW ' $ ( [ L V W E\ '([LVW '([LVW '([LVW ' ( [ L V W ' ( [ L V W ' ([LVW '([LVW '([LVW '([LVW '([LVW '([LVW ' ( [LVW ' ( [LVW '([LVW ' ( ; , 6 7 ' % '$ '&([LVW ' ( [ L V W '' '& '% '$ '(02:$//8372 ' ' ' ' '''' ' ' '' ' ' ' '' ' ' '' ' '' '' ''' ' ' ' ' ' ''' ' ' ' ' ' ' '''' ' ' ' ' ' ' ' ''' ' ' ' '' ' ' '(;6,7522)$&&(6 /$''(5725(0$,1 ' ' ' ' .(<72'(02/,7,21127(6 ' '(02(;,67678':$// ' '(02(;,67'225 6 ' '(02(;,672+'225 ' '(02(;,67&08:$//$65(4 ')25 1(:(1/$5*('2+'225 ' '(02(;,67&$6(:25. ' '(02(;,6772,/(752206,1&/8',1* 3/80%,1*),;785(6$&&(6625,(6 7,/((7& ' '(02(;,67:$//$65(4 '72(1/$5*( 23(1,1* ' '(02(;,67+0)5$0($65(4 ')25 1(:+0'225$1'+0)5$0( ' '(02(;,67&21&)/225$71(: *$5$*($5($21/< 1 6&$/( )LUVW6WRU\3ODQ'HPROLWLRQ '(027:2(;,67 72,/(752206 (1/$5*((;,6723(1,1* )520 ; 72%( ; 12 4 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S ' $ '( '$([LVW '%([LVW '([LVW '&([LVW ' $ ( [ L V W E\ '([LVW '([LVW '([LVW ' ( [ L V W ' ( [ L V W ' ([LVW '([LVW '([LVW '([LVW '([LVW '([LVW ' ( [LVW ' ( [LVW '([LVW ' ( ; , 6 7 ' % '$ '&([LVW ' ( [ L V W '' '& '% ' ' % '& +0) E\ ' % ' $ '% '$ $$ (( %% && '' ) $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ 75(1&+'5$,1 :0/3 :0/3 :0/3 :0/3 :0/3 :0/3&08 :0/3&08 :0/3&08 : :63 : :63 :63 :63 : :0/3 :0/3 :0/3&08 :0/3&08 :0/3 1(: &21&$3521 &21752/ -2,176$7 -$0%67<3 (;,67&21& $3521 1(:'2&./(9(/(5 '2&.%803(5$1' 6($/3$'6 (;,67&21& $3521 6,0 6,0 6,0 6,0 6/23('1 6/ 2 3 ( ' 1 6/23('1 6 / 2 3 ( ' 1 6/23('1 6 / 2 3 ( ' 1 ([ L V W + D O O Z D \ 1HZ:DUHKRXVH $ VTIW 0DLQW6KRS $ VTIW *DUDJH $ VTIW 'RFN2II%UHDN $ VTIW 'RFN $ VTIW /QGU\ $ VTIW :DVK$UHD $ VTIW ([LVW9HVW ([LVW5HFHSWLRQ ([LVW2IILFH ([LVW2IILFH ([LVW2IILFH ([LVW0HQ ([LVW:RPHQ ([ L V W $ O F R Y H ([LVW6SUQNOU ([LVW+DOOZD\ ([LVW2SHQ2II ([ L V W 2 I I L F H ([ L V W 2 I I L F H ([ L V W 2 I I L F H ([LVW2IILFH ([LVW2IILFH ([ L V W 2 I I L F H ([ L V W 2 I I L F H ([LVW,7 ([LVW7OW 6&$/( )LUVW6WRU\3ODQ1HZ 1(:;766 &2/8016#1(:2+ '2256'5-$0%6 1(:5(,1)&21&6/$% $7(;7:$//6:2,168/ $'' /$<(52)55,*,' ,168/:=&+$11(/6# 2& +25= ),1,6+:,7+ 60227+35(),107//,1(5 3$1(/ ,1),//%(7:((11(:2+ '2256:1(:&0883 72 0$7&+60227+ 52&.)$&($1')/87('&08 352),/(720$7&+(;,67 1(:75(1&+'5$,1 12 5 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S 6/23('522) 6758&785('2:1 6/23('522) 6758&785('2:1 7$ 3 ( 5 ( ' ,1 6 8 / ' 2 : 1 7$ 3 ( 5 ( ' ,1 6 8 / ' 2 : 1 7$3(5(' ,168/'2:1 7$3(5(' ,168/'2:1 7$3(5(' ,168/'2:1 7$3(5(' ,168/'2:1 7$3(5(' ,168/'2:1 7$3(5(' ,168/'2:1 1 6&$/( 5RRI3ODQ 1(:522)'5$,17,('72 1(:81'(5*5281'67250 &219(57(;,676&833(572 29(5)/2:6&833(5$'' '$00 1(:522)'5$,17,('72 1(:81'(5*5281'67250 1(:522)'5$,13,3(' '2:1:1(:6&833(572 63,//21*5$'( 1(:522)'5$,13,3(' '2:1:1(:6&833(572 63,//21*5$'( &219(57(;,676&833(572 29(5)/2:6&833(5$'' '$00 12 6 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S $ 6&$/( 1RUWK([WHULRU(OHYDWLRQ1HZ 6&$/( 6RXWK([WHULRU(OHYDWLRQ1HZ 6&$/( :HVW([WHULRU(OHYDWLRQ1HZ 6&$/( (DVW([WHULRU(OHYDWLRQ1HZ $//(;,67%/8( 3$,17('&0872%( 3$,17('5(' 1(: :; +2+'225'(02 &08-$0%6$1'3529,'(1(:/,17(/ (;,67'2:16&833(56$1''2:1 632876&219(57('7229(5)/2: 6&833(56$'''$006723 (;,67'2:16&833(56$1''2:1 632876&219(57('7229(5)/2: 6&833(56$'''$006723 12 7 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S 5 2 & . ) $ & ( 6&$/( (DVW([WHULRU(OHYDWLRQ3DUWLDO(QODUJHG 1(:;766 &2/8016#1(:2+ '2256'5-$0%6 7<3 ,1),//%(7:((11(:2+ '2256:1(:&0883 72 0$7&+60227+ 52&.)$&($1')/87('&08 352),/(720$7&+(;,67 1(: :; +2+'225'(02&08 -$0%6$1'3529,'(1(:/,17(/ '(02 $%29((;,67 2+'5$1'3529,'(1(: /,17(/)25 +,*+ '225 '(02(;,67/2:(53257,212) &08:$// ; $1' :,1'2:6$65(4 ')251(: 2+'2256 5(029(6$/9$*(5(,167$// 25 3529,'(1(: &08$65(4 '72 ,167$//1(:67//,17(/67<3 ;;/(1*7+2)23(1,1* 67/3/$7($72+'5+($'7<3 52&.)$&(&083$,17(':+,7(72 0$7&+ )/87('&08720$7&+(;,67 5(029(6$/9$*(5(,167$// 25 3529,'(1(: &08$65(4 '72 ,167$//1(:67//,17(/67<3 12 8 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S 9(5 6&$/( %XLOGLQJ6HFWLRQ1RUWK6RXWK$ 6&$/( %XLOGLQJ6HFWLRQ1RUWK6RXWK% 6&$/( %XLOGLQJ6HFWLRQ:HW(DVW$ 6&$/( %XLOGLQJ6HFWLRQ1RUWK6RXWK& 12 9 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S $ 6/23('1 6&$/( %XLOGLQJ6HFWLRQ:HW(DVW% 6&$/( :DOO6HFWLRQ 6&$/( 'HWDLO2+'U-DPE 6$/9$*($1'7(036833257(;,67 &08:$//$%29(1(:2+'2256 25'(02$1'5(%8,/' 1(:522) (;,67251(:3$5$3(735(),1 07/&$3)/$6+,1* 1(:07//,1(53$1(/ 5,*,',168/:+25== &+$11(/6#2& 1(:67((//,17(/3(5 6758&7 &87$1'),71(:&08$5281'67((/ %($0 ;;&21767/3/$7( '(02(;7&08)251(:2+ '225 1(:;766(;326('-$0% &2/ 1(:,168/$7('2+'225 1(:25(;,67&21&)/225 1(:5(,1)&21&$3521 6((6758&7 5,*,',168/%(/2: $3521 $7/2&$7,216:,7+1(:,1 )/225+($73529,'(5,*,' ,168/7$3('$1'6($/(' &203$&7('*5$18/$5 ),// 1(:,168/2+'225 75($7(';;&217 2+'2256($/ 1(:;766(;326('67((/ -$0%&2/801 &/26('&(//,168/62/,' %$&.(552'$1'&$8/.1(:25(;,67&08:$// ,17(5,250(7$//,1(53$1(/ 5,*,',168/:+25== &+$11(/6#2& 13 0 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S ([ L V W + D O O Z D \ 1HZ:DUHKRXVH $ VTIW 0DLQW6KRS $ VTIW *DUDJH $ VTIW 'RFN2II%UHDN $ VTIW 'RFN $ VTIW /QGU\ $ VTIW :DVK$UHD $ VTIW ([LVW9HVW ([LVW5HFHSWLRQ ([LVW2IILFH ([LVW2IILFH ([LVW2IILFH ([LVW0HQ ([LVW:RPHQ ([ L V W $ O F R Y H ([LVW6SUQNOU ([LVW+DOOZD\ ([LVW2SHQ2II ([ L V W 2 I I L F H ([ L V W 2 I I L F H ([ L V W 2 I I L F H ([LVW2IILFH ([LVW2IILFH ([ L V W 2 I I L F H ([ L V W 2 I I L F H ([LVW,7 ([LVW7OW 1 6&$/( )LUVW6WRU\5HIOHFWHG&HLOLQJ3ODQ'HPROLWLRQ 13 1 35 ( / , 0 , 1 $ 5 < ' 2 1 2 7 8 6 ( ) 2 5 & 2 1 6 7 5 8 & 7 , 2 1 'DWH/DVW5HYLVHG &RS\ULJKW0LFKDHO-7KRPDV$UFKLWHFW //&$OOULJKWVUHVHUYHG 7KHDUFKLWHFWXUDOZRUNVGHSLFWHGKHUHLQDUHWKH VROHSURSHUW\RI0LFKDHO-7KRPDV$UFKLWHFW//& DQGPD\QRWEHFRQVWUXFWHGRUXVHGZLWKRXWLWV H[SUHVVHGZULWWHQSHUPLVVLRQ1RSHUPLVVLRQWR PRGLI\RUUHSURGXFHDQ\RIWKHVHDUFKLWHFWXUDO ZRUNVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH FRQVWUXFWLRQRIDQ\EXLOGLQJLVH[SUHVVHGRU VKRXOGEHLPSOLHGIURPGHOLYHU\RISUHOLPLQDU\ GUDZLQJVRUXQVHDOHGFRQVWUXFWLRQGUDZLQJV 3HUPLVVLRQWRFRQVWUXFWWKHEXLOGLQJV V GHSLFWHG LQVHDOHGFRQVWUXFWLRQGUDZLQJVLVH[SUHVVO\ FRQGLWLRQHGRQWKHIXOODQGWLPHO\SD\PHQWRIDOO IHHVRWKHUZLVHGXHWR0LFKDHO-7KRPDV $UFKLWHFW//&DQGLQDEVHQFHRIDQ\ZULWWHQ DJUHHPHQWWRWKHFRQWUDU\LVOLPLWHGWRDRQH WLPHXVHRQWKHVLWHLQGLFDWHGRQWKHVHSODQV 0-7 3URMHFW1R )LOH1DPH 6WHLQKDJHQ&KDQKDVVHQ SOQ 'UDZQ%\ 6LJQDWXUH ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRU UHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG $UFKLWHFWXQGHUWKHODZVRIWKH6WDWHRI 0LQQHVRWD 0LQQHVRWD/LFHQVH1R 'DWH6LJQHG $ $ 67UL2DN&LUFOH1( (DVW%HWKHO01 3KRQH (PDLO PMWDOOF#JPDLOFRP :HE PLFKDHOMWKRPDVDUFKLWHFWFRP 6W H L Q K D J H Q ( Q W H U S U L V H V 3 D U N 5 R D G &K D Q K D V V H Q 0 1 6& $ / ( , 1 ' , & $ 7 ( ' % $ 6 ( ' 8 3 2 1 3 5 , 1 7 ( ' ; $ 5 & + , 7 ( & 7 8 5 $ / ' 6+ ( ( 7 $G D S W L Y H 5 H X V H I R U 2 I I L F H D Q G 6 K R S ([ L V W + D O O Z D \ 1HZ:DUHKRXVH $ VTIW 0DLQW6KRS $ VTIW *DUDJH $ VTIW 'RFN2II%UHDN $ VTIW 'RFN $ VTIW /QGU\ $ VTIW :DVK$UHD $ VTIW ([LVW9HVW ([LVW5HFHSWLRQ ([LVW2IILFH ([LVW2IILFH ([LVW2IILFH ([LVW0HQ ([LVW:RPHQ ([ L V W $ O F R Y H ([LVW6SUQNOU ([LVW+DOOZD\ ([LVW2SHQ2II ([ L V W 2 I I L F H ([ L V W 2 I I L F H ([ L V W 2 I I L F H ([LVW2IILFH ([LVW2IILFH ([ L V W 2 I I L F H ([ L V W 2 I I L F H ([LVW,7 ([LVW7OW 1 6&$/( )LUVW6WRU\5HIOHFWHG&HLOLQJ3ODQ1HZ 13 2 PH (952) 227-11 00 • ChanhassenMN.gov 7700 MARKET BOULEVARD • PO BOX 147 • CHANHASSEN • MINNESOTA • 55317 Project: Conditional Use Permit Request (Planning Case 2026-05) City Council Review Date: April 27, 2026 60 Day Action Deadline: May 5, 2026 Drafted By: Rachel Arsenault, Associate Planner Joe Seidl, Water Resources Engineer Mackenze Grunig, Project Engineer Staff Report Date: April 22, 2026 SUMMARY OF REQUEST: Applicant is requesting a conditional use permit for a contractor’s yard at the property located at 1480 Park Road. LOCATION: 1480 Park Road APPLICANT: Steinhagen Proper@es LLC OWNER: Chad Chris@an CURRENT ZONING: Industrial Office Park (IOP) 2040 LAND USE PLAN: Office Industrial ACREAGE: 1.3 Acres PROPOSED MOTIONS: “The Chanhassen City Council approves the requested condi@onal use permit for a contractor’s yard at 1480 Park Road, subject to staff condi@ons.” 133 LEVEL OF CITY DISCRETION IN DECISION-MAKING: The city has limited discretion in approving or denying Conditional Use Permits, based on whether or not the proposal meets the conditional use permit standards outlined in the Zoning Ordinance. If the city finds that all the applicable conditional use permit standards are met, the permit must be approved. This is a quasi-judicial decision. No2ce of this public hearing has been mailed to all property owners within 500 feet. APPLICABLE REGULATION ARTICLE 20-IV CONDITIONAL USES ARTICLE 20-XXII "IOP" INDUSTRIAL OFFICE PARK DISTRICT ARTICLE 20-XXV LANDSCAPING AND TREE REMOVAL BACKGROUND/EXISTING CONDITIONS The property currently has an office building located on the west side of the property with a parking lot spanning the east side and wrapping around the back of the building. There is a chain link fence separa@ng the front por@on of the parking lot from the rest for storage purposes of trailers and trucks. This property is currently not conforming with code as a different contractor is opera@ng out of the premises without a condi@onal use permit. The condi@onal use permit applica@on and subsequent construc@on will bring the property into compliance with the sale of the property to new ownership. ZONING OVERVIEW This property is zoned IOP, Industrial Office Park, in this zoning district a contractor yard is a condi@onal use permit. Contractor’s yards are required to screen outdoor storage of equipment and vehicles, contain only operable vehicles/equipment, chemicals must be properly stored, and the contractor must be licensed, bonded, and insured. In addi@on, all condi@onal use permits must meet the general issuance standards listed in Sec@on 20-232, this is reviewed under the analysis sec@on of the staff report. SITE PLAN The applicant is proposing changes to the exis@ng structure to include new parking bay doors, a new dock door, new paint, and roof updates. None of which require addi@onal development applica@ons. The proposal includes new bituminous pavement to create an apron for the new parking bay doors on the east side of the exis@ng building. New curb and guLer will be installed to improve current run-off condi@ons. The applicant is proposing to install new site signage for traffic control and new pavement striping. There are no proposed changes to the access of the property from public right-of-way. 134 Addi@onal fencing will be installed with the project to meet the requirements of screening. Contractor’s yards are required to comply with buffer yard D and F4 fencing. The site plan will have to be updated to meet the buffer yard D requirements. F4 fencing is a minimum of 8 feet tall and a minimum of 95% opaque. Currently the applicant is proposing three types of fencing that will have to be updated to meet the requirements, including the exis@ng 8-foot chain link fence, PVC 6-foot fencing, and PVC 8-foot fencing. ENGINEERING PROJECT OVERVIEW The applicant is reques@ng a condi@onal use permit (CUP) for a contrac@ng yard located at 1480 Park Road. The site is currently zoned as Industrial Office Park. The applica@on includes improvements to the onsite stormwater infrastructure, and a descrip@on of the use of the site. Plans dated March 4, 2026, and site use narra@ve were reviewed by staff. GRADING & DRAINAGE The site consists of a single parcel that contains a building, bituminous pavement, parking area, with the remaining areas maintained as open grass. Under exis@ng condi@ons, most of the parking lot drains north towards a catch basin located at the northeast corner of the property. Stormwater is discharged into the storm sewer system without any prior treatment. The storm sewer then conveys runoff to a pond/wetland located east of Park Place. The grassy area north of the parking lot drains north towards an exis@ng wetland. The rest of the site drains south toward Park Road, where runoff is collected by the storm sewer system and ul@mately directed to the same pond/wetland east of Park Place. 135 Site drainage paLerns are not expected to change under the proposed condi@ons. However, approval of a condi@onal use permit requires that the site adequately support its intended use. Currently, this standard is not met, as stormwater leaves the property without treatment. The proposed contractor use also increases the poten@al for pollutant transport, placing addi@onal strain on the storm sewer system. To address these concerns, stormwater improvements are required to capture sediment and runoff from on-site equipment before discharge, thereby protec@ng downstream resources. As part of these improvements, the exis@ng catch basin at the northeast corner of the site will be replaced with a sumped catch basin to provide pretreatment prior to discharge. SITE USAGE The site was approved for the storage of equipment, such as dump trucks, within the designated parking lot. However, aerial imagery and previous city site visits indicate that addi@onal, unapproved materials have been stored on the property, including areas outside of the parking lot, as shown in the photos below. Runoff from materials or equipment stored outside the parking lot drains directly toward the wetland to the north, contribu@ng to the degrada@on of the wetland north of the project. To prevent this, no equipment or materials should be stored outside of the designated parking area. Under the proposed improvements, runoff from equipment stored within the parking lot will be treated by the sumped catch basin prior to discharge which protects the downstream pond. 2024 Aerial 2021 Aerial 136 Project Site Survey The site is proposed to store the following equipment outside: - (1) Interna@onal HV Tandem with interchangeable boxes. - (4) Interna@onal MV single axles with interchangeable boxes. - (1) Interna@onal CV single axle Truck - (3) 1-Ton pick-up Truck - (8) ½-ton pick-up Trucks - (3) Interchangeable truck boxes - (3) flatbed trailers - (1) Dump Trailer - (1) Enclosed trailer - (1) JLG Telehandler - (2) Skid Steers - Misc Skid Steer ALachments. - Customer Equipment awai@ng delivery. The sumped catch basin should be reevaluated if there is any vehicle fueling or materials stored on site outside of the list above to provide a more adequate form of treatment. STORM WATER MANAGEMENT The proposed project is located within the jurisdic@on of the Riley Purgatory Bluff Creek Watershed District and is therefore subject to its rules and regula@ons. The applicant must 137 determine whether a permit from the watershed district is required for the proposed work and provide documenta@on of all required permits prior to the start of construc@on ac@vi@es. The proposed design includes a sumped catch basin to capture sediment prior to discharging from the site. This is adequate for the proposed use of the site. If the proposed use of the site changes from equipment storage or includes vehicle fueling or material storage, the sumped catch basin should be reevaluated to include a treatment structure. Stormwater from the northern grassy areas discharges directly to the wetland north of the site. No materials or equipment should be stored outside of the parking lot to protect downstream resources. All stormwater infrastructure on the site will be privately owned and maintained. The applicant shall prepare an Opera@on and Maintenance (O&M) Plan for the private stormwater infrastructure onsite. Maintenance of private stormwater systems is required in perpetuity. The O&M Plan must be approved by the Water Resources Engineer, or their designee, and recorded against the benefi@ng property. The stormwater O&M agreement shall be recorded prior to the issuance of city permits. ANALYSIS The planning commission shall recommend a condi@onal use permit and the council shall issue such condi@onal use permits only if it finds that such use at the proposed loca@on: a) Will not be detrimental to or endanger the public health, safety, comfort, convenience, or general welfare of the neighborhood or the city. The contractor’s yard will not be detrimental to or endanger public health, safety, comfort, convenience, or general welfare of the neighborhood or city. b) Will be consistent with the objec@ves of the city's comprehensive plan and this chapter. This proposal is consistent with the objec ves of the comprehensive plan and this chapter. c) Will be designed, constructed, operated, and maintained so to be compa@ble in appearance with the exis@ng or intended character of the general vicinity and will not change the essen@al character of that area. The proposal is compa ble with appearance and character of the vicinity as this area is home to other contractor yards. d) Will not be hazardous or disturbing to exis@ng or planned neighboring uses. The proposal will not be hazardous or disturbing to exis ng or planned neighboring uses. e) Will be served adequately by essen@al public facili@es and services, including streets, police and fire protec@on, drainage structures, refuse disposal, water and sewer systems, and schools; or will be served adequately by such facili@es and services 138 provided by the persons or agencies responsible for the establishment of the proposed use. The proposed will be served adequately by facili es and services. f) Will not create excessive requirements for public facili@es and services and will not be detrimental to the economic welfare of the community. The proposal will not create excessive requirements for public facili es and services and will not be detrimental to the economic welfare of the community. g) Will not involve uses, ac@vi@es, processes, materials, equipment, and condi@ons of opera@on that will be detrimental to any persons, property, or the general welfare due to excessive produc@on of traffic, noise, smoke, fumes, glare, odors, rodents, or trash. The contractor’s yard shall conform to these requirements. h) Will have vehicular approaches to the property which do not create traffic conges@on or interfere with traffic or surrounding public thoroughfares. The proposal will u lize exis ng property exits & entrances. i) Will not result in the destruc@on, loss or damage of solar access, natural, scenic or historic features of major significance. The proposal will not result in the destruc on, loss or damage of solar access, natural, scenic or historic features of major significance. j) Will be aesthe@cally compa@ble with the area. The proposed will be aesthe cally compa ble with the area. k) Will not depreciate surrounding property values. The proposed will not depreciate surrounding property value. l) Will meet standards prescribed for certain uses as provided in this ar@cle. The proposed will meet standards prescribed for certain uses as provided in this ar cle. (Ord. No. 80, Art. III, § 2(3-2-3), 12-15-86; Ord. No. 377, § 23, 5-24-04) PLANNING COMMISSION RECOMMENDATION The Chanhassen Planning Commission recommended approval of the requested condi@onal use permit for a contractor’s yard at 1480 Park Road subject to the condi@ons of the staff report. STAFF RECOMMENDATION Staff recommend approval of the requested condi@onal use permit for a contractor’s yard at 1480 Park Road, subject to the condi@ons listed herein. Condi2onal Use Permit Condi2ons 1. Outdoor storage area shall be enclosed with 95% opaque fencing 8’ in height. Fencing shall be maintained in good condi@on at all @mes. 139 2. All materials and equipment stored outdoors, excluding vehicles, shall not exceed the height of the required storage area fencing. 3. Materials and equipment placed within the outdoor storage area shall not emit odors, produce excessive noise, or be hazardous. 4. All materials and equipment shall be stored on paved surfaces. 5. Any expansion of the exis@ng opera@on beyond the approved site plan in the condi@onal use permit #26-05 shall require amendment to the condi@onal use permit. Staff Comments Building 1. Any retaining walls (if present) built that are more than four feet high, measured from the boLom of the foo@ng to the top of the wall, must be designed by a professional engineer and a building permit must be obtained prior to construc@on. Retaining walls (if present) under four feet in height require a zoning permit. 2. Any fences built that are over 7’ in height require a building permit prior to construc@on. Fire 1. Schedule an on-site inspec@on with the Fire Department to inspect the building and access to the site when applicable. Planning 1. Applicant shall update the site plan to meet F4 fencing requirement, a minimum of 8 feet tall and 95% opaque. This fencing shall be provided along all sides of the outdoor storage yard. Forestry 1. Applicant shall update the site plan to meet Buffer Yard D requirements for screening of the equipment and supply storage, as stated in Code Sec@on 20-289. 2. Plan@ng plan shall provide a breakdown of the species diversifica@on to verify the proposed meets city code requirements for species diversity. No more than 10% from same species, no more than 20% from same genus and no more than 30% from the same family. 3. The five (5) trees to be removed on the east side of the building shall be replaced in accordance with city code. Water Resources 1. It is the applicant’s responsibility to ensure that permits are received from all other applicable agencies with jurisdic@on over the project (i.e. Army Corps of Engineers, DNR, 140 Carver County, DOLI, Board of Water and Soil Resources, MDH, MPCA, etc.). The applicant shall submit verifica@on that all applicable permits have been secured prior to the issuance of the condi@onal use permit. 2. The applicant shall develop a maintenance plan for the onsite stormwater system. An opera@ons and maintenance agreement shall be recorded prior to the issuance of condi@onal use permit. 141 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA CONDITIONAL USE PERMIT #26-05 1. Permit. Subject to the terms and conditions set forth herein, the City of Chanhassen hereby grants a conditional use permit for a contractor’s yard at 1480 Park Road. 2. Property. The permit for the property situated in the City of Chanhassen, Carver County, Minnesota, and legally described in Exhibit A. 3. Conditions. The permit is issued subject to the following conditions: 1. Outdoor storage area shall be enclosed with 95% opaque fencing 8’ in height. Fencing shall be maintained in good condition at all times. 2. All materials and equipment stored outdoors, excluding vehicles, shall not exceed the height of the required storage area fencing. 3. Materials and equipment placed within the outdoor storage area shall not emit odors, produce excessive noise, or be hazardous. 4. All materials and equipment shall be stored on paved surfaces. 5. Any expansion of the existing operation beyond the approved site plan in the conditional use permit #26-05 shall require amendment to the conditional use permit. 4. Termination of Permit. The City may revoke the permit following a public hearing for violation of the terms of this permit. 5. Lapse. If within one year of the issuance of this permit the authorized construction has not been substantially completed or the use commenced, this permit shall lapse, unless an extension is granted in accordance with the Chanhassen Zoning Ordinance. 6. Criminal Penalty. Violation of the terms of this conditional use permit is a criminal misdemeanor. Dated: April 27, 2026 142 CITY OF CHANHASSEN BY: ___________________________ Elise Ryan, Mayor AND: ___________________________ Laurie Hokkanen, City Manager STATE OF MINNESOTA ) ( ss COUNTY OF CARVER ) The foregoing instrument was acknowledged before me this day of , 20___, by Elise Ryan, Mayor, and by Laurie Hokkanen, City Manager, of the City of Chanhassen, a Minnesota municipal corporation, on behalf of the corporation and pursuant to the authority granted by its City Council. __________________________________ NOTARY PUBLIC 143 Exhibit A 144 EXHIBIT B 145 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA FINDINGS OF FACT AND DECISION IN RE: Application of Steinhagen Properties LLC for a Conditional Use Permit (CUP). On April 7, 2026, the Chanhassen Planning Commission met at it’s regularly scheduled meeting to consider the application of Steinhagen Properties LLC for a contractor’s yard conditional use permit. The Planning Commission conducted a public hearing on the proposed conditional use permit, preceded by published and mailed notice. FINDINGS OF FACT 1. Permit. On March 6, 2026, the city received a completed land use application for the property legally described in Exhibit A (“Property”), located at 1480 Park Road requesting a conditional use permit for a contractor’s yard on the Property. 2. Property. The Property is currently zoned Industrial Office Park (IOP). The Property is guided by the 2040 Land Use Plan for Office Industrial Use. Contractor’s yards are considered a Conditional Use within the Industrial Office Park (IOP) zoning district. 3. Conditions. The permit is issued subject to the following conditions: 1. Outdoor storage area shall be enclosed with 95% opaque fencing 8’ in height. Fencing shall be maintained in good condition at all times. 2. All materials and equipment stored outdoors, excluding vehicles, shall not exceed the height of the required storage area fencing. 3. Materials and equipment placed within the outdoor storage area shall not emit odors, produce excessive noise, or be hazardous. 4. All materials and equipment shall be stored on paved surfaces. 5. Any expansion of the existing operation beyond the approved site plan in the conditional use permit #26-05 shall require amendment to the conditional use permit. 4. Termination of Permit. The city may revoke the permit following a public hearing for violation of the terms of this permit. The city may institute any proper action or proceeding at 146 law or at equity to prevent violations of the within property, to restrain or abate violations of the within permit, or to prevent use or occupancy of the Subject Property. 5. Lapse. If within one year of the issuance of this permit the authorized construction has not been substantially completed or the use commenced, this permit shall lapse, unless an extension is granted in accordance with the Chanhassen Zoning Ordinance. 6. Criminal Penalty. Violation of the terms of this conditional use permit is a criminal misdemeanor. DECISION The City Council approves the conditional use permit based on the findings of fact included herein, and subject to the conditions of the staff report. ADOPTED by the Chanhassen City Council this 27th day of April 2026. CHANHASSEN CITY COUNCIL BY:___________________________________ Its Mayor BY:_ __________________________________ Its City Manager 147 EXHIBIT A 148 EXHIBIT B 149 City Council Item April 27, 2026 Item Award Design Contract for Rehabilitation of Wells 7 and 13 File No.ENG 26-07 Item No: D.8 Agenda Section CONSENT AGENDA Prepared By Charlie Howley, Director of Public Works/City Engineer Reviewed By Laurie Hokkanen SUGGESTED ACTION "The Chanhassen City Council approves a design contract with BARR Engineering for the Rehabilitation of Wells 7 and 13." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY Consider an award of a design contract for annual well rehabilitation work. BACKGROUND The city has a plan for annual well rehabilitations. Typically, a municipal well is rehabbed every 8 to 10 years. The city currently has 12 active municipal wells. This project is for well no's 7 and 13. Well 7 was originally installed in 1996 and last rehabbed in 2018. Well 13 was originally installed in 2008 and last rehabilitated in 2017. DISCUSSION BARR Engineering has performed nearly all of our well installation and rehabilitation design services. They know our infrastructure and staff and have performed exemplary work thus far. The contract is based on our standard professional services template. 150 BUDGET Well Rehabilitations are included in our 5-yr Capital Improvement Plan, which includes the design services. The budget for the 2026 rehabilitation work is $180,000. BARR's proposal is for $34,000 which is the basis for the not-to-exceed contract. RECOMMENDATION Staff recommends awarding the design contract to BARR Engineering. ATTACHMENTS Barr_Chanhassen_Wells 7 13 Rehab Contract 151 1 Barr_Chanhassen_Wells 7 & 13 Rehab Contract PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this 27th day of April, 2026, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and BARR ENGINEERING Co., ("Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for Design and Construction Administration Services for the Well #7 and #13 Rehabilitation Project. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Insurance Certificate; C. Consultant’s April 2, 2026 proposal (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “C” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of Thirty-Four Thousand Dollars ($34,000), inclusive of expenses. Services performed directly by Consultant shall be paid at an hourly rate in accordance with the Proposal, subject to the not to exceed fee. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 152 2 Barr_Chanhassen_Wells 7 & 13 Rehab Contract 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each occurrence/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 153 3 Barr_Chanhassen_Wells 7 & 13 Rehab Contract 11. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 13. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 14. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 15. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 154 4 Barr_Chanhassen_Wells 7 & 13 Rehab Contract 16. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 17. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 18. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 19. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 20. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including payment for services performed or furnished to the date and time of termination. Dated: _______________, 2026. CITY OF CHANHASSEN BY: _____________________________________________ Elise Ryan, Mayor BY: _____________________________________________ Laurie Hokkanen, City Manager Dated: _______________, 2026. BARR ENGINEERING, Co. BY: _____________________________________________ ____________ Its __________________ Brian LeMon Vice President April, 2 155 City Council Item April 27, 2026 Item Accept Bids and Award Contract for the 2026 Sealcoat Project File No.Project No. 26-05 Item No: D.9 Agenda Section CONSENT AGENDA Prepared By Mackenze Grunig, Project Engineer Reviewed By Charlie Howley SUGGESTED ACTION "The Chanhassen City Council approves awarding a contract for the 2026 Sealcoat Project to Allied Blacktop Company for roadway sealcoating and crack sealing in the amount of $189,800.00." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY BACKGROUND Annually, the city performs a sealcoat project to extend the life of its street pavement. The Pavement Management Program identified the streets in the project for maintenance this year. Staff visited each street to review the pavement condition and confirm that sealcoating was appropriate visually. DISCUSSION A sealcoat program is a cost-effective tool to protect the capital asset of a street and extend the life of the street system. Sealcoating is the application of asphalt emulsion (oil) followed immediately with an aggregate cover (rock). Sealcoating of streets is beneficial because it: Can delay or eliminate further aging of pavement due to water and sun 156 Seals the surface to provide a moisture barrier Fills in raveled pavement areas Seals smaller cracks temporarily or permanently Performs minor leveling Restores surface friction to improve wheel grip Economically prolongs the life of existing pavements It is estimated that a sealcoat application extends the life of pavement from five to seven years at a fraction of the cost of street rehabilitations or reconstructions. As such, it is more cost-effective to sealcoat roadways when fewer pavement distresses are present versus letting the pavement deteriorate until major, costly rehabilitation or reconstruction projects are required. This project also included a bid alternate to add an additional street to the seal coat and due to the positive bids received, we are recommending going forward with it. BUDGET City staff solicited bids by advertising in the local newspaper and QuestCDN two weeks prior to the bid opening. On April 17, 2026, two bids were received for the 2026 Sealcoat Project No. 26-05. Bid Amounts for the project are shown below: BIDDER BASE BID ALTERNATE TOTAL BID (1) Allied Blacktop Company $121,257.00 $68,543.00 $189,800.00 Pearson Bros. Inc.$161,796.00 $95,989.00 $257,785.00 Engineer's Estimate $163,735.00 $92,475.00 $256,210.00 Allied Blacktop Company has completed previous projects in the City of Chanhassen. Their past work has been acceptable. Sealcoating activities will occur this summer and city staff will send out notifications to all affected property owners prior to work commencing. (1) For the 2026 budget year is funding sealcoating as an operational expense out of the Street Maintenance portion of the General Fund. The overall project budget was $202,000. Assessments are not utilized for sealcoating work. RECOMMENDATION Staff recommends awarding of the 2026 Sealcoating project to Allied Blacktop Co. ATTACHMENTS 26-05 Tabulate and Compare Bids Advertisement for Bids 157 Seal Coat City wide 2026 Map Sealcoat Project No. 26-05 Agreement 158 Item Description Estimated Unit Total Unit Total # Quantity Units Price Price Price Price 1 MNDOT 2356.506 CRS-2P BITUMINOUS MATERIAL FOR SEALCOAT 11,100 GAL $2.20 $24,420.00 $5.00 $55,500.00 2 MNDOT 2356.506 FA-2 MODIFIED 1/8" CLASS A DRESSER (TRAP ROCK) 41200 SY $1.76 $72,512.00 $1.33 $54,796.00 3 CRACKSEALING MATERIAL 8,300 LB $2.75 $22,825.00 $5.00 $41,500.00 4 EXTRA STREET SWEEPING 1 LS $1,500.00 $1,500.00 $10,000.00 $10,000.00 TOTALS $121,257.00 $161,796.00 Item Description Estimated Unit Total Unit Total # Quantity Units Price Price Price Price A1 MNDOT 2356.506 CRS-2P BITUMINOUS MATERIAL FOR SEALCOAT 6,300 GAL $2.20 $13,860.00 $5.00 $31,500.00 A2 MNDOT 2356.506 FA-2 MODIFIED 1/8" CLASS A DRESSER (TRAP ROCK) 23300 SY $1.76 $41,008.00 $1.33 $30,989.00 A3 CRACKSEALING MATERIAL 4,700 LB $2.75 $12,925.00 $5.00 $23,500.00 A4 EXTRA STREET SWEEPING 1 LS $750.00 $750.00 $10,000.00 $10,000.00 ALTERNATE 1 TOTALS $68,543.00 $95,989.00 BASE BID + ALT 1 $189,800.00 $257,785.00 Apparent Low Bid Apparent 2nd Low Allied Blacktop Co. Pearson Bros., Inc. Allied Blacktop Co. Pearson Bros., Inc. Apparent Low Bid Apparent 2nd Low Bid Tabulation and Comparison 2026 Sealcoat Project No. 26-05 Bid Tab Page 1 15 9 ADVERTISEMENT FOR BIDS Sealed bids will be received by the Engineering Department at the City of Chanhassen, Minnesota in the City Hall at 7700 Market Boulevard, until 10:00 AM, C.D.T. Friday, April, 17, 2026, at which time they will be publicly opened and read aloud for the furnishing of all labor, materials and appurtenances necessary for the following: 2026 SEALCOAT PROJECT NO. 26-05 In general the work consists of the following approximate quantities: 17,500 GAL CRS-2P Bituminous Material 64,500 SY FA-2 Modified 1/8” Cl. "A" Dresser Trap Rock 13,000 LB Cracksealing Material Complete digital project bidding documents are available at www.questcdn.com. Digital plan documents may be downloaded for $22.00 by inputting Quest Project #10106608 on the website’s Project Search page. For assistance and free membership registration, contact QuestCDN at 952-233-1632 or info@questcdn.com. Contractors may examine plans and specifications on file in the office of the City Engineer, 7700 Market Boulevard, Chanhassen, MN 55317. Please contact Mackenze Grunig at 952-227-1165 or mgrunig@chanhassenmn.gov with any questions. Bid Security in the amount of five percent (5%) of the amount of the Bid must accompany each Bid in accordance with the Instructions to Bidders. The OWNER reserves the right to retain the deposits of the three lowest bidders for a period not to exceed 60 days after the date and time set for the opening of bids. No bids may be withdrawn for a period of 60 days after the date and time set for the opening of bids. The OWNER reserves the right to reject any and all bids, to waive irregularities and informalities therein and further reserves the right to award the Contract to the best interests of the OWNER. It is anticipated that the bids will be considered by the Chanhassen City Council at their meeting on April 27, 2026. Laurie Hokkanen, City Manager City of Chanhassen, Minnesota (Publish in the Sun Sailor on March 19, 2026) (Publish on www.questcdn.com) 160 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ S e a l C o a t M a p \ 2 0 2 6 \ S e a l C o a t 2 0 2 6 . a p r x 2026 Sealcoat Project City of Chanhassen Lake Virginia Christmas Lake Lotus Lake Brendan Pond Lake Harrison Kerber Pond Lake Susan Rice Marsh Lake Lake Riley Rice Lake Lake St. Joe Lake Minnewashta Lake Ann Lake Lucy ST18 ST15 ST14 ST17 ST61 Minnewashta Regional Park North Lotus Lake Park Meadow Green Park Lake Ann Park Chanhassen Pond Park Chanhassen Nature Preserve Chanhassen Recreation Center Lake Susan Park Rice Marsh Lake Preserve Power Hill Park Fox Woods Preserve Bandimere Community Park Bluff Creek Golf Course Hesse Farm Park Preserve Lake Susan Preserve Raguet Wildlife Management Are MN Valley National Wildlife Re MN Landscape Arboretum Seminary Fen Scientific & Nat* Bluff Creek Preserve Independent School District 11 Independent School District 112 Independent School District 276 Riley Ridge Park Lake Ann Park Preserve SA41 SA5 SA5 SA101 SA7 )212 Au d u b o n R d Lyman Blvd Ga l p i n B l v d Pioneer Trl Po w e r s B l v d Flying Clo u d D r C o R d 1 0 1 Date Created: 7/28/2025 Created By: City of Chanhassen - Engineering Department µ0 0.06 Mile 0 280 Feet Sealcoat 2026 Page 1 of 6 161 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ S e a l C o a t M a p \ 2 0 2 6 \ S e a l C o a t 2 0 2 6 . a p r x 2026 Sealcoat Project - Washta Bay Rd City of Chanhassen Brendan Pond Lake Minnewashta W ashtaBayRd S a n d p i p e r Trl Highover Dr Higho v e r W a y Oriole Ave High o v e r Tr l Fo r e stAv e L a k e L u c y Rd Forest Cir O r c h a r d L n Highover Ct N WashtaBayCt Tanagers L n Ta n a g e r s P t North Manor R d 64th St W H i g hover Ln P i p e rR i dge L n M i n n e w a s h t a Wo odsDr Minnewashta Regional Park Independent School District 276 SA7 SA41 Hwy 7 Ha z e l t i n e B l v d 1 3 5 - 2 0 13 6 - 1 0 373- 2 0 304-30 373-10 3 7 3 - 3 0 420-2 0 42 0 - 1 0 1 3 5 - 1 0 30 5 - 1 0 1-1 0 304-20 3 7 3 - 4 0 298-10 27 9 - 1 0 304-10455-1 0 Date Created: 7/28/2025 Created By: City of Chanhassen - Engineering Department µ0 0.06 Mile 0 280 Feet Sealcoat 2026 Page 2 of 6 162 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ S e a l C o a t M a p \ 2 0 2 6 \ S e a l C o a t 2 0 2 6 . a p r x 2026 Sealcoat Project - Lakeway Ct City of Chanhassen La k e w a y D r Lake Lucy Rd La k e w a y C t 50 9 - 1 Date Created: 7/28/2025 Created By: City of Chanhassen - Engineering Department µ0 0.06 Mile 0 280 Feet Sealcoat 2026 Page 3 of 6 163 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ S e a l C o a t M a p \ 2 0 2 6 \ S e a l C o a t 2 0 2 6 . a p r x 2026 Sealcoat Project - Anthem Pl City of Chanhassen Lake Lucy Rd Yos em ite Av e Anthem Pl 505-10 Date Created: 7/28/2025 Created By: City of Chanhassen - Engineering Department µ0 0.06 Mile 0 280 Feet Sealcoat 2026 Page 4 of 6 164 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ S e a l C o a t M a p \ 2 0 2 6 \ S e a l C o a t 2 0 2 6 . a p r x 2026 Sealcoat Project - Eagle Ridge Rd City of Chanhassen Eagle Ridge Rd E a g l e C t H a w kcrest Cir E a g l e B l u f f C i r E a g l e R i dge W a y H a w k c r e s t Ct Fox Woods Preserve Bandimere Community Park Gr e a t P l a i n s B l v d ST101 74 2 - 1 0 743-1 0 8 6 5 741-30 744 - 1 0 74 1 - 2 0 74 1 - 1 0 Date Created: 7/28/2025 Created By: City of Chanhassen - Engineering Department µ0 0.06 Mile 0 280 Feet Sealcoat 2026 Page 5 of 6 165 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ S e a l C o a t M a p \ 2 0 2 6 \ S e a l C o a t 2 0 2 6 . a p r x 2026 Sealcoat Project - Park Rd City of Chanhassen Fla m i n g o D r R o s e w o odDr Suffolk Dr Pelican C t A u d u b o n R d L a k e A n n P a r k Dr L a k e D r W Co m m e r c e D r E s s e x R d Lake Dr B ittern Ct We s t L a k e D r LakeSu s a n H i l l s D r D o v e C t P owers Pl E g r e t C t S w a nC t Bu r l w o o d D r H e r o n Dr Powers Bl v d M a l l o r y C t I b i s C t Park Ct P ar k Dr U p l a n d C i r Coulter Blvd McGlynn Dr ArboretumBlvd P a r k R d WestL a k e Ct W 7 8 t h S t P a r k Pl M otorple x C t ST17 Lake Ann Park Lake Susan Park SA5 Arboretum Blvd Powers Blvd 313-20 312 - 1 0 313-30 313-10 Date Created: 7/28/2025 Created By: City of Chanhassen - Engineering Department µ0 0.06 Mile 0 280 Feet Sealcoat 2026 Page 6 of 6 166 1 175881v1 FORM OF AGREEMENT BETWEEN CITY OF CHANHASSEN AND CONTRACTOR FOR 2026 SEALCOAT PROJECT NO. 26-05 THIS AGREEMENT, made this 27th day of April, 2026, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation (“Owner”) and ALLIED BLACKTOP COMPANY (“Contractor”). Owner and Contractor, in consideration of the mutual covenants set forth herein, agree as follows: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents”, all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement; B. Specifications dated March 13, 2026; , C. City of Chanhassen General Conditions of the Construction Contract; D. Quote/Bid dated 4/17/2026. In the event of a conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 2. OBLIGATIONS OF THE CONTRACTOR. The contractor shall provide the goods, services, and perform the work in accordance with the Contract Documents. 3. CONTRACT PRICE. Owner shall pay Contractor for completion of the Work in accordance with the Contract Documents the amount of One hundred eighty-nine thousand eight hundred dollars 00/100 ($189,800.00). 4. PAYMENT PROCEDURES. A. Contractor shall submit Applications for Payment. Applications for Payment will be processed by Engineer as provided in the General Conditions. B. Progress Payments; Retainage. Owner shall make 95% progress payments on account of the Contract Price on the basis of Contractor’s Applications for Payment during performance of the Work. C. Payments to Subcontractor. 167 2 175881v1 (1) Prompt Payment to Subcontractors. Pursuant to Minn. Stat. § 471.25, Subd. 4a, the Contractor must pay any subcontractor within ten (10) days of the Contractor’s receipt of payment from the City for undisputed services provided by the subcontractor. The Contractor must pay interest of 1 ½ percent per month or any part of a month to the Subcontractor on any undisputed amount not paid on time to the subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100.00 or more is $10.00. For an unpaid balance of less than $100.00, the Contractor shall pay the actual penalty due to the subcontractor. (2) Form IC-134 (attached) required from general contractor. Minn. Stat. § 290.92 requires that the City of Chanhassen obtain a Withholding Affidavit for Contractors, Form IC-134, before making final payments to Contractors. This form needs to be submitted by the Contractor to the Minnesota Department of Revenue for approval. The form is used to receive certification from the state that the vendor has complied with the requirement to withhold and remit state withholding taxes for employee salaries paid. D. Final Payment. Upon final completion of the Work, Owner shall pay the remainder of the Contract Price as recommended by Engineer. 5. COMPLETION DATE/LIQUIDATED DAMAGES. A. The work for streets must be completed on or before September 30, 2026 and be ready for final payment in accordance with the General Conditions. B. Contract and Owner recognize that time is of the essence of this Agreement and that Owner will suffer financial loss if the Work is not completed within the times specified in Paragraph 5.A. above, plus any extensions thereof allowed. The parties also recognize the delays, expense, and difficulties involved in proving in a legal or arbitration proceeding the actual loss suffered by Owner if the Work is not completed on time. Accordingly, instead of requiring any such proof, Owner and Contractor agree that as liquidated damages for delay (but not as a penalty), Contractor shall pay Owner $900.00 for each calendar day that expires after the time specified in Paragraph 5.A. for Completion until the Work is complete. 168 3 175881v1 6. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor has visited the Site and become familiar with and is satisfied as to the general, local, and Site conditions that may affect cost, progress, and performance of the Work. C. Contractor is familiar with and is satisfied as to all federal, state, and local Laws and Regulations that may affect cost, progress, and performance of the Work. D. Contractor has carefully studied all: (1) reports of explorations and tests of subsurface conditions at or contiguous to the Site and all drawings of physical conditions in or relating to existing surface or subsurface structures at or contiguous to the Site (except Underground Facilities) which have been identified in the General Conditions and (2) reports and drawings of a Hazardous Environmental Condition, if any, at the site. E. Contractor has obtained and carefully studied (or assumes responsibility for doing so) all additional or supplementary examinations, investigations, explorations, tests, studies, and data concerning conditions (surface, subsurface, and Underground Facilities) at or contiguous to the Site which may affect cost, progress, or performance of the Work or which relate to any aspect of the means, methods, techniques, sequences, and procedures of construction to be employed by Contractor, including any specific means, methods, techniques, sequences, and procedures of construction expressly required by the Bidding Documents, and safety precautions and programs incident thereto. F. Contractor does not consider that any further examinations, investigations, explorations, tests, studies, or data are necessary for the performance of the Work at the Contract Price, within the Contract Times, and in accordance with the other terms and conditions of the Contract Documents. G. Contractor is aware of the general nature of work to be performed by Owner and others at the Site that relates to the Work as indicated in the Contract Documents. H. Contractor has correlated the information known to Contractor, information and observations obtained from visits to the Site, reports and drawings identified in the Contract Documents, and all additional 169 4 175881v1 examinations, investigations, explorations, tests, studies, and data with the Contract Documents. I. Contractor has given Engineer written notice of all conflicts, errors, ambiguities, or discrepancies that Contractor has discovered in the Contract Documents, and the written resolution thereof by Engineer is acceptable to Contractor. J. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. K. Subcontracts: (1) Unless otherwise specified in the Contract Documents, the Contractor shall, upon receipt of the executed Contract Documents, submit in writing to the Owner the names of the Subcontractors proposed for the work. Subcontractors may not be changed except at the request or with the consent of the Owner. (2) The Contractor is responsible to the Owner for the acts and omissions of the Contractor's subcontractors, and of their direct and indirect employees, to the same extent as the Contractor is responsible for the acts and omissions of the Contractor's employees. (3) The Contract Documents shall not be construed as creating any contractual relation between the Owner, the Engineer, and any Subcontractor. (4) The Contractor shall bind every Subcontractor by the terms of the Contract Documents. 7. WORKER’S COMPENSATION. The Contractor shall obtain and maintain for the duration of this Contract, statutory Worker’s Compensation Insurance and Employer’s Liability Insurance as required under the laws of the State of Minnesota. 8. COMPREHENSIVE GENERAL LIABILITY. Contractor shall obtain the following minimum insurance coverage and maintain it at all times throughout the life of the Contract, with the City included as an additional name insured on a primary and non- contributory basis. The Contractor shall furnish the City a certificate of insurance satisfactory to the City evidencing the required coverage: Bodily Injury: $2,000,000 each occurrence $2,000,000 aggregate products and completed operations 170 5 175881v1 Property Damage: $2,000,000 each occurrence $2,000,000 aggregate Contractual Liability (identifying the contract): Bodily Injury: $2,000,000 each occurrence Property Damage: $2,000,000 each occurrence $2,000,000 aggregate Personal Injury, with Employment Exclusion deleted: $2,000,000 aggregate Comprehensive Automobile Liability (owned, non-owned, hired): Bodily Injury: $2,000,000 each occurrence $2,000,000 each accident Property Damage: $2,000,000 each occurrence 9. WARRANTY. The Contractor guarantees that all new equipment warranties as specified within the quote shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship, materials, and equipment which may develop in any part of the contracted service, and upon proper notification by the City shall immediately replace, without cost to the City, any such faulty part or parts and damage done by reason of the same in accordance with the bid specifications. 10. INDEMNITY. The Contractor agrees to indemnify and hold the City harmless from any claim made by third parties as a result of the services performed by it. In addition, the Contractor shall reimburse the City for any cost of reasonable attorney’s fees it may incur as a result of any such claims. 11. MISCELLANEOUS. A. Terms used in this Agreement have the meanings stated in the General Conditions. B. Owner and Contractor each binds itself, its partners, successors, assigns and legal representatives to the other party hereto, its partners, successors, assigns and legal representatives in respect to all covenants, agreements, and obligations contained in the Contract Documents. C. Any provision or part of the Contract Documents held to be void or unenforceable under any Law or Regulation shall be deemed stricken, and all remaining provisions shall continue to be valid and binding upon Owner and Contractor, who agree that the Contract Documents shall be 171 6 175881v1 reformed to replace such stricken provision or part thereof with a valid and enforceable provision that comes as close as possible to expressing the intention of the stricken provisions. D. Data Practices/Records. (1) All data created, collected, received, maintained or disseminated for any purpose in the course of this Contract is governed by the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, any other applicable state statute, or any state rules adopted to implement the act, as well as federal regulations on data privacy. (2) All books, records, documents and accounting procedures and practices to the Contractor and its subcontractors, if any, relative to this Contract are subject to examination by the City. E. Software License. If the equipment provided by the Contractor pursuant to this Contract contains software, including that which the manufacturer may have embedded into the hardware as an integral part of the equipment, the Contractor shall pay all software licensing fees. The Contractor shall also pay for all software updating fees for a period of one year following cutover. The Contractor shall have no obligation to pay for such fees thereafter. Nothing in the software license or licensing agreement shall obligate the City to pay any additional fees as a condition for continuing to use the software. F. Patented devices, materials and processes. If the Contract requires, or the Contractor desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Contractor shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the Owner. If no such agreement is made or filed as noted, the Contractor shall indemnify and hold harmless the Owner from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the Project agreed to be performed under the Contract, and shall indemnify and defend the Owner for any costs, liability, expenses and attorney's fees that result from any such infringement G. Assignment. Neither party may assign, sublet, or transfer any interest or obligation in this Contract without the prior written consent of the other party, and then only upon such terms and conditions as both parties may agree to and set forth in writing. H. Waiver. In the particular event that either party shall at any time or times waive any breach of this Contract by the other, such waiver shall not 172 7 175881v1 constitute a waiver of any other or any succeeding breach of this Contract by either party, whether of the same or any other covenant, condition or obligation. I. Governing Law/Venue. The laws of the State of Minnesota govern the interpretation of this Contract. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County. J. Severability. If any provision, term or condition of this Contract is found to be or become unenforceable or invalid, it shall not affect the remaining provisions, terms and conditions of this Contract, unless such invalid or unenforceable provision, term or condition renders this Contract impossible to perform. Such remaining terms and conditions of the Contract shall continue in full force and effect and shall continue to operate as the parties’ entire contract. K. Entire Agreement. This Contract represents the entire agreement of the parties and is a final, complete and all-inclusive statement of the terms thereof, and supersedes and terminates any prior agreement(s), understandings or written or verbal representations made between the parties with respect thereto. L. Permits and Licenses; Rights-of-Way and Easements. The Contractor shall procure all permits and licenses, pay all charges and fees therefore, and give all notices necessary and incidental to the construction and completion of the Project. The City will obtain all necessary rights-of- way and easements. The Contractor shall not be entitled to any additional compensation for any construction delay resulting from the City’s not timely obtaining rights-of-way or easements. M. If the work is delayed or the sequencing of work is altered because of the action or inaction of the Owner, the Contractor shall be allowed a time extension to complete the work but shall not be entitled to any other compensation. CITY OF CHANHASSEN CONTRACTOR: ALLIED BLACKTOP COMPANY BY: BY: Elise Ryan, Mayor Its BY: Laurie Hokkanen, City Manager 173 City Council Item April 27, 2026 Item Approve 2026 Sanitary and Storm Sewer Televising and Cleaning Contract File No.27-04 Item No: D.10 Agenda Section CONSENT AGENDA Prepared By Mackenze Grunig, Project Engineer Reviewed By Charlie Howley SUGGESTED ACTION "The Chanhassen City Council approves a contract for 2026 Sanitary and Storm Sewer Televising and Cleaning Project No. 27-04 with Pipe Services for a not-to-exceed amount of $76,436.80." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY BACKGROUND DISCUSSION Sanitary sewer televising consists of cleaning the sewer pipes and recording video along the entire length of the pipe. The City typically performs this work in areas included in upcoming city projects. Storm sewer televising generally consists only of cleaning when debris levels prevent the camera from progressing through the pipe. The contractor will document and report any deficiencies observed during the video inspection. The City of Chanhassen issued a request for quotes to five contractors on April 6, 2026, and received five responses. Quotes were evaluated based on total cost, including mobilization, sanitary sewer 174 cleaning and televising, and storm sewer televising. Based on the unit prices submitted, staff finds the quotes to be reasonable for the scope of work. The low bidder, Pipe Services, has previously completed similar work for the City of Chanhassen, and their performance was satisfactory. BUDGET Funding for this work has been budgeted for in the Capital Improvement Plan (CIP), Project SS-012, and Project ST-012. $48,301.00 of the funding will come from SS-012 for the portion of sanitary sewer televising and cleaning associated with the contract, and $28,135.80 of the funding will come from ST- 012 for the portion of the storm sewer televising. Staff is proposing a not-to-exceed contract for 110% of the low bid, or $76,436.80, in the event unexpected emergency services or quantity overruns are required. RECOMMENDATION Staff recommends approving the sewer televising contract. ATTACHMENTS Televising RFQ 2027 Sanitary and Storm Areas Maps - 27-04 2027 Final Quote Tabulation Pipe Services Quote 2027-04 FORM OF AGREEMENT AWARD 175 Request for Quotes 2026 City Televising Project City Project N. 27-04 Distribution Date: April 6, 2026 I. INTRODUCTION The City of Chanhassen (City) is issuing this Request for Quote (RFQ) for sanitary sewer and storm sewer televising. In general, the project includes cleaning and televising sanitary sewer mainlines, televising storm sewer mainlines and submitting electronic and paper reports to the City. A. RFQ Content. This RFQ contains the following sections: I. Introduction II. Project Information III. Quotes IV. Project Tabulations and Project Maps B. Addenda/Clarifications. Any changes to this RFQ will be made by written addendum. C. Contract Award. Issuance of this RFQ and receipt of quotes does not commit the City to award a contract. The City reserves the right to postpone opening for its own convenience, to accept or reject any or all quotes received in response to this RFQ, to negotiate with other than the selected Contractor should negotiations with the selected be terminated, to negotiate with more than one Contractor simultaneously, or to cancel all or part of this RFQ. D. Contact Person. The contact for specific questions regarding information in this proposal is: Mackenze Grunig City of Chanhassen 7700 Market Boulevard P.O. Box 147 Chanhassen, MN 55317 (952) 227-1165, Fax (952) 227-1170 mgrunig@chanhassenmn.gov 176 RFQ Sanitary Sewer and Storm Sewer Televising Page 2 4/6/2026 II. PROJECT INFORMATION A. Project Areas. It is mandatory to do a site visit prior to supplying a quote to become familiar with and satisfied as to the general, local and site conditions that may affect cost, progress, and performance of the Work. The City is interested in receiving quotes for sanitary sewer televising and cleaning and storm sewer televising in the areas shown on the attached maps. Since some of the work is in rear-yard easements, a special condition for entering rear yards (i.e. different equipment and property owner notification) may be needed. The cost of this shall be incorporated into the quote submittal. B. Project Specifications. Sewer televising and cleaning shall be performed in accordance with Section 19.00 of Chanhassen’s 2026 Sanitary and Storm Sewer Specifications and is attached to the RFQ. Storm sewer televising shall be performed in accordance with Section 19.00 as well, however cleaning is only necessary if debris is encountered that prevents televising of the storm sewer mainline from upstream to downstream structures. As such, the contractor shall supply two bid schedules, one for sanitary sewer televising and one for storm sewer televising. The Contractor performing the television inspection shall be certified by the NASSCO Pipeline Assessment and Certification Program (PACP). All pipe inspections should adhere to the NASSCO PACP standard codes and ratings. Digital record drawings of the sanitary sewer and storm sewer in the project will be made available upon request. The approximate depth of sewers ranges from 3’ to 25’, sanitary pipe sizes range from 8-10” and storm pipe sizes range from 12” to 42”. The total footage of sanitary sewer lines and storm sewer lines are approximately 16,532 LF and 10,345 LF, respectively. The scope of this work will require all cleaning and televising to be done by the contractor. Upon review of the televising work, if it is not deemed acceptable, determined solely by the City, when cleaned or televised the first time will be re-cleaned and re-televised at the contractor’s expense. Reports for each segment of televised pipe will be submitted with televising data following completion of the Work. One digital copy report must be provided that includes all televising sections within the Project. Reports and digital files shall include the following report types and information as required by PACP standards including but not limited to: 1. Pipe Graphic Report: a. Asset ID (Pipe segment reference number) b. Date Inspected/Televised c. Plan Sheet/Map Number (as shown in the plans) 177 RFQ Sanitary Sewer and Storm Sewer Televising Page 3 4/6/2026 d. Upstream Manhole ID e. Downstream Manhole ID f. Street Name (or neighborhood/area if not near street) g. Pipe Type h. Pipe Size i. Pipe Length j. Cleaning Performed (Jetting, Root Cutting, etc.) k. Location of Service Connections l. Locations of Leaks or Joint Separation m. Location of Damaged Section (including nature of damage and location with respect to pipe axis) n. Deflection in alignment or grade of pipe o. Location of any repairs p. Comments indicating conditions, visual inspection items, areas of concern, and other pertinent information 2. Tabular Report: a. Same requirements as Pipe Graphic Report b. PACP pipeline condition ratings i. Structural ii. O & M iii. Overall 3. PACP Pipeline Condition Ratings tabular file (Excel or CSV): a. Pipe segment reference number b. Quick Structural Rating c. Quick O&M Rating d. Quick Overall Rating e. Structural Rating f. O&M Rating g. Overall Rating h. Structural Rating Index i. O&M Rating Index j. Overall Rating Index 178 RFQ Sanitary Sewer and Storm Sewer Televising Page 4 4/6/2026 Digital copies of the reports will be submitted in Adobe PDF, Microsoft Word, Microsoft Excel, or other compatible format as approved by the City. Digital copies will be submitted on the same media device as the digital video recordings, and be labeled by the Asset ID number. The Contractor is required to deliver a NASSCO PACP Standard Database in Microsoft Access format that references the manhole and pipe segment numbers provided by the City. Digital video recordings will be made by the Contractor. Video will be submitted to meet the following formats: a) MPEG-4 (*.mp4, *.m4a, *.m4v) b) Video size will be a minimum of 320 pixels by 240 pixels. c) The minimum video frame rate will be 30 frames/second (fps) d) Video will include the following data for each pipe segment: 1. Asset ID/Report Number 2. Date of Inspection 3. Direction of inspection (upstream, downstream, north, south, etc.) 4. Upstream and downstream manhole numbers 5. Current/progressive distance along pipe length (tape counter footage) e) Video will include the following audio for each pipe segment: 1. Date and time of video inspection 2. Inspection company 3. Name of street or (neighborhood/area if not near street) 4. Upstream and downstream manhole numbers 5. Description of pipe size, type, and joint length. 6. Description of direction of video (upstream, downstream, north, south, etc.) Upon completion of the project, the Contractor will supply the digital data (televising videos, reports, database, maps, etc.) on either a USB flash drive or external hard drive. Also attached to this RFQ is the general Form of Agreement along with the City of Chanhassen’s 2025 General Conditions which are incorporated as part of the Agreement. 179 RFQ Sanitary Sewer and Storm Sewer Televising Page 5 4/6/2026 C. Project Schedule. The following is the anticipated project schedule: Quotes Received Award Contract April 20, 2026 April 27, 2026 Notice to Proceed Project Complete April 30, 2026 July 31, 2026 III. QUOTES A. Submission of Quotes. Submit the quotes via email to: Mackenze Grunig, Project Engineer mgrunig@chanhassenmn.gov Emailed quotes shall be received by 3:00 p.m. CDT, Monday, April 20, 2026. Quotes received after this time will not be accepted. Include, at a minimum, the following: 1. Identification of the offering contractor(s), including name, address and telephone number of each firm, 2. Acknowledgement of receipt of RFQ addenda, if any. 3. Samples of a video and inspection log and proof of PACP certification. 4. Name, title, address, email address and telephone and fax numbers of contact person during period of proposal evaluation. 5. Bid Tabulation. 6. No bid bond required. 180 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Sewer Televising: Bluff Creek Estates City of Chanhassen " "" " " " " " " """ "" " " "" "" " " " " " " " "" "" " " " " " " " "" " "" " " " " " " "" " " " " " " "" " " " " " " " " " " " """"" " " " " " " " " " " """ "" " " " " " " " " " " """" "" " " " " " " "" " " " """" " "" " " " """" " " "" "" " " "" Valley Ridge Ct Osprey Ln Au d u b o n R d V alle y V ie w C t HeronDr Valley Ridge Trl S Al i s a L n Valley Ridge Pl Valley Vie w P l V a l l e y Ridge Trl N Al i s a C t Lake Dr W S u n ri d g e C t 37-013 37-015 37-019 37-027 37-029 37-032 37-036 37-035 37-044 37-045 37-043 37-041 37-040 37-030 37-033 37-039 37-038 37-037 37-034 37-031 37-02837-026 37-025 37-023 37-02137-018 37-016 37-020 37-022 37-024 Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 181 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Sewer Televising: Chanhassen Estates City of Chanhassen " " " " " " " " " " " " " " " " """ " " " " " " " " " " "" " " " " " """" " " " " " """ " "" " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " """ "" " " " " " " " " " " " " " " "" " " " " " " "" " " " " " " " " " " " " " " " """""" " " " " " " "" " " " " " " "" " " " " " " " " " " " " " "" " " " " " " " " " " Da k o t a L n A r b o r etum B l vd H i d d e n Ct LakeDrE Da k o t a A v e Cheyenne Spur Eri e Spu r Dakota Cir E r i e A v e Ch e y e n n e A v e SA5 A r b o r e t u m B l v d 29-117 29-131 29-133 29-132 29-128 29-126 29-118 29-121 29-119 29-134 29-130 29-127 29-114 29-125 29-115 29-123 29-129 29-138 29-142 Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 182 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Sewer Televising: Lake Susan Hills City of Chanhassen " " " " " " " " " " " " " " " "" " " " """" " " " " " " "" "" "" " " " " " " " "" " " " " " " " "" " " " " """" " " " " " " " "" "" "" " " " " " " " " " " " " " " " " " "" " " " "" """ " " "" " """ " " " """" " " " " " " " " " "" "" " " "" " """""" " " " """" " " " " " " """ " " " """ " " " " " " " " " """" " " "" " """" "" " " " " " " """" "" """" " " "" """ " " " " """ " " " """ " " " " " " " "" "" " " "" " " "" " " " " " " " " " " " "" """" "" " " " " " " " L a k e S u s a n D r Rosewood Dr La k e S u s a n H i l l s D r SuffolkDr Tern Ct L a k e S u s a n C t H e r o n D r Kingfis h e r Ct E s s e x Rd Thrus h Ct C h a n h assen HillsDrN Barbara Ct Dove Ct Fl a m i n g o D r E g ret C t Pelic a n C t Bu r l w o o d Dr We s t L a k e D r La k e D r W P o w e rs Pl Dr a k e C t West Lake Ct ST17 Po w e r s B l v d 34-135 34-133 34-145 34-146 34-088 38-075 34-083 34-090 34-096 34-095 34-105 34-101 34-110 34-114 34-115 34-118 34-124 34-139 34-123 34-122 34-116 34-119 34-117 34-111 34-125 34-127 34-13634-137 34-132 34-13434-130 34-140 34-141 34-14234-138 34-131 34-129 34-126 34-121 34-112 34-108 34-094 34-091 34-086 38-058 38-060 38-062 38-061 38-059 38-05738-056 38-055 34-165 34-120 34-147 34-144 34-148 34-149 Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 183 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Sewer Televising: Lake Riley Blvd City of Chanhassen "" " " " " "" "" " """ """" " " " " """ """ " " " " " " """ "" " "" " """ " " "" " """" " """" " " """"" "" " " " "" "" " "" " " " " " " " " """""""""""""""" "" " " " " " " " " " " " " " " " " " " " " " " " " " " """ " " " " " " " " " " " """ " " " " " " " " " " " " "" " " S h o r e v i e w C t Parkland Way S p r i n g f i e l d D r G re e nleaf C t ReflectionsRd Greenvie wDr Chesterfield L n S u n n y v a l e Dr Kiowa Trl L y ma n B l v d La k e R i l e y B l v d Su m m erfield Dr Deerfoot Trl 18 42-064 39-032 39-033 42-106 42-105 42-104 42-103 42-102 42-096 42-094 42-08942-084 42-066 42-107 Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 184 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Storm Televising: Lake Susan Hills City of Chanhassen " "" " " " " " " " " " " " " " " """" " "" "" " " " " " " " " " " " " " " " "" " " " " " " """ " " """ " " " " " " "" " " "" " " " " "" " "" " " " "" " " " " " " " " """ " " "" " " """ " " " " " "" " " " " " " "" " " """ " " " " " " " "" " " "" " " " " "" "" " " " " " "" "" " " " " " " " "" " " " "" " " " " " """" "" " " " " "" " " " " " " " """"" " """ " " " " "" " " " " " " " " "" " " " """" "" " " "" """ " 78 632 787788 789 790 791 792 1462 L a k e S u sa n D r Rosewood Dr Lake Susan Hil l s D r Suffolk D r L a k e D r W Mergan s e r C t Tern Ct Kingfisher C t L a k e S u s a n C t Essex Rd Thrus h C t H e r o n D r C h a n hassen HillsDrN Barbara Ct Dove Ct F l a m i n g o D r E g ret C t Pelic a n C t Bu r l w o o d Dr West Lake Dr Powers P l D ra ke C t West Lake Ct ST17 1168 1282 1284 1294 1295 2410 2409 2408 2140 21392411 3626 3983 2407 2406 3627 3624 3625 3639 3495 3637 3638 3636 3635 3492 3493 34943959 3496 3633 3634 3644 3645 3642 3643 3647 3648 3649 3646 3640 36413631 Po w e r s B l v d µ0 0.05 Mile 0 300 Feet Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 185 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Storm Televising: W 86th St/Tigua Lane City of Chanhassen " " " " " " " " " " " " " " " """ "" "" " " " " " " " " " "" " """ " " " "" " " " " " " " " " " " " " "" " " " " " " " " " """ " " " " """ " " " " " " " " "" "" "" " " " " " " "" " " " " """"" "" " " " " " " " "" " "" " " " "" " "" """" """""" "" " " "" " " "" " " " " " " " " " " " " "" " " " " " " "" "" " """" " " " "" " " " """" " " "" " " " " " " " " " """ " """ " " " " " " " " " " " " " " " " " " " " " 537 M ission Hills D r Mission Hills Way E Mayfield C t F r isco Ct Re f l e c t i o n s R d MissionHills Wa y W Mission Hills Ct W 86th St R i c e C t Mission Hills Ln M o n k C t BlackbirdCt Heartland Ct M i s s i o n H i l l s C i r Marshland Trl T i g u a L n A l d r i c h D r P r e s e r v e C t W aters E d ge D r 1194 4104624 )212 2037 2044 2045 1684 1683 2038 2043 2042 20402039 Gre at Plain s Blv d Hwy 212 ST101 µ0 0.05 Mile 0 300 Feet Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 186 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Storm Televising: Bluff Creek Estates City of Chanhassen " " " "" " " " " " " " " " " " " " """" " " " " " " " " " " " " " """" " "" "" " "" " " " " " " " "" " " " """ " " "" """ " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " """ "" " " " " " "" " " "" "" " " " " "" " " " " " " " " " " 641645 648 649 650 651 652 685 686 687 688 Valley Ridge Ct Osprey L n Au d u b o n R d V alle y V ie w C t HeronDr V a lleyRidge Trl S Al i s a L n Valley Ridge Pl Valley V ie w P l Valley Ridge Trl N Al i s a C t Lake Dr W S u n ri d g e C t 1253 2661 2679 26782680 2867 2865 2866 2869 2857 2858 28592860 2861 28622863 2864 28522853 2854 2855 2856 2871 2870 2872 2686 2685 2684 2683 2682 2681 2691 2690 2689 2692 2687 2688 8918 8919 8920 8925 8927 8928 µ0 0.05 Mile 0 300 Feet Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 187 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Storm Televising: Chanhassen Estates City of Chanhassen " " "" " " " " "" " " " " " """" " " " " " " " " " " " " " " " "" " " " " " " " " " " " " " " " " " " " "" " " " " " " " " " " " " " " " "" "" "" " " " " "" " " " " " " "" " "" " " " " " " " " " " " " " " " " "" " " "" " " "" " " " " " " " " """ " " 813 5563 Hidden Ln Da k o t a L n A r b o retum Blvd Hidden Ct Da k o t a A v e Lake DrE Cheyenne Spur Eri e S p u r Dakota Cir Er i e A v e Cheyenne Ave SA5 3738 3736 3735 3739 3734 3726 3723 3724 3721 3722 3719 3720 3718 3733 37413740 3742 3743 3744 3745 3732 3730 3727 3728 3731 3729 3725 A r b o r e t u m B l v d µ0 0.05 Mile 0 300 Feet Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 188 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Storm Televising: Lake Riley Blvd City of Chanhassen " " " " " " "" " " " " " " "" " " " " " " " " " " " " " " " " " " " " " " " " " " " "" "" "" " "" " " " " " " " """"""" " " " " " " " " " "" "" "" " " """ " " " " " " " """ " " " " """ "" " " 10 1 8 80 774 775 801 809 8454 S h o r e v i e w C t Parkland Way S p r i n g f i e l d D r G r e e nleaf Ct ReflectionsR d Greenview Dr Chesterfield Ln S u n n y v a l e D r K i o w aTrl Lyman Blvd La k e R i l e y B l v d Su m merfieldDr Deerfoot Trl 1184 1343 3696 106 µ0 0.05 Mile 0 300 Feet Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 189 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Storm Televising: Dell Road City of Chanhassen " " " " " " "" " " " " " " " " " "" " " " " " " " " " " " """ " " " " " " " """ " " """ " "" " " " " " """ " " " " " " " " " " " "" """ " " " " " " " " " " " " " " " " " " " " "" " " " " " 342 5645 8479 W 77th St De l l R d W 78th St W 1 8 7 t h S t Q u a ttr o D r 1242 SA5 9777 97789779 9780 2183 2177 2181 2184 9776 2383 11682 11683 2182 2174 2175 2176 2162 Arboretum Blvd µ0 0.05 Mile 0 300 Feet Date Created: 3/12/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 190 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 2026 Storm Televising: Bluff Creek Blvd City of Chanhassen """ " " " " " """ " " " " " " "" " "" " " " " "" " " " " " " "" " "" " """ """"" " """ " " " " " " " "" "" 8 3 3 9445 15636 18516 18519 18626 18627 18628 Hesse Farm Rd W e s t F a r m R d H e i d i L n B l u f f C r e e k D r BluffCir HesseFarm C ir ST61 8484 4006 4411 18850 )212 9123 9124 9125 9126 14450 14452 14453 18855 18856 18857 1885818859 H w y 2 1 2 Flyi n g C l o u d D r µ0 0.05 Mile 0 300 Feet Date Created: 3/26/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 191 ITEM NO.PAY ITEM UNIT UNIT PRICE CONTRACT QTY TOTAL UNIT PRICE TOTAL UNIT PRICE TOTAL UNIT PRICE TOTAL UNIT PRICE TOTAL UNIT PRICE TOTAL 1 Sanitary ROW LF 2.00$ 18300 36,600.00$ 1.74 31,842.00$ 1.56 28,548.00$ 2.75 50,325.00$ 2.35 43,005.00$ 1.91 34,953.00$ 2 Storm ROW LF 2.25$ 11400 25,650.00$ 1.74 19,836.00$ 2.48 28,272.00$ 1.50 17,100.00$ 2.35 26,790.00$ 3.82 43,548.00$ 3 Sanitary Easement LF 2.75$ 2600 7,150.00$ 3.98 10,348.00$ 5.98 15,548.00$ 2.75 7,150.00$ 5.50 14,300.00$ 3.82 9,932.00$ 4 Storm Easement LF 3.00$ 3300 9,900.00$ 1.74 5,742.00$ 1.20 3,960.00$ 1.75 5,775.00$ 5.50 18,150.00$ 7.64 25,212.00$ 5 Heavy Cleaning HR 500.00$ 5 2,500.00$ 344 1,720.00$ 500 2,500.00$ 920.00 4,600.00$ 395 1,975.00$ 425 2,125.00$ Total 81,800.00$ Total 69,488.00$ Total 78,828.00$ Total 84,950.00$ Total 104,220.00$ Total 115,770.00$ HK SolutionsEngineer's Estimate 2027 TELEVISING TABULATION - CITY PROJECT NUMBER 27-04 VisuSewerPipe Services American EnvironmentalEmpire 19 2 1 QUOTATION – SEWER TELEVISING/CLEANING April 4th, 2026 Mackenze Grunig, PE Project Engineer City of Chanhassen 7901 Park PL Chanhassen, MN 55317 Dear Mr. Mackenze Grunig, As requested, below is a bid proposal for the Chanhassen storm televising only and sanitary cleaning and televising project according to the indicated linear footages and pipe sizes. City of Chanhassen Cost Distribution: Confirmed Linear Footages, Pipe Sizes, and Activities Pipe Size/Type Pipe Length/Qty Activity Cost/Linear Foot/Qty Sanitary – Right of Way 18,300 TV/CLN $1.74/LF Storm – Right of Way 11,400 TV $1.74/LF Sanitary – Easement 2,600 TV/CLN $3.98/LF Storm – Easement 3,300 TV $1.74/LF Total $ 67,768.00 Change Order Pre- Approved Pipe Size/Type Pipe Length/Qty Activity Cost/Linear Foot/Qty Heavy Cleaning – Roots 5 CLN $344.00/hr Total $ TBD 16281 Baseline Ave. Shakopee, MN 55379 952.445.3173 │ info@pipe-services.com Website: pipe-services.com 193 2 CITY Official, all change order activities require CITY consent prior to initiation. Change order activities below $500.00 are authorized via verbal CITY directive/consent. Change order activities exceeding $500.00 require written approval via email or memorandum letter. Upon City Approval - Change Order Rates Activity / Vehicle Unit Cost Per Unit T.V. Vehicle Support Per Hour $ 337.00 Hydrovac Vehicle Support Per Hour $ 357.00 T.V. Vehicle Emergency Mobilization Per Day $ 1,200.00 Hydrovac Vehicle Emergency Mobilization Per Day $ 1,400.00 Water By-Pass Operations Per Hour $ 350.00 CITY Official, please be cognizant of the below provisions. These provisions exist to help ensure clarity of project scope and expectations relating to contingency efforts. The spirit of these provisions is meant to enhance communication during project execution in order to align Pipe Service's decisions with CITY officials' interests: quality work, cost management, and situational awareness. Change Order Contingencies: All change order activities will first involve CITY/FIRM approval. The Pipe Services project lead will contact the designated CITY/FIRM official, explain the situation, advise the associated pros and cons, and implement a course of action according to the CITY/FIRM official's directive. 1. Work outside of the aforementioned project scope will require a per hour charge rate of: $337/hour for CCTV support and $357/hour for Hydrovac support. All change orders will require CITY/FIRM approval prior to execution. 2. In the event the CITY/FIRM requests plugging services at an hourly rate to stem high water levels, Pipe Services will assess water flow rates. If prior to or during plugging operations Pipe Services assess that the combination of high-water levels and high flow rates excessively risks flooding residential or public infrastructure, Pipe Services will request that CITY/FIRM conducts the plugging operations or authorize a pump bypass change order. CITY/FIRM provided plugging operations will incur an hourly r ate charge according to associated Pipe Services vehicles. 3. In the event the CITY/FIRM requests Pipe Services conduct water bypass operations under high water level and high flow rate conditions, the CITY/FIRM will incur an hourly pump rate charge of $350.00 per hour and a bypass equipment mobilization fee. 4. During emergency mobilization requests outside of project scope, CITY will incur a mobilization charge according to vehicle usage and the mobilization rate quoted within the aforementioned change order price disbursement chart. Emergency work is generally charged by the hour according to half-day and full-day activity. In the event the emergency mobilization request involves extensive work, Pipe Services will work with the CITY official to identify an affordable price structure outside of the hourly rate and associated daily emergency mobilization charges. Non-emergency out-of-scope mobilization charges are agreed upon on a case- by-case basis depending on vehicle availability and the customers requested timeline. Our bid is based on the following provisions and understandings: 194 3 The below provisions and understandings are standard expectations. Any project irregularities that do not allow for these provisions can be negotiated but will likely change the associated bid amount. 1.) Pipe Services will honor this bid for up to 45 days from the date of submission/document creation date. We will make every effort to honor the bid past the 45-day mark. 2.) Pipe Services will receive payment within 30 days of completing the aforementioned described project activities to the satisfaction of the CITY. 3.) Pipe Services to provide 1 typed reports and portable hard drive for televised services. All inspections will be done in certified PACP format. Reporting system will provide color stills of major incidents and a summary report of all “significant findings". Along with a importable database for GIS. 4.) All inspections to be completed with a color pan & tilt TV camera. 5.) CITY/FIRM to provide sewer maps, manhole numbering and pipe identification system. 6.) CITY/FIRM to locate and expose all man-holes (MH) and to make them accessible. In the event a MH cannot be identified or requires exposure, Pipe Services will coordinate with the CITY to identify a course of action. During the interim, Pipe Services will skip the MH in question and continue planned inspections. If the city chooses to utilize Pipe Services for location or exposure of a MH, an hourly rate will apply according to associated vehicle usage 7.) Pipe Services is allowed to draw water from CITY fire hydrants at no additional cost. 8.) Pipe Services assumes that all dumping will take place at CITY location free of charge. If a dump location is not provided free of charge, Pipe Services will charge a Hyrdovac vehicle hourly rate according to dump site location and any associated dump fees. Does not apply to Chanhassen bid. 9.) If during the course of vacuuming operations Pipe Services discovers that environmentally hazardous materials exists and special disposal procedures are necessary (for example large amounts of oil), CITY will incur charges associated with the dump fees and drive time to the special dump site location according to associated vehicle usage. 10.) During televising only operations not associated with cleaning, Pipe Services will make every attempt to bypass obstacles within the pipe. If bypass operations endanger the camera system or if bypassing is not an option, Pipe Services will utilize a reverse set-up operation and charge accordingly. All reverse set-up operations incur full footage charge for that pipe segment length for the initial attempt and the reverse operation effort. If a pipe line presents multiple reverse set-up requirements, Pipe Services will contact the CITY/FIRM to consult on a course of action in an effort to avoid unnecessary charges. 195 4 Acceptance of Proposal The above prices, specifications and conditions are satisfactory and are hereby accepted. Pipe Services Corporation is authorized to do the work as specified. By: ______________________________ City/Legal Entity of:______________ Signature: _________________________ Date: ___________________________ We would like to thank you again for the opportunity to work with the city of Chanhassen. Sincerely, Pipe Services Corporation Ryan Mergen Ryan R. Mergen CEO ▪ Pipe Services 16281 Baseline Avenue ▪ Shakopee, MN 55379 (O) 952-445-3173 ▪ info@pipe-services.com http://pipe-services.com/ 196 1 175881v1 FORM OF AGREEMENT BETWEEN CITY OF CHANHASSEN AND CONTRACTOR FOR 2027 SANITARY SEWER I&I PROJECT NO 27-04 THIS AGREEMENT, made this 27 day of April, 2026, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation (“Owner”) and THE FATHER SOLANUS CASEY MISSION LLC, a Minnesota limited liability company, dba Pipe Services (“Contractor”). Owner and Contractor, in consideration of the mutual covenants set forth herein, agree as follows: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents”, all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement; B. Request for Quote dated April 6, 2026; C. 2025 General Conditions; D. 2025 Sanitary and Storm Sewer Construction Specifications – Section 19.00. E. Quote/Bid dated April 18, 2026. In the event of a conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts with Contract Document “A” having the first priority and Contract Document “E” having the last priority. 2. OBLIGATIONS OF THE CONTRACTOR. The contractor shall provide the goods, services, and perform the work in accordance with the Contract Documents. This contract may be terminated by the City at any time upon discovery by the City that the Contractor or any of its subcontractors has submitted a false statement under oath verifying compliance with any of the minimum criteria set forth in Minn. Stat. §16C.285, Subdivision 3, the Responsible Contractor statute. 3. CONTRACT PRICE. Owner shall pay Contractor for completion of the Work in accordance with the Contract Documents the amount of Seventy-six thousand four hundred thirty-six dollars 80/100 ($76,436.80). 4. PAYMENT PROCEDURES. A. Contractor shall submit Applications for Payment. Applications for Payment will be processed by Engineer as provided in the General Conditions. 197 2 175881v1 B. Progress Payments; Retainage. Owner shall make 95% progress payments on account of the Contract Price on the basis of Contractor’s Applications for Payment during performance of the Work. C. Payments to Subcontractor. (1) Prompt Payment to Subcontractors. Pursuant to Minn. Stat. § 471.25, Subd. 4a, the Contractor must pay any subcontractor within ten (10) days of the Contractor’s receipt of payment from the City for undisputed services provided by the subcontractor. The Contractor must pay interest of 1 ½ percent per month or any part of a month to the Subcontractor on any undisputed amount not paid on time to the subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100.00 or more is $10.00. For an unpaid balance of less than $100.00, the Contractor shall pay the actual penalty due to the subcontractor. (2) Form IC-134 (attached) required from general contractor. Minn. Stat. § 290.92 requires that the City of Chanhassen obtain a Withholding Affidavit for Contractors, Form IC-134, before making final payments to Contractors. This form needs to be submitted by the Contractor to the Minnesota Department of Revenue for approval. The form is used to receive certification from the state that the vendor has complied with the requirement to withhold and remit state withholding taxes for employee salaries paid. D. Final Payment. Upon final completion of the Work, Owner shall pay the remainder of the Contract Price as recommended by Engineer. 5. COMPLETION DATE/LIQUIDATED DAMAGES. A. The Work associated with the Project must be completed and ready for final payment in accordance with the General Conditions by August 29, 2025. B. Contract and Owner recognize that time is of the essence of this Agreement and that Owner will suffer financial loss if the Work is not completed within the times specified in Paragraph 5.A. above, plus any extensions thereof allowed. The parties also recognize the delays, expense, and difficulties involved in proving in a legal or arbitration proceeding the actual loss suffered by Owner if the Work is not completed on time. Accordingly, instead of requiring any such proof, Owner and Contractor agree that as liquidated damages for delay (but not as a 198 3 175881v1 penalty), Contractor shall pay Owner $400.00 for each calendar day that expires after the time specified in Paragraph 5.A. for Completion until the Work is complete. Daily costs are based on MnDOT Table 1807.1-1, "Schedule of Liquidated Damages as follows: TABLE 1807.1-1 SCHEDULE OF LIQUIDATED DAMAGES Original Contract Amount Charge Per Cal. Day, ($) From More Than ($) To and Including ($) 0 25,000 300 25,000 100,000 400 100,000 500,000 900 500,000 1,000,000 1,200 1,000,000 2,000,000 1,500 2,000,000 5,000,000 2,500 5,000,000 10,000,000 3,000 10,000,000 --- 3,500 6. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor has visited the Site and become familiar with and is satisfied as to the general, local, and Site conditions that may affect cost, progress, and performance of the Work. C. Contractor is familiar with and is satisfied as to all federal, state, and local Laws and Regulations that may affect cost, progress, and performance of the Work. D. Contractor has carefully studied all: (1) reports of explorations and tests of subsurface conditions at or contiguous to the Site and all drawings of physical conditions in or relating to existing surface or subsurface structures at or contiguous to the Site (except Underground Facilities) which have been identified in the General Conditions and (2) reports and drawings of a Hazardous Environmental Condition, if any, at the site. E. Contractor has obtained and carefully studied (or assumes responsibility for doing so) all additional or supplementary examinations, investigations, explorations, tests, studies, and data concerning conditions (surface, subsurface, and Underground Facilities) at or contiguous to the Site which 199 4 175881v1 may affect cost, progress, or performance of the Work or which relate to any aspect of the means, methods, techniques, sequences, and procedures of construction to be employed by Contractor, including any specific means, methods, techniques, sequences, and procedures of construction expressly required by the Bidding Documents, and safety precautions and programs incident thereto. F. Contractor does not consider that any further examinations, investigations, explorations, tests, studies, or data are necessary for the performance of the Work at the Contract Price, within the Contract Times, and in accordance with the other terms and conditions of the Contract Documents. G. Contractor is aware of the general nature of work to be performed by Owner and others at the Site that relates to the Work as indicated in the Contract Documents. H. Contractor has correlated the information known to Contractor, information and observations obtained from visits to the Site, reports and drawings identified in the Contract Documents, and all additional examinations, investigations, explorations, tests, studies, and data with the Contract Documents. I. Contractor has given Engineer written notice of all conflicts, errors, ambiguities, or discrepancies that Contractor has discovered in the Contract Documents, and the written resolution thereof by Engineer is acceptable to Contractor. J. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. K. Subcontracts: (1) Unless otherwise specified in the Contract Documents, the Contractor shall, upon receipt of the executed Contract Documents, submit in writing to the Owner the names of the Subcontractors proposed for the work. Subcontractors may not be changed except at the request or with the consent of the Owner. (2) The Contractor is responsible to the Owner for the acts and omissions of the Contractor's subcontractors, and of their direct and indirect employees, to the same extent as the Contractor is responsible for the acts and omissions of the Contractor's employees. 200 5 175881v1 (3) The Contract Documents shall not be construed as creating any contractual relation between the Owner, the Engineer, and any Subcontractor. (4) The Contractor shall bind every Subcontractor by the terms of the Contract Documents. 7. WORKER’S COMPENSATION. The Contractor shall obtain and maintain for the duration of this Contract, statutory Worker’s Compensation Insurance and Employer’s Liability Insurance as required under the laws of the State of Minnesota. 8. COMPREHENSIVE GENERAL LIABILITY. Contractor shall obtain the following minimum insurance coverage and maintain it at all times throughout the life of the Contract, with the City included as an additional name insured on a primary and non- contributory basis. The Contractor shall furnish the City a certificate of insurance satisfactory to the City evidencing the required coverage: Bodily Injury: $2,000,000 each occurrence $2,000,000 aggregate products and completed operations Property Damage: $2,000,000 each occurrence $2,000,000 aggregate Contractual Liability (identifying the contract): Bodily Injury: $2,000,000 each occurrence Property Damage: $2,000,000 each occurrence $2,000,000 aggregate Personal Injury, with Employment Exclusion deleted: $2,000,000 aggregate Comprehensive Automobile Liability (owned, non-owned, hired): Bodily Injury: $2,000,000 each occurrence $2,000,000 each accident Property Damage: $2,000,000 each occurrence 9. WARRANTY. The Contractor guarantees that all new equipment warranties as specified within the quote shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship, materials, and equipment which may develop in any part of the contracted service, and upon proper notification by the City shall immediately replace, without cost to the City, any such faulty part or parts and damage done by reason of the same in accordance with the bid specifications. 201 6 175881v1 10. INDEMNITY. The Contractor agrees to indemnify and hold the City harmless from any claim made by third parties as a result of the services performed by it. In addition, the Contractor shall reimburse the City for any cost of reasonable attorney’s fees it may incur as a result of any such claims. 11. MISCELLANEOUS. A. Terms used in this Agreement have the meanings stated in the General Conditions. B. Owner and Contractor each binds itself, its partners, successors, assigns and legal representatives to the other party hereto, its partners, successors, assigns and legal representatives in respect to all covenants, agreements, and obligations contained in the Contract Documents. C. Any provision or part of the Contract Documents held to be void or unenforceable under any Law or Regulation shall be deemed stricken, and all remaining provisions shall continue to be valid and binding upon Owner and Contractor, who agree that the Contract Documents shall be reformed to replace such stricken provision or part thereof with a valid and enforceable provision that comes as close as possible to expressing the intention of the stricken provisions. D. Data Practices/Records. (1) All data created, collected, received, maintained or disseminated for any purpose in the course of this Contract is governed by the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, any other applicable state statute, or any state rules adopted to implement the act, as well as federal regulations on data privacy. (2) All books, records, documents and accounting procedures and practices to the Contractor and its subcontractors, if any, relative to this Contract are subject to examination by the City. E. Software License. If the equipment provided by the Contractor pursuant to this Contract contains software, including that which the manufacturer may have embedded into the hardware as an integral part of the equipment, the Contractor shall pay all software licensing fees. The Contractor shall also pay for all software updating fees for a period of one year following cutover. The Contractor shall have no obligation to pay for such fees thereafter. Nothing in the software license or licensing agreement shall obligate the City to pay any additional fees as a condition for continuing to use the software. 202 7 175881v1 F. Patented devices, materials and processes. If the Contract requires, or the Contractor desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Contractor shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the Owner. If no such agreement is made or filed as noted, the Contractor shall indemnify and hold harmless the Owner from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the Project agreed to be performed under the Contract, and shall indemnify and defend the Owner for any costs, liability, expenses and attorney's fees that result from any such infringement G. Assignment. Neither party may assign, sublet, or transfer any interest or obligation in this Contract without the prior written consent of the other party, and then only upon such terms and conditions as both parties may agree to and set forth in writing. H. Waiver. In the particular event that either party shall at any time or times waive any breach of this Contract by the other, such waiver shall not constitute a waiver of any other or any succeeding breach of this Contract by either party, whether of the same or any other covenant, condition or obligation. I. Governing Law/Venue. The laws of the State of Minnesota govern the interpretation of this Contract. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County. J. Severability. If any provision, term or condition of this Contract is found to be or become unenforceable or invalid, it shall not affect the remaining provisions, terms and conditions of this Contract, unless such invalid or unenforceable provision, term or condition renders this Contract impossible to perform. Such remaining terms and conditions of the Contract shall continue in full force and effect and shall continue to operate as the parties’ entire contract. K. Entire Agreement. This Contract represents the entire agreement of the parties and is a final, complete and all inclusive statement of the terms thereof, and supersedes and terminates any prior agreement(s), understandings or written or verbal representations made between the parties with respect thereto. L. Permits and Licenses; Rights-of-Way and Easements. The Contractor shall procure all permits and licenses, pay all charges and fees therefore, and give all notices necessary and incidental to the construction and 203 8 175881v1 completion of the Project. The City will obtain all necessary rights-of- way and easements. The Contractor shall not be entitled to any additional compensation for any construction delay resulting from the City’s not timely obtaining rights-of-way or easements. M. If the work is delayed or the sequencing of work is altered because of the action or inaction of the Owner, the Contractor shall be allowed a time extension to complete the work but shall not be entitled to any other compensation. CITY OF CHANHASSEN CONTRACTOR: THE FATHER SOLANUS CASEY MISSION LLC DBA PIPE SERVICES BY: BY: Elise Ryan, Mayor Its BY: Laurie Hokkanen, City Manager 204 City Council Item April 27, 2026 Item Approve Temporary On-Sale Liquor License, July 2, 3 & 4, 2026, Rotary Club of Chanhassen File No.Item No: D.11 Agenda Section CONSENT AGENDA Prepared By Priya Wall, Recreation Manager Reviewed By Jerry Ruegemer SUGGESTED ACTION “The Chanhassen City Council approves the request from Chanhassen Rotary Club for a temporary on-sale intoxicating liquor license to sell alcoholic beverages at the 4th of July Celebration on July 2, 3 & 4, 2026 at City Center Park. Approval is contingent upon the Rotary Club providing and updated certificate of liquor liability insurance.” Motion Type Simple Majority Vote of members present Strategic Priority N/A SUMMARY The Chanhassen Rotary Club submitted a temporary on-sale intoxicating liquor license application for a 4th of July Celebration on July 2, 3 & 4, 2026. Liquor will be served in City Center Park and is outlined in the attached map. Alcohol will be served: July 2: 3pm-8pm July 3: 3pm-midnight July 4: 10am-5pm 205 BACKGROUND In prior years, alcohol has been served only on July 3 and July 4 as part of the 4th of July Celebration. This was due to July 3 & 4 having a significantly larger all-ages crowd and activities as compared to July 2, which traditionally only hosted families at the Carnival. 2026 is the first year the Chanhassen Rotary Club will serve alcohol on July 2. At the time of the 4th of July Celebration, Civic Campus Phase 2 construction will be wrapping up, and grass will not yet be established in the traditional area designated for beer sales and the beer garden. Because of this, beer sales and the beer garden will be hosted in a temporary location for 2026, before moving back to the traditional area in 2027 when construction and amenities are complete. DISCUSSION With the expansion of activities and attendance on July 2 and to provide options for attendees, the Chanhassen Rotary Club will offer alcohol sales on July 2. Sales will be limited to 3pm-8pm. The Chanhassen Rotary Club will reimburse the City for costs incurred due to this expansion, including necessary staffing, equipment rental, and waste removal costs. The beer sales and beer garden location will either be hosted in the area of Ballfield #1 at City Center Park, north of the west parking lot and trail, or in the west parking lot of City Center Park, south of the trail. The northern location on Ballfield #1 is the preferred location and is pending permission from Independent School District 112. Parkland north of the trail (including Ballfield #1) is ISD 112 property, and any alcohol sales there require district permission. BUDGET RECOMMENDATION Staff recommends approval of the Chanhassen Rotary Club’s request for a temporary on-sale liquor license for the 4th of July Celebration on July 2, 3 & 4, 2026 in City Center Park. Approval is contingent upon receipt of an updated certificate of liquor liability insurance. ATTACHMENTS Temporary Liquor License Application Liquor Sales Location Map 206 Minnesota Department of Public Safety Alcohol and Gambling Enforcement Division 445 Minnesota Street, Suite 1600, St. Paul, MN 55101 651-201-7507 Fax 651-297-5259 TTY 651-282-6555 APPLICATION AND PERMIT FOR A 1 DAY TO 4 DAY TEMPORARY ON-SALE LIQUOR LICENSE Name of organization Date organized Tax exempt number Address City State Zip Code Name of person making application Business phone Home phone Date(s) of event Club Charitable Religious Other non-profit Type of organization Organization officer's name City State Zip Code Organization officer's name City State Zip Code Organization officer's name City State Zip Code Location where permit will be used. If an outdoor area, describe. If the applicant will contract for intoxicating liquor service give the name and address of the liquor license providing the service. If the applicant will carry liquor liability insurance please provide the carrier's name and amount of coverage. City or County approving the license Date Approved Fee Amount Permit Date Date Fee Paid Signature City Clerk or County Official APPROVAL APPLICATION MUST BE APPROVED BY CITY OR COUNTY BEFORE SUBMITTING TO ALCOHOL AND GAMBLING ENFORCEMENT City or County E-mail Address City or County Phone Number CLERKS NOTICE: Submit this form to Alcohol and Gambling Enforcement Division 30 days prior to event. ONE SUBMISSION PER EMAIL, APPLICATION ONLY. PLEASE PROVIDE A VALID E-MAIL ADDRESS FOR THE CITY/COUNTY AS ALL TEMPORARY PERMIT APPROVALS WILL BE SENT BACK VIA EMAIL. E-MAIL THE APPLICATION SIGNED BY CITY/COUNTY TO AGE.TEMPORARYAPPLICATION@STATE.MN.US Microdistillery Small Brewer Please Print Name of City Clerk or County Official 207 Chanhassen 4Chanhassen 4 of July Liquor License Map of July Liquor License MapththChanhassen 4 of July Liquor License Mapth City Center Park - Approved Liquor Areas l July 2, 3, 4, 2026City Center Park - Approved Liquor Areas l July 2, 3, 4, 2026City Center Park - Approved Liquor Areas l July 2, 3, 4, 2026 Beer sale locationBeer sale location (tentative)(tentative) Beer sale location (tentative) Beer sale locationBeer sale location (tentative)(tentative) Beer sale location (tentative) 208 City Council Item April 27, 2026 Item Approve 2026 Chanhassen Farmers' Market Agreement File No.Item No: D.12 Agenda Section CONSENT AGENDA Prepared By Priya Wall, Recreation Manager Reviewed By Jerry Ruegemer SUGGESTED ACTION "The Chanhassen City Council approves the 2026 agreement with the Chanhassen Farmers' Market to coordinate a farmers' market every Saturday from 9 a.m. to 1 p.m. at City Center Park from June 6 through September 26, 2026." Motion Type Simple Majority Vote of members present Strategic Priority N/A SUMMARY The Chanhassen Farmers' Market runs at City Center Park on Saturdays, June through September, from 9 a.m. to 1 p.m. It is a popular Saturday morning destination for residents to shop for fresh produce, flowers, handmade goods, fresh treats, and other items. BACKGROUND The Chanhassen Farmers' Market has been coordinated and managed by community volunteers since 2004. The City of Chanhassen Park & Recreation department temporarily coordinated the market during the 2020 and 2021 seasons during the transition between community volunteers due to the COVID-19 pandemic. Since 2022, the Farmers' Market has been coordinated and managed by Chanhassen community volunteer Holly Bustle. From 2004 - 2023, prior to the beginning of Civic Campus construction, the Farmers' Market was held 209 in the parking lot on the southeast side of the old City Hall building near the Council Chambers and Senior Center entrance. During the 2024 and 2025 seasons, the Farmers' Market was held on the athletic fields north of the old City Hall building and construction fencing. DISCUSSION Chanhassen community volunteer Holly Bustle will return for the 2026 season to manage the Chanhassen Farmers' Market. The annual agreement between the City of Chanhassen and the Chanhassen Farmers' Market has been updated and is attached, along with the 2026 market map. The Chanhassen Farmers' Market and individual vendors complete liability waivers at the beginning of each market season. Due to ongoing Civic Campus construction, the location of the Farmers' Market within City Center Park will be the same as in 2025. Vendors will set up on ballfield #1, just north of the west City Center parking lot, trail, and construction fence area. Depending on the completion dates of final Civic Campus construction items, landscaping finishes, establishment of grassy areas, and market logistics, the market may be moved to the new Civic Campus space near the end of their season. There will be no Farmers' Market on Saturday, July 4, due to the City of Chanhassen's annual 4th of July Celebration. Youth athletic groups utilizing the soccer fields at City Center Park will be unaffected and will retain access to all three fields. Parents & guardians of players utilizing soccer fields will be directed to park along Kerber Boulevard or Chanhassen Elementary School, and Farmers' Market vendors, visitors, and Chanhassen Library patrons will park in west City Center lot (north of the library) or east City Center lots (north of the new City Hall building). Youth athletic groups that would traditionally utilize ballfield #1 at City Center Park have been permitted at other locations throughout the park system. BUDGET RECOMMENDATION Staff recommends the City Council approve the 2026 agreement with the Chanhassen Farmers' Market to coordinate a farmers' market every Saturday from 9 a.m. to 1 p.m. at City Center Park from June 6 through September 26, 2026. ATTACHMENTS 2026 Farmers' Market Agreement 2026 Farmers' Market Map 2026 Farmers' Market Waiver 2026 Farmers' Market Individual Vendor Waiver 210 1 225949v1 USE AGREEMENT THIS USE AGREEMENT (“Agreement”) is made the 28th day of April, 2026, (the “Effective Date”) by and between the CITY OF CHANHASSEN, a Municipal Corporation, located at 7700 Market Boulevard, Chanhassen, Minnesota 55317 (“City”), and the CHANHASSEN FARMERS MARKET, a Minnesota non- profit corporation, located at PO Box 103 Chanhassen, MN 55317 (“Market”). WHEREAS, the Market is an association of individuals who produce fruits, vegetables, and other grown products and hand-crafted items, which are sold to the general public at open-air markets; WHEREAS, both parties desire that the Market operates a Farmers’ Market in the City, in order to provide an opportunity to sell the Market’s products and afford the City and its residents opportunities for civic engagement and commerce. NOW, THEREFORE, in consideration of the mutual benefits received by both parties, it is agreed: 1. The City will grant the Market exclusive use of Ballfield #1 at City Center Park, as shown on the attached Exhibit A (“Use Area”) to operate a Saturday Farmers Market (“Farmers Market”) (i.e., erect stands and sell products to the general public), as permitted herein. 2. The Farmers Market shall be subject to the following: a. For each day of operation of the Farmers Market, the Market will provide cones and blockades for the purpose of demarcating the Use Area. The Market shall place them where needed and remove them at the end of each sale day. b. The Market shall ensure any and all individual vendors operating at the Farmers Market to meet all state licensing and other requirements and regulations that are applicable to them. c. The Market shall ensure any and all Food Trucks operating at the Farmers Market will meet all state licensing and other requirements and regulations that are applicable to them. 3. The right to utilize the Use Area for the Farmers Market shall commence on June 6, 2026, and shall terminate on September 26, 2026. No Farmers Market shall take place on July 4, 2026. 4. The operation of a Farmers Market in the Use Area is also subject to the following conditions: a. The operation of a Farmers Market is limited to Saturdays between the hours of 9:00 a.m. and 1:00 p.m. The operation of community yoga, as part of the Farmers Market, will be 211 2 225949v1 limited to 8:15-9:00 a.m. A setup period of 7:00 a.m. to 9:00 a.m. and a teardown period of 1:00 p.m. to 2:00 p.m. will be permitted for individual vendors. b. The Market individual vendors shall furnish appropriate refuse containers, as required by the City, and remove refuse and other waste material after each Farmers Market. c. The Market shall utilize portable restrooms already on-site in City Center Park. d. The Market shall provide a market manager (“Manager”) to represent the Market on the site during each Farmers Market. The Manager or the Manager’s designee shall be responsible for all advertising, administrative activities, promotions, and communications with the City and the general public concerning sale activities at the Farmers Market. e. The Market shall be responsible to ensure that its operation of a Farmers Market is in compliance with, at all times, local, state and federal rules and regulations. f. The Market shall allow the City and the Chanhassen Library to, at various times, display and/or sell various items pertinent to their operations, without cost to the City or Chanhassen Library. g. The Market shall submit an annual report to the City by December 31, 2026. The report shall include number of markets held, estimated weekly attendance, number of total vendors, number of food, craft, and nonprofit vendors, partnerships, and highlights from the 2026 season. 5. The Market may not sub-lease or otherwise assign this Agreement. This Agreement shall not be deemed an approval for any other permits of approvals required by the City and/or any other governmental entity for the operation of the Farmers Market. 6. The Market shall indemnify, defend, and hold the City, and its respective officers, employees, and agents, harmless from and against any and all losses, claims, actions, and expenses that may arise from or out of the activities conducted or carried on by the Market directly or indirectly in any respect whatsoever related to the Market’s operation of a Farmers Market within the Use Area. 7. The Market will sign a waiver, waiving any claims the Market might have against the City, as well as defend and indemnify the City for any claims that arise against the City from third parties. 8. Individual vendors of the Market will sign a waiver, waiving any claims the vendor might have against the city, as well as defend and indemnify the City for any claims that arise against the City from third parties, OR provide a certificate of insurance, naming the City as additional insured. 212 3 225949v1 9. The City may terminate this Agreement at any time with or without cause by giving 30 days written notice to the Market at the address indicated above. Sections 5 and 6 of this Agreement shall survive termination. 10. The City retains the right to close any individual vendor of the Farmers Market for any reason with one week’s notice. 11. This Agreement shall be governed by, construed, and enforced in accordance with the laws of the State of Minnesota. 12. This Agreement shall constitute the entire agreement between the parties and any prior understanding or representation of any kind preceding the date of this Agreement shall not be binding upon either party except to the extent incorporated in this Agreement. 13. Any modification of this Agreement or additional obligations assumed by either party in connection with this Agreement shall be binding only if evidenced in writing signed by each party or an authorized representative of each party. 14. Any notice provided for or concerning this Agreement shall be in writing and shall be deemed sufficiently given when sent by U.S. Mail or hand-delivered to the respective address of each party as set forth in the beginning of this Agreement. 15. The parties acknowledge that this Agreement is an agreement to operate a Farmers Market in the Use Area described herein and does not confer any estate or interest to the Market in the City’s property, nor does it create a partnership or joint venture between the City and the Market. All costs of doing business, including but not limited to supplies and equipment, will be the sole responsibility of the Market at its sole expense. IN WITNESS WHEREOF, the parties have signed this Agreement. CITY OF CHANHASSEN CHANHASSEN FARMERS MARKET By:________________________________ By:______________________________ Elise Ryan, Mayor Print Name:____________________ And:________________________________ Its: President Laurie Hokkanen, City Manager 213 Soccer parking: Chanhassen Elementary Restrooms Soccer field Civic Campus Construction Soccer parking: Kerber Blvd. Farmers’ Market + Library parking Soccer field Soccer field Farmers’ Market 2026 Saturdays, June 6 -September 26 9:00 a.m. - 1:00 p.m. Approved MarketApproved Market AreaArea Approved Market Area 214 1 221841v1 WAIVER AND RELEASE I, ______________________, as an authorized representative of the named organization below, located at PO Box 103 Chanhassen, Minnesota 55317 (“Organization”), and on behalf of the Organization, its officers, employees, agents and assigns, as a condition of the Organization being permitted to locate and operate a seasonal market (“Market”) on City of Chanhassen (“City”) property located at 7700 Market Boulevard, Chanhassen, MN 55317 (“City Property”), do hereby agree to the following: A. The Organization hereby waives, releases, and discharges the City, its officials and employees, from any and all claims and liabilities for bodily injury, personal injury, or property loss or damage arising out the Organization’s use of City property or operation of the Market on City Property. B. The Organization further agrees to indemnify, defend and save harmless the City, its officials and employees, from and against any liability, claim or demand, including but not limited to court costs and attorney fees for or on account of bodily injury, personal injury or property loss or damage asserted or claimed against the City arising out of the Organization’s use of City Property or operation of the Market on City Property. C. Specifically excluded from this release and indemnification shall be any claims, liabilities, losses or damages arising out of the gross negligence or intentional acts of the City, its officials and employees. D. By execution of this Waiver and Release, the Organization further agrees and represents that it has inspected the City Property and that it accepts the same as safe and reasonably suited for the purposes of the Organization’s use thereof. The Organization further agrees to return the City Property to the City in the same condition in which it was provided, save for ordinary wear and tear which may occur. The Organization further agrees to report to the City any damage to the City Property during the Organization’s use of the City Property or the operation of the Market on City Property. E. This Waiver and Release shall be binding upon the Organization, and the Organizations, successors and assigns. 215 2 221841v1 IN WITNESS THEREOF, THIS WAIVER AND RELEASE AGREEMENT is executed by the Organization, acting by and through the undersigned, who represents that he or she is properly authorized to bind the Organization hereto. Organization: CHANHASSEN FARMERS MARKET Dated: ________________. ________________________________ Signature of Undersigned ________________________________ Print Name of Undersigned ________________________________ Title 216 221843v1 WAIVER AND RELEASE I, ______________________, as a condition of the being permitted to locate and operate as a vendor in connection with the Chanhassen Farmers Market (“Vending Operations”) on City of Chanhassen (“City”) property located at 7700 Market Boulevard, Chanhassen, MN 55317 (“City Property”), do hereby agree to the following: A. I hereby waive, release, and discharge the City, its officials and employees, from any and all claims and liabilities for bodily injury, personal injury, or property loss or damage arising out my use of City property or my Vending Operations on City Property. B. I further agree to indemnify, defend and save harmless the City, its officials and employees, from and against any liability, claim or demand, including but not limited to court costs and attorney fees for or on account of bodily injury, personal injury or property loss or damage asserted or claimed against the City arising out of the my use of City Property or my Vending Operations on City Property. C. Specifically excluded from this release and indemnification shall be any claims, liabilities, losses or damages arising out of the gross negligence or intentional acts of the City, its officials and employees. D. By execution of this Waiver and Release, I further agree and represent that I have inspected the City Property and that I accept the same as safe and reasonably suited for the purposes of the my use thereof. I further agree to return the City Property to the City in the same condition in which it was provided, save for ordinary wear and tear which may occur. I further agree to report to the City any damage to the City Property during my use of the City Property or my Vending Operations on City Property. E. This Waiver and Release shall be binding upon me, and my heirs, successors and assigns. F. My address is:__________________________________________. . Dated: ________________. ________________________________ Signature of Undersigned ________________________________ Print Name of Undersigned 217 City Council Item April 27, 2026 Item Award Chanhassen Community Center Bid Package #1a: Steel Supply & Install File No.Item No: D.13 Agenda Section CONSENT AGENDA Prepared By Laurie Hokkanen, City Manager Reviewed By SUGGESTED ACTION "The Chanhassen City Council moves to award Bid Package #1a for the Chanhassen Community Center to RJM Construction, in the amount of $6,272,580 for Linco Fabricating, as part of the Construction Manager at Risk (CMAR) delivery method, and authorize the City Manager to execute the necessary documents. This award does not establish the Guaranteed Maximum Price (GMP), which will be brought forward for City Council approval at a later date." Motion Type Simple Majority Vote of members present Strategic Priority Development & Redevelopment SUMMARY BACKGROUND The City Council awarded Bid Package #1 for the Chanhassen Community Center on April 13, 2206. At that time, staff noted that the City Council will also consider awarding the bid package for structural steel, likely at the May 11, 2026, meeting. Bids were received and are ready for award earlier than anticipated. Due to long lead times and competition with other large projects, RJM Construction recommends proceeding with the award at this time. Bid Package #2 is expected to be considered on June 8, 2026. 218 The project page is available at: https://www.chanhassenmn.gov/government/projects/chanhassen- community-center DISCUSSION After BP #1, the city had awarded 20% of the construction budget and was 8% under budget. W ith steel now included in BP #1, we have awarded 28% of the construction dollar amount and are currently 2% under budget on that 28%. Between Q4 2025 – Q1 2026 the steel market has experienced a 10% material increase, and continues to steadily increase. The project did not experience this increase at that level, which is why RJM Construction is recommending award of the steel package at this time. BUDGET The overall project budget remains approximately $80M. The work to be awarded is: Linco Fabricating: $6,272,580 RECOMMENDATION Staff recommends award. ATTACHMENTS Chanhassen Community Center - Steel Supply & Install - 4.23.2026 219 Laurie Hokkanen City Manager City Of Chanhassen Re:Chanhassen Community Center - Steel Funish & Install Dear Laurie Hokkanen, Total Construction Estimate:$6,272,580 ALTERNATES: WILL BE FINALIZED WITH BID PACK 2 CLARIFICATIONS: No. 1: No. 2: No. 3: No. 4: Sincerely, Brad Barickman Vice President - Community Our estimate does not include any SAC and WAC fees. Thank you for the opportunity to provide this estimate. Our team is experienced and competent in your market; this applied knowledge will assist the team in obtaining the best possible project value. Please feel free to contact RJM if you have any questions or need additional information. April 23, 2026 RJM Construction is pleased to present an estimate for the Chanhassen Community Center project located in Chanhassen, MN. Together with the City of Chanhassen and BKV Group, we can work as a team to deliver the project goals of cost, schedule and quality. Our estimate is based upon drawings dated 2/27/2026 and two addendums. This estimate assumes that all work will be done during regular business hours. We do not include removing, storing or re-installing any systems furniture. Architectural and engineering fees are not included. 220 ESTIMATE SUMMARY ESTIMATE DATE: PROJECT: ARCHITECT: DRAWING DATE: Final $/sf DESCRIPTION Sub Contractors Estimate 183,850 Construction Costs 5A - Structural Steel/Joist/Decking/Misc. Steel - Material & Labor Linco Fabricating $6,272,580 $34.12 Total Construction Estimate $6,272,580 $34.12 April 23, 2026 Chanhassen Community Center - Steel Funish & Install BKV Group February 27, 2026 2 221 Chanhassen Community Center – Steel Furnish & Install Project: Chanhassen Community Center Hwy 212 & Powers Blvd Chanhassen, MN 55317 Owner: City of Chanhassen 7700 Market Blvd PO Box 147 Chanhassen, MN 55317 Architect: BKV Group 222 North Second Street Long & Kees Bldg, Suite 101 Minneapolis, MN 55401 Construction Manager: RJM Construction 830 Boone Avenue North Golden Valley, MN 55427 RJM has successfully worked with Linco Fabricating on multiple projects. We recommend this vendor for award for the Chanhassen Community Center project. RJM is requesting to enter into contract with Linco Fabricating for steel supply & erection. 222 City Council Item April 27, 2026 Item Resolution 2026-XX: Approve Construction Materials Testing Agreement for the 2026 City Pavement Rehabilitation Project No. 26-01 File No.ENG Project No. 26-01 CIP No. ST-012 Item No: D.14 Agenda Section CONSENT AGENDA Prepared By Ben Phillips, Engineering Technician III Reviewed By George Bender SUGGESTED ACTION "The Chanhassen City Council adopts a resolution awarding a consulting agreement for construction materials testing to Braun Intertec for the 2026 City Pavement Rehabilitation Project No. 26-01." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY The 2026 City Pavement Rehabilitation Project (City Project No. 26-01) is entering the construction phase with the contractor indicating construction beginning early-to-mid May 2026. Construction Materials Testing (CMT) is a required component of the Quality Control/Quality Assurance (QC/QA) process for roadway construction projects of this type. The Engineering Department solicited proposals from two qualified testing firms - Braun Intertec Corp. and American Engineering Testing, Inc. (AET) - consistent with the city's established practice on prior pavement rehabilitation projects. BACKGROUND 223 As part of the overall Pavement Management Program (PMP), the city annually plans to rehabilitate a section or sections of public streets across the city. The Five-Year Capital Improvement Plan (CIP) identifies the near-term streets to be rehabilitated. This 2026 project includes approximately 2.2 miles of city streets for rehabilitation. Key dates and items relative to this project: On June 13, 2025, the Engineering Department released a Request for Proposals (RFP) for design and construction services for the 26-01 project. On June 20, 2025, the Engineering Department released a Request for Proposals (RFP) for geotechnical services for the 26-01 project. On July 14, 2025, the City Council approved a Professional Services Agreement with Houston Engineering, Inc. for design and construction services for the 26-01 project. On July 14, 2025, the City Council approved a Professional Services Agreement with Braun Intertec for geotechnical exploration and engineering services in association with the 26-01 design contract. On November 10, 2025, the City Council called for a Public Hearing to be held regarding the proposed improvements on November 24, 2025. On November 19, 2025, the Engineering Department and Houston Engineering hosted a public Open House meeting at City Hall to discuss the project and respond to questions with the impacted properties. Riley Purgatory Bluff Creek Watershed District staff also attended this meeting and presented on the proposed project within North Lotus Lake Park. Approximately 73 residents attended and 20 comment cards were received. On November 24, 2025, the City Council accepted the feasibility study, conducted a Public Hearing related to the proposed improvements, and authorized the preparation of plans and specifications for the 26-01 project. On February 17, 2025, the Engineering Department and Houston Engineering hosted a pop-up meeting for the property owners in the Fox Hollow neighborhood to specifically discuss the proposed alignment of the portion of Fox Hollow Dr between Pleasantview Rd and the cul-de-sac near the tennis courts. Approximately 43 residents attended and 6 comment cards were received. On March 9, 2026, the City Council accepted the plans and specifications and authorized the advertisement for bids for the 26-01 project. On March 31, 2026, Houston Engineering and the Engineering Department hosted a bid opening. On April 7, 2026, the Engineering Department distributed Request for Quotations (RFQs) for construction material testing (CMT) professional services for the 26-02 project. On April 13, 2026, the City Council called for a Public Hearing related to the assessments for the 26-01 project. 224 On April 14, 2026, the Engineering Department hosted a second public open house for the project in the training room at City Hall. On April 17, 2026, the Engineering Department received two proposals in response to the RFQ for construction material testing. DISCUSSION The Engineering Department solicited proposals from American Engineering Testing, Inc. and Braun Intertec Corporation for the construction materials testing and associated professional engineering services required to facilitate the construction of the project. Both firms submitted competitive proposals. The proposals were reviewed to compare the proposed work scopes, testing rates, and estimated costs. This effort included review of the level of effort and clarity of each firm's proposal in meeting the specifications of the project. As necessary, quantity and/or testing rate amounts in the proposals were adjusted to facilitate a fair comparison between the proposals. The proposals were analyzed and the results are as follows: Braun Intertec - $87,847.00 American Engineering Testing - $98,030.00 Both firms have the required certified personnel and are capable of completing the required work. Both firms have successfully completed work for the city on past projects. Staff recommends Braun Intertec be selected for this work. Braun Intertec's proposal is on a unit-cost basis and billed per personnel hours and/or testing rates provided in their proposal. Staff recommends an agreement amount of $93,000.00 be awarded to allow for minor adjustments to the testing quantities without the need for processing a contract modification. Braun will submit monthly invoices that staff will review before processing. Staff will review the invoices for accuracy and conformance with the contract. BUDGET Funding for the 2026 City Pavement Rehabilitation Project No. 26-01 will be through the budgetary amount established for this project from the PMP fund. RECOMMENDATION Staff recommends the City Council adopt a resolution to approve entering into the contract with Braun Intertec in the amount of $93,000.00 for construction material testing professional services which includes a small contingency for additional services that routinely arise during construction. ATTACHMENTS Resolution 2026-XX Award Construction Materials Testing Contract_26-01 City of Chanhassen Braun Agreement 26-01 Braun Proposal - 2026 City Pavement Rehabilitation AET 26-01 Construction Materials Testing Proposal 225 26-01 CMT RFP CIP Project Budget ST-012-2026 226 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 27, 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION AWARDING A CONSULTANT AGREEMENT FOR CONSTRUCTION MATERIALS TESTING ON THE 2026 CITY PAVEMENT REHABILITATION PROJECT NO. 26-01 WHEREAS, pursuant to a request for proposals for construction material testing for the 2026 City Pavement Rehabilitation Project No. 26-01, two proposals were received and evaluated that complied with the request for proposal: Bidder Quote Amount Braun Intertec $87,847.00 American Engineering and Testing $98,030.00 WHEREAS, it was evaluated by staff that Braun Intertec had the lowest responsible quote and best met the scope of the request for proposals. A consultant contract amount of $93,000.00 is recommended to be awarded to allow for minor revisions to unit price testing quantities during construction to facilitate not needing to approve a contract revision. NOW, THEREFORE, BE IT RESOLVED by the Chanhassen City Council that the Mayor and City Manager are hereby authorized and directed to enter into a consulting agreement with Braun Intertec in the name of the City of Chanhassen for the construction materials testing professional services for the 2026 City Pavement Rehabilitation Project No. 26-01 according to the proposal and the plans and specifications on file in the office of the City Engineer. PASSED AND ADOPTED by the Chanhassen City Council on this 27th day of April 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 227 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this 27th day of April, 2026, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and BRAUN INTERTEC CORPORATION ("Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for construction materials testing and associated engineering services. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for quote – Construction Materials Testing Services for #26-01, Distributed April 7th, 2026; C. Insurance Certificate; D. Consultant’s April 20th, 2026, proposal for $87,847.00 (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of Ninety-three Thousand Dollars ($93,000.00), inclusive of expenses. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. Notwithstanding the foregoing, the information is not intended or represented to be suitable for reuse by the City or others on extensions or modifications of the services or on any other project. Any such reuse without written verification or adaptation by Consultant for the specific purpose intended will be at the City’s sole 228 2 201749v1 risk, and the City agrees to hold Consultant harmless for all costs and liability arising out of such unauthorized use. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances, at the same time and in the same locality. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, to the extent caused by the negligent execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each claim/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. ALLOCATION OF LIABILITY. Notwithstanding anything to the contrary, in no event will Consultant be liable for any consequential, indirect, incidental, special, exemplary, punitive, or enhanced damages, and in no event will Consultant’s aggregate liability arising out of this Agreement, or the services performed exceed the amount of the applicable insurance limits set forth in the Agreement. 229 3 201749v1 11. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 12. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 13. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 14. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 15. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 230 4 201749v1 16. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 17. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 18. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 19. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 20. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 21. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including payment for services performed or furnished to the date and time of termination. Dated: CITY OF CHANHASSEN BY: Elise Ryan, Mayor BY: Laurie Hokkanen, City Manager 231 5 201749v1 Dated: BRAUN INTERTEC CORPORATION BY: Its 232 April 20, 2026 Proposal 10010912_001 Ben Phillips City of Chanhassen 7700 Market Blvd Chanhassen, MN 55317 Re: Proposal for Construction Materials Testing Services 2026 City Pavement Rehabilitation City Project No. 26-01 Chanhassen, Minnesota Dear Mr. Phillips: Braun Intertec Corporation (Braun Intertec) submits this proposal to provide construction materials testing services for the 2026 City Pavement Rehabilitation Project in Chanhassen, Minnesota. Our Understanding of Project This project will include primarily full depth reclamation with selective full reconstruction and mill and overlay. Select removals and replacements of existing curb and gutters, driveway aprons, ped ramps, and sidewalk. Small incidental replacements of utility structures may be part of this project as needed. Two main neighborhoods are part of this project Fox Hollow and Vasserman Ridge. Roads involved in the project are Pleasant Park Drive, Gray Fox Lane, Bluff Ridge Court, Hunters Court, Fox Drive, Fox Hollow Drive, Gray Fox Curve, Foxtail Court, Quail Crossing, Gray Fox Curve, Ridgeview Point, Ridgeview Way, Vasserman Trail, and Vasserman Place. Available Project Information This proposal was prepared using the following documents and information. ▪ Project “not for construction” plans prepared by Houston Engineering, Inc., dated March 3, 2026. ▪ City of Chanhassen Standard Specifications and Detail Plates prepared by the City of Chanhassen, dated January 22, 2026. ▪ Request for Proposals provided by the City of Chanhassen, dated February 9, 2026, and provided to Braun Intertec via email on April 7, 2026. ▪ Conversations with Ben Phillips (City of Chanhassen) confirming requested testing quantities regarding bituminous testing trips and bituminous testing hours charges. 233 City of Chanhassen 2026 City Pavement Rehabilitation Proposal 10010912_001 April 20, 2026 Braun Intertec Page 2 Braun Intertec Project Team For this project we propose using Tom Loosbrock as a lead senior technician and Jacob Collins as our project manager. Tom and Jacob will be supported by Director, Andrew Valerius, and principal engineer, Charles Cadenhead. The project team has provided services on many City of Chanhassen projects in the past including: Crimson Bay Street Improvements, Galpin Boulevard, 2024 Street Reconstruction, 2023 Mill and Overlay Project, Orchard Lane Area Improvements, Minnewashta Manor Neighborhood Street Reconstruction, and the 2023, 2022, 2017, and 2016 Street Resurfacing and Rehabilitation Projects and state-aid projects Lake Lucy Road Rehabilitation, Lake Drive Improvements, and Minnewashta Parkway Rehabilitation. Tom Loosbrock is a senior engineering assistant with more than 20 years of experience in materials testing and is responsible for field operation coordinating, general project management; soil density testing using nuclear and sand cone methods; soil excavation observations; DCP testing, concrete testing and bituminous testing. Tom has worked on many state-aid projects throughout his career and is familiar with MnDOT specification, and the schedule of materials control. Jacob Collins is a project manager and will be the main point of contact for this project. Jacob has more than 18 years of experience with special inspections and testing. His extensive on-site testing and special inspection experience related to concrete, masonry, structural steel, fireproofing, soils as well as with MnDOT testing for transportation will help any project as project manager. Jacob also assists technicians on-site with training to help ensure the tests and observations are done properly in accordance with the project at hand. Andrew Valerius is a senior project manager with more than 20-years’ experience who is responsible for overseeing the quality control and day-to-day operations of engineering technicians involved in roadway and bridge projects, especially for state-aid and federally-funded projects. He has extensive experience working with the Minnesota Department of Transportation’s (MnDOT) Schedule of Materials Control and MnDOT’s Standard Specifications for Construction. Internally, he help leads the Braun Intertec transportation group for the State of Minnesota. Andrew also helps organize and presents at many educational sessions that focus on MnDOT’s specifications and procedures. Andrew’s past experience providing field services, such as soil density testing, concrete testing, bituminous and concrete batch plant observations, and testing services has allowed him to gain the necessary knowledge of field testing practices and practical site experience to perform his senior project manager role at a high level and deliver quality results safely. Charles Cadenhead has more than 30 years of experience in the transportation industry and more than 25 years of experience in delivering construction projects for owners (MnDOT and Anoka County) and other clients. With every project, from design-bid-build to design-build Charles has been one of the primary individuals entrusted with quality oversight from all aspects. While working for MnDOT his primary focus was on the construction side of projects, however with his experience at Anoka County and as a consultant he has been involved in both design and construction quality management. At Anoka County he was involved as early as the right-of-way process and used his expertise in construction to help manage risks associated with the design of projects. Projects have been various in size from simple span bridges and mill and overlays to large design-build projects with over $200 million in construction. Charles brings years of contract administration and change management experience to bear in order to arrive at a successfully completed project. 234 City of Chanhassen 2026 City Pavement Rehabilitation Proposal 10010912_001 April 20, 2026 Braun Intertec Page 3 Resumes for Tom Loosbrock, Jacob Collins, Andrew Valerius, and Charles Cadenhead are attached to highlight their expertise and experience with projects similar to this one. Scope of Services Services are performed under the direction of a licensed professional engineer. Observation and testing services will be performed on an on-call, as-needed basis as requested and scheduled by you or your on-site project representative. After reviewing available information to determine compliance with project plans and/or specifications and other design or construction documents, our scope of services for the project will be limited to the tasks defined below. Soil Related Services ▪ Measure the in-place dry density, moisture content and relative compaction of fill placed for pavement and/or utility support, and of utility backfill for compliance with the project documents. This task includes performing laboratory Proctor tests to provide maximum dry densities from which the relative compaction of fill can be determined, as well as the use of a nuclear density gauge to measure in-place dry densities and moisture contents. ▪ Sample and test aggregate base, select granular, and reclamation materials for compliance with the project documents. This task includes laboratory gradation testing of aggregate base material. ▪ Perform MnDOT dynamic cone penetrometer (DCP) tests on aggregate base material. ▪ Perform Full Depth Reclaim Dynamic Cone Penetrometer (DCP) tests on full depth reclaim (FDR) materials. Concrete Related Services ▪ Sample and test fresh concrete associated with pavement and/or curb -and-gutter for compliance with the project documents and cast test cylinders for laboratory compressive strength testing. We assume that we will be able to appropriately dispose of excess concrete (and associated wash water) on site at no additional cost to us. ▪ Measure and report the compressive strength of the concrete test cylinders for compliance with the project documents. A set of four cylinders will be cast, with one tested at 7 days and three at 28 days for each set cast. Per the request for proposal we have included 10 field cure cylinders, if additional field cure cylinders are requested, each additional cylinder will be charged at the unit price listed in our cost estimate. Bituminous Related Services ▪ Sample and test bituminous pavement materials for compliance with the project documents. This task includes Rice specific gravity, Gyratory density, fine aggregate angularity, percent crushed, asphalt content and extracted aggregate gradation tests of the bituminous. ▪ Measure the in-place wet density of the fresh bituminous with a nuclear density gauge to observe and document the contractor’s roll pattern (ordinary compaction). 235 City of Chanhassen 2026 City Pavement Rehabilitation Proposal 10010912_001 April 20, 2026 Braun Intertec Page 4 Consulting, Project Communication and Reporting Services ▪ Project management, including scheduling of our field personnel. ▪ Review test reports and communicating with you and the parties you may designate such as the project contractor(s), and other project team members, as needed. ▪ Transmit test results to the project team on a weekly basis. Basis of Scope of Work The costs associated with the proposed scope of services were estimated using the following assumptions. If the construction schedule is modified or the contractor completes the various phases of the project at different frequencies or durations than shown in this proposal, we may need to adjust the overall cost accordingly. The scope of work and number of trips required to perform these services are as shown in the attached table. Notable assumptions in developing our estimate include: ▪ We were provided estimated quantities of tests, hours, and quantities to use for the purposes of this estimate. These numbers were provided within the Request for Proposal. ▪ We understand it will take 60 trips to complete the nuclear density gauge, dynamic cone penetration, and soil sampling on this project. ▪ We understand that 50 sets of concrete tests will be required to complete the project. We understand that 10 additional field-cured cylinders may be requested for the project. ▪ We understand that bituminous paving requiring sampling and testing will be completed in 15 days for this project. ▪ We assume your full-time on-site construction observer will observe the test rolling for this project if required. ▪ We assume the project engineer of record will review and approve contractor’s quality control submittals and test results. ▪ You, or others you may designate, will provide us with current and approved plans and specifications for the project. Modification to these plans must also be sent to us so we can review their incorporation into the work. ▪ We will require a minimum of 24 hours’ notice for scheduling inspections for a specific time. Shorter than 24 hours’ notice may impact our ability to perform the requested services, and the associated impacts will be the responsibility of others. If the work is completed at different rates than described above, this proposal should be revised. If the pace of construction is different than described above, this proposal should be revised. 236 City of Chanhassen 2026 City Pavement Rehabilitation Proposal 10010912_001 April 20, 2026 Braun Intertec Page 5 Cost and Invoicing We will furnish the services described herein for an estimated fee of $87,847. Our estimated costs are based on industry averages for construction production. Depending on the contractor’s performance, our costs may be significantly reduced or slightly higher than estimated. A tabulation showing our estimated hourly and/or unit rates associated with our proposed scope of services is also attached. The actual cost of our services will be based on the actual units or hours expended to meet the requirements of the project documents. This cost estimate was developed with the understanding that the scope of services defined herein will be required and requested during our normal work hours of 6:00 a.m. to 4:00 p.m., Monday through Friday. Services that we are asked to provide to meet the project requirements or the contractor’s construction schedule outside our normal business hours will be invoiced using an overtime rate factor. The factor for services provided outside our normal work hours or on Saturday will be 1.25 times the listed hourly rate for the service provided. The factor for services provided on Sunday or legal holidays will be 1.5 times the listed hourly rate for the service provided. We have not included premiums for overtime in our cost estimate; however, we recommend that allowances and contingencies be made for overtime charges based on conversations with the contractor. You will be billed only for services provided on a time and materials basis. Because our services are directly controlled by the schedule and performance of others, the actual cost may vary from our estimate. It is difficult to project all of the services and the quantity of services that may be required for any project. If services are required that are not discussed above, we will provide them at the rates shown in the attached table or, if not shown, at our current Schedule of Charges. We will invoice you on a monthly basis. 237 City of Chanhassen 2026 City Pavement Rehabilitation Proposal 10010912_001 April 20, 2026 Braun Intertec Page 6 General Remarks We will be happy to meet with you to discuss our scope of services further and clarify the various scope components. We appreciate the opportunity to present this proposal to you. After review this proposal, if selected, we will attach our estimate to the city provided terms and conditions after legal review within Braun Intertec and the City of Chanhassen. Braun Intertec will not release any written reports until we have received a signed agreement. We appreciate the opportunity to present this proposal to you. We will be happy to meet with you to discuss our proposed scope of services further and clarify the various scope components. Braun Intertec will not release any written reports until we have received a signed agreement. Ordering services from Braun Intertec constitutes acceptance of the terms of this proposal. To have questions answered or schedule a time to meet and discuss our approach to this project further, please contact Jacob Collins at 612.418.8570 or (JaCollins@braunintertec.com). Sincerely, Braun Intertec Corporation Jacob D. Collins Project Manager Andrew M. Valerius Director, Senior Project Manager Charles M. Cadenhead, Jr., PE Vice President, Principal Engineer Attachments: Cost Estimate Table City of Chanhassen Provided – Quantity Item Price List Resumes –Thomas Loosbrock, Jacob Collins, Andrew Valerius, and Charles Cadenhead The proposal is accepted, and Braun Intertec is authorized to proceed. _____________________________________________ Authorizer’s Firm _____________________________________________ Authorizer’s Signature _____________________________________________ Authorizer’s Name (please print or type) _____________________________________________ Authorizer’s Title _____________________________________________ Date 238 1 Fee Estimate 10010912_001 Chanhassen - 26-01 City Pavement Rehabilitation Client: Work Site Address: City of Chanhassen Ben Phillips 7700 Market Blvd Chanhassen, MN 55317-8363 Various Locations Chanhassen, Minnesota 55317 Qty/Hours Rate Amount Task 1: Construction Materials Testing Subtask 1.1: Soil Testing $21,530.00 Soil Compaction Testing - Nuclear - Item 8 110.00 102.00 $11,220.00 Soil Compaction Testing - Non Nuclear – DCP Testing - Item 8 10.00 102.00 $1,020.00 Soil Sample pick-up - Item 8 10.00 102.00 $1,020.00 Nuclear moisture-density meter charge, per hour 110.00 32.00 $3,520.00 Compaction Testing on Soils (Item 1) 70 Ea @ 1 Qty 70.00 Compaction Testing on Granular Materials (Item 2) 40 Ea @ 1 Qty 40.00 Trip Charge - Item 7 60.00 50.00 $3,000.00 Geotechnical Evaluation Allowance - Item 14 1.00 1,750.00 $1,750.00 Subtask 1.2: Concrete Testing $18,080.00 Concrete Testing - Item 9B 125.00 102.00 $12,750.00 Concrete Cylinder Pick Up - Item 10B 40.00 102.00 $4,080.00 Trip Charge - Item 10A 25.00 50.00 $1,250.00 Subtask 1.3: Bituminous Testing $9,570.00 Asphalt Sample pick-up - Item 11B 25.00 102.00 $2,550.00 Compaction Testing - Nuclear – Roll Pattern - Item 12A 30.00 102.00 $3,060.00 Trip Charge 25.00 50.00 $1,250.00 Sample pick-up Trip Charge - Item 11C 15 Ea @ 1 Qty 15.00 Roll Pattern Trip Charge - Item 12B 10 Ea @ 1 Qty 10.00 Nuclear moisture-density meter charge, per hour - Item 12A 30.00 32.00 $960.00 Pavement Evaluation Allowance - Item 14 1.00 1,750.00 $1,750.00 Subtask 1.4: Laboratory Testing $25,255.00 Soil Proctor MD Relationship (Standard), each - Item 3 10.00 216.00 $2,160.00 Soil Topsoil Testing with Nutrients MnDOT 3877 2B each - Item 4 1.00 445.00 $445.00 Sieve Analysis with No. 200 wash, each - Item 5 10.00 168.00 $1,680.00 Concrete Compressive Strength Cylinders ASTM C39 each 210.00 42.00 $8,820.00 Concrete Cylinder Sets 50 Sets @ 4 Qty 200.00 Field-Cured Cylinders 10 Ea @ 1 Qty 10.00 MnDOT Asphalt Verification, each - Item 11A 15.00 810.00 $12,150.00 Subtask 1.5: Project Management $13,412.00 Project Manager - Item 15A 30.00 186.00 $5,580.00 Project Assistant - Item 15B 50.00 102.00 $5,100.00 Senior Project Manager - Item 13 4.00 218.00 $872.00 Project Manager - Item 13 10.00 186.00 $1,860.00 Task 1 Total: $87,847.00 Project Total $87,847.00 239 5 Gradation Sample and Testing EA $2,160 10A Concrete Testing and Cylinder Pickup Trip Charge 130 $102 7 Chanhassen - 2026 Street Reconstruction City Project 26-01 $445 11A MnDOT Gyratory Bituminous Mix Properties Verification Testing & Rice Testing EA 15 $810 $12,150 4 Topsoil Borrow Sample & Testing EA 1 $445.00 $4,080 10B Cylinder Pick Up Hours HR 40 $102 9B Concrete Testing Hours HR 125 $102 $12,750 9C Concrete Testing & Casting Field-Cured Cylinders (Compressive Strength, Curing, & Handling)EA 10 $42 $420 11B Bituminous Verification Sample Pickup and Testing Hours HR 25 $102 11C Bituminous Verification Sample Pickup Trip Charge EA 15 $50 $3,000 $168 10 Soils & Granular Materials Testing Trip Charge (ALL) EA 60 Roll Pattern Testing Hours HR 30 $134 EA $50 25 $50 $1,250 $0 $21.33 $2,240 ITEM NO. ITEM UNITS QUANTITY UNIT PRICE 3 Proctor Sample & Testing (including Moisture Content) EA 10 $216.00 50 $168 $8,400 9A Concrete Testing & Casting Cylinder Sets (Compressive Strength, Curing, & Handling)*EA $87,847 15A Project Management & Oversight HR 30 $5,580 $186 $3,500 Geotechnical and Pavement Evaluation Allowance Allowance 1 $3,500 $2,732 $2,732 *EA indicates a set of 4 cylinders TOTAL 1 Will be charged per cylinder. Price displayed to left is per set assuming 4 cylinders. $750 COMMENTS Charged per hour as "Nuclear moisture-density meter" Assumes 1.5 Ea per hour estimate (70 hours assumed) Charged per hour as "Nuclear moisture-density meter" Assumes 1.5 Ea per hour estimate (40 hours assumed) No additional charge per each DCP. Cost is only per hour of technician. TOTAL PRICE $2,550 Compaction Testing on Soils (Nuclear Density Test) EA 105 15B Project Administration HR 50 $102 $5,100 2 Compaction Testing on Granular Materials (Nuclear Density Test)EA 60 $21.33 $1,280 $13,260 8 Soils & Granular Materials Testing Hours (ALL) HR $1,680 6 DCP Tests for Aggregate Base (Class 5) EA 30 $0 $4,020 Price listed is combined lines of "nuclear moisture-density meter charge" and "Compaction Testing - Nuclear" both per hour 12B Roll Pattern Testing Trip Charge Half listed with "Soils Testing" for Geotechnical Evaluation and half listed with "Pavement Testing" for Pavement Evaluation $500 13 EA 10 $50 14 Evaluation, Reporting, & Analysis Documentation LS 1 12A Charges include Final Report (ea), Project Manager (hour), Senior Project Manager (hour), and Principal Engineer (hour) 240 Thomas R. Loosbrock Field Operations Coordinator, Senior Field Technician Mr. Loosbrock is a field operations coordinator responsible for field scheduling; general project management; soil excavation observations; soil density testing; reinforced concrete observations & testing; reinforced masonry observations & testing and pre-stressed concrete inspections. Tom is familiar with MnDOT specifications, MnDOT schedule of materials control, and has been the lead technician on many state-aid and federal projects throughout his career. Tom was responsible for managing, performing field observations, and testing on the following projects and has more than 20 years of experience: Project Experience ▪ Galpin Boulevard Improvements SAP 194-115-004, Chanhassen, MN (Spring 2024 to Fall 2025) ▪ Chanhassen 2025 Pavement Rehabilitation 25-01, Chanhassen, MN (Summer 2025) ▪ 2024 City of Chanhassen City Pavement Rehabilitation 24-01, Chanhassen, MN (Summer 2024 to Summer 2025) ▪ 2023 City of Chanhassen Mill & Overlay Projects, Chanhassen, MN (Summer 2023 to Fall 2023) ▪ 2023 City of Chanhassen Pavement Rehabilitation Project Chanhassen, MN (Summer 2023 ▪ 2023 City of Chaska Street Reconstruction, Chaska, MN (Summer 2023 ▪ 2022 Lake Lucy Road Rehab Project, Chanhassen, MN (Summer 2022) ▪ 2022 City of Chanhassen Reconstruction, Chanhassen, MN (Summer 2022) ▪ 2022 City of Chaska Street Reconstruction, Chaska, MN (Summer 2022) ▪ 2021 City of Chanhassen Street Reconstruction, Chanhassen, MN (Summer 2021) ▪ 2021 City of Chaska Street Reconstruction, Chaska, MN (Summer 2021) ▪ 2020 City of Chaska Street Reconstruction, Chaska, MN (Summer 2020) ▪ 2019 City of Chaska Street Reconstruction, Chaska, MN (Summer 2019) ▪ City of Chanhassen Lake Drive Improvements, Chanhassen, MN (Summer 2019) ▪ 2018 City of Chaska Street Reconstruction (Summer 2018) ▪ CSAH 83, Shakopee, MN (Summer 2016 to Fall 2017) ▪ TH 5 Reconstruction, Waconia, MN (Summer 2015 to Spring 2016) ▪ Vicksburg Lane Reconstruction, Plymouth, MN (Summer 2015 to Fall 20 Experience Industry: 20 years Braun Intertec: 4 years Education B.S., Agricultural Systems Technology, South Dakota State University Certifications International Code Council (ICC) Certified: Reinforced Concrete Special Inspector, Structural Masonry Special Inspector, Prestressed Concrete Special Inspector, Soils Special Inspector No. 1136593 American Concrete Institute (ACI) Concrete Field Testing Technician Grade I No. 00936257 MnDOT Certified: Aggregate Production Grading and Base Level I & II Bituminous Street Level I Bituminous Plant Inspector Level I Concrete Field Level I & II Concrete Plant Inspector Level I Bridge Construction Level I & II No. 07515 241 *While employed by another firm. Jacob D. Collins Project Manager Jacob joined Braun Intertec in 2022 as a project manager. Jacob has more than 20 years of experience with special inspections and testing. He now acts as a project manager for commercial and transportation projects. His extensive on-site testing and special inspection experience related to concrete, masonry, structural steel, fireproofing, soils as well as with MnDOT testing for transportation will help any project as project manager. Jacob also assists technicians on-site with training to help ensure the tests and observations are done properly in accordance with the project at hand. Project Experience ▪ Preska Hall – Mankato State University – Mankato, MN (2011-2012)* ▪ St. Cloud State University Integrated Science and Engineering Laboratory Facility (ISELF) – St. Cloud, MN (2012-2013)* ▪ Herb Brooks National Hockey Center – Entrance Expansion – St. Cloud, MN –2012-2013)* ▪ North Hennepin Community College – Bioscience and Health Career Center – Brooklyn Park, MN – (2013-2014)* ▪ Mall of America – Phase 1C Expansion – Bloomington, MN – (2014-2016)* ▪ Encore Apartments – Minneapolis, MN – (2015-2016)* ▪ University of Minnesota – Athletes Village – Minneapolis, MN (2016-2017)* ▪ Various Local Municipality Street and Utility Improvements – Anoka, Brooklyn Center, Coon Rapids, Maple Grove, Ramsey, Robbinsdale – (2017-2022)* ▪ North Loop Apartments – Project 1 – Minneapolis, MN (2018-2019)* ▪ 1701 Nicollet Avenue Apartments – NICO I – Minneapolis, MN (2019)* ▪ 2924 Bryant Avenue Apartments – Minneapolis, MN (2020)* ▪ Robbinsdale Water System Improvements – Water Treatment Facility – Robbinsdale, MN – (2020-2022)* ▪ Cityline Apartments – Minneapolis, MN – (2021-2022)* ▪ NICO II Apartments – Minneapolis, MN – (2021-2022)* Experience Industry: 20 years Braun Intertec: 4 years Education Civil Engineering University of Minnesota Certifications PTI Level 2 Unbonded PT Inspector ICC Structural Steel 1 Framing and Bolting ICC Structural Steel 2 Welding ICC Steel Reinforced Concrete ICC Fireproofing ICC Soils ACI Field Technician MnDOT Aggregate Production MnDOT Concrete Field MnDOT Concrete Plant MnDOT Bituminous Street MnDOT Bituminous Plant MnDOT Grading & Base Tester MnDOT Grading & Base Inspector 242 Jacob D. Collins Project Manager Page 2 *While employed by another firm. ▪ University of Minnesota – Microbial Cell Production Facility (MCPF) – St. Paul, MN – (2021-2022)* ▪ Farmington – 2022 Street and Utility Improvements – Farmington, MN (2022) ▪ St. Therese Senior Community – Corcoran, MN (2022-2024) ▪ Cottage Grove 100th Street, 105th Street, & Ideal Avenue Improvements – Cottage Grove, MN (2022-2023) ▪ Cottage Grove – South District Street and Utility Improvements – Cottage Grove, MN (2022-2023) ▪ Northfield 2022 NW Area Mill and Overlay Project – Northfield, MN (2022) ▪ Brooklyn Center – Woodbine Area Improvements / 53rd Avenue Mill & Overlay – SAP 109-116-003, SAP 109113-002 – Brooklyn Center, MN (2022) ▪ Crew Carwash – West St. Paul – West St. Paul, MN (2022) ▪ Edina Community Center 2022 Improvements – Edina, MN (2022) ▪ City of Cottage Grove – Glacial Valley Park Improvements (2022-2023) ▪ City of Carver – Ironwood Park Improvements – Carver, MN (2022-2023) ▪ Carver Elementary 2022 Addition – Carver, MN (2022-2023) ▪ Chanhassen – 2022 Lake Lucy Road Rehabilitation – SAP 253-102-001 – Chanhassen, MN (2022) ▪ Cottage Grove – E Point Douglas and Jamaica Avenue – SAP 180-110-014, Cottage Grove, MN (2023-2024) ▪ City of Brooklyn Center – 2023 Street and Utility Improvements – CP 23-01, CP 23-02, and CP 23-03 – Brooklyn Center, MN (2023) ▪ City of Maple Grove – Lakeview Knolls Site Pickleball – Maple Grove, MN (2023) ▪ Cottage Grove – Low Zone Water Treatment Plant – Cottage Grove, MN (2023-2025) ▪ Chanhassen – 2023 City Pavement Rehabilitation – CP 23-01 – Chanhassen, MN (2023) ▪ Ramsey – The COR Grading Improvements – Ramsey, MN (2023) ▪ Chanhassen – Galpin Boulevard Reconstruction – SAP 194-115-004 – Chanhassen, MN (2024-Current) ▪ TH 41 / Organic Recycling Facility Driveway Intersection Improvements – SP 7010-115 – Shakopee, MN (2024) ▪ County Road 5 Extension – SAP 043-605-016 SAP 043-609-019 – Winsted, MN (2024-2025) ▪ Brooklyn Center Orchard Lane East Improvements – Brooklyn Center, MN – (2024-2025) ▪ Cottage Grove - Intermediate Zone Water Treatment Plant – Cottage Grove, MN (2025-Current) ▪ Chanhassen – Crimson Bay Road Rehabilitation – SP 1002-123 – Chanhassen, MN (2025-Current) ▪ Northfield Mill Towns State Trail – Northfield, MN (2025-Current) ▪ Maple Grove The Commons and Waldon Shores Area Street Reconstruction – CP 2025-03 – Maple Grove, MN (2025) 243 Andrew M. Valerius Director, Senior Project Manager Andrew is a senior project manager who is responsible for overseeing the quality control and day-to-day operations of engineering technicians involved in roadway and bridge projects. Specializing in state-aid and federally-funded projects, he has extensive experience working with the Minnesota Department of Transportation’s (MnDOT) Schedule of Materials Control and MnDOT’s Standard Specifications for Construction. From past work he has a working relationship with MnDOT staff and is able to get timely responses to questions and resolve issues to keep projects on schedule. Internally, Andrew helps lead the Braun Intertec transportation construction materials testing group for the State of Minnesota. Andrew also helps organize and presents at many educational sessions that focus on MnDOT’s specifications and procedures. Andrew’s past experience providing field services, such as soil density testing, concrete testing, bituminous and concrete batch plant observations, and testing services has allowed him to gain the necessary knowledge of field testing practices and practical site experience to perform his senior project manager role at a high level to deliver quality results safely. Project Experience Andrew has worked on numerous local government projects including many MnDOT state-aid and federally funded projects while with Braun Intertec. He has provided material testing oversight and review for the following cities: ▪ City of Bloomington, Bloomington, MN Oversaw the Construction Material Testing for the City of Bloomington’s projects during the 2024, 2019, 2017, 2016, 2015, 2014, and 2011 construction season.* Also provided oversight of the Normandale Boulevard Reconstruction Project and the Old Cedar Avenue Roadway and Trail Improvement Project during the 2017 and 2018 Construction Seasons for the City of Bloomington. ▪ City of Lakeville, Lakeville, MN — Oversaw the Construction Material Testing for the City of Lakeville’s projects since 2009.* ▪ City of Apple Valley, Apple Valley, MN — Oversaw the Construction Material Testing for the City of Apple Valley’s projects since 2010.* ▪ City of Edina, Edina, MN Oversaw the Construction Material Testing for the City of Edina’s state aid/federal projects since 2009.* Experience Industry: 20 years Braun Intertec: 20 years Education B.S. Technology Assessment and Management St. Cloud State University Certifications MnDOT Certified #13631 Aggregate Production Concrete Field Tester & Inspector Grading & Base Tester & Inspector Concrete Plant Tester Bituminous Plant Tester Bituminous Street Inspector 244 Andrew M. Valerius Associate Director, Senior Project Manager Page 2 ▪ City of Chaska, Chaska, MN Oversaw the Construction Material Testing for the City of Chaska’s state aid/federal projects since 2009.* ▪ City of Plymouth, Plymouth, MN Oversaw the Construction Material Testing for various City of Plymouth’s state aid/ federal projects since 2009.* ▪ City of St. Paul, St. Paul, MN Oversaw the Construction Material Testing for the City of St. Paul’s projects during the 2009 construction season. Currently provides a supporting role to our John Rutherford our project manager.* ▪ City of St. Louis Park, St. Louis Park, MN -- Oversaw the Construction Material Testing for various City of St. Louis Park’s state aid/ federal projects since 2009.* ▪ City of Hastings, Hastings, MN Oversaw the Construction Material Testing for various City of Hastings’ projects since 2009.* ▪ MN State Government Shutdown, Various Cities, MN Provided project management for bituminous and concrete batch plant observations and testing for numerous cities and projects during the three week government shutdown in 2011.* MnDOT Project Experience Andrew has worked on numerous MnDOT projects while with Braun Intertec. He has provided materials testing oversight and review for the following major projects: ▪ TH 13/101, Savage, MN Schedule Materials Control Coordinator responsible for ensuring overall compliance with the Schedule of Materials Control, verify testing rates, and preparing year end materials certification for the project. Mr. Valerius coordinated with the QC/QA staff and also filled in for the Quality Manager/Construction Quality Manager at times during construction. ▪ I-35W Bridge over the Mississippi River, Minneapolis, MN Performed more than 1,000 hours of grading and base testing required for this major bridge replacement project. ▪ Central Corridor Light Rail Project, West and East Project, Minneapolis and St. Paul, MN Providing a supporting role to our Project Managers with guidance in MnDOT testing procedures and protocol. ▪ Advance Traffic Improvements Central Corridor Light Rail Project, Minneapolis, MN Oversaw construction materials testing on the Advance Traffic Improvements project which included many streets around the University of Minnesota. ▪ 4th Street Advanced Utilities, Central Corridor Light Rail Project, St. Paul, MN Provided Project Management oversight on the 4th Street Advanced Utility project on numerous streets in downtown St. Paul. 245 Charles Cadenhead, PE Vice President, Principal Engineer Charles brings more than 30 years of experience in the transportation industry and more than 26 years of experience in delivering construction projects for owners (MnDOT and Anoka County) and other clients. With every project, from design-bid-build to design-build Charles has been one of the primary individuals entrusted with quality oversight from all aspects. While working for MnDOT his primary focus was on the construction side of projects, however with his experience at Anoka County and as a consultant he has been involved in both design and construction quality management. At Anoka County he was involved as early as the right-of-way process and used his expertise in construction to help manage risks associated with the design of projects. Projects have been various in size from simple span bridges and mill and overlays to large design-build projects with over $400 million in construction. Charles brings years of contract administration and change management experience to bear in order to arrive at a successfully completed project. Project Experience For the past 8 years Charles has served as a Principal in Charge of municipal and state projects for Braun Intertec working with Project Managers and Technicians to provide engineering expertise and guidance. Below are larger projects in which Charles was heavily involved in the development and implementation of project construction, quality, and completion to meet the various requirements needed to satisfy high quality projects. TH494 Design Build | MnDOT Bloomington, Minnesota | 8/2024 - Present Quality Manager. MnDOT is reconstructing the I494 with additional lanes, bridges, retaining walls, movement of utilities and multiple staging efforts to reduce congestion on this heavily trafficked corridor. Charles is the Quality Manager for the project and oversees the design Quality Manager and Construction Quality Manager for this project. Charles was responsible for setting up the five quality manuals for the project and has worked with the designer, contractor, and owner to help manage the delivery of the project while meeting the project quality standards. 25% Commitment Experience MN Transportation: 30 years MnDOT: 15 years Design-Build projects: 4 years Anoka County: 5 years Design-Build projects: 2 years Private Sector: 14 years Design Build projects: 8 years Certifications Professional Engineer - Minnesota 246 Charles Cadenhead, PE Vice President, Principal Engineer Page 2 TH 52 Design Build | MnDOT Zumbrota, Minnesota | 7/2021 – 10/2023 Quality Manager. MnDOT reconstructed the Trunk Highway 52 mainline, approximately 20 miles, with new concrete pavement using the design-build project delivery method for the work. Charles was the Quality Manager for the project and oversees the design Quality Manager and Construction Quality Manager for this project. Charles was responsible for setting up the five quality manuals for the project and worked with the designer, contractor, and owner to help manage the delivery of the project while meeting the project quality standards. 25% Commitment I-94 Maple Grove to Rogers Design- Build | MnDOT Maple Grove, Minnesota | 9/2019 – 7/2022 Quality Manager. MnDOT is adding a lane to I-94 between Maple Grove and Rogers using the design-build project delivery method for the project. Charles is the Quality Manager for the project and oversees the Design Quality Manager and Construction Quality Manager for this project. He has set up the five quality manuals for the project and works with the designer, contractor, and owner to help the delivery of the project meeting the project quality standards. 25% Commitment TH 371 Design-Build | MnDOT Nisswa, Minnesota | 9/2015 – 11/2017 Consultant Project Manager/Change Management. The reroute of TH 371 by Pequot Lakes is MnDOT, District 3, is a design-build project to allow travelers to avoid traffic congestion in the town of Pequot Lakes while allowing local traffic to move easier in the community. Charles is the consultant team project manager, contract administrator for MnDOT and the construction quality manager for this project that was completed in the fall of 2017. 30% Commitment I-35W/4th Street Design-Build | MnDOT Consultant Manager/Contract Administrator | 5/2014 – 11/2016 This MnDOT project incorporated the realignment of an overpass bridge, additional lane construction, retaining walls and contaminated material removal management. Charles performed the duties of contract administrator and consultant project manager for the entirety of the project. This busy urban project necessitated tight time controls on the traffic impacts on the interstate system and design modifications from the initial proposed layout. Charles was heavily involved in the weekly construction meetings and helping staff new to the design-build project delivery method. Total cost control and negotiations on the project led to an increase in the bid amount by less than 1% on the overall project costs. 30% Commitment Elk Run Design-Build | MnDOT Oronoco, Minnesota | 5/2012 – 11/2012 Construction/Project Engineer. Charles served as a construction engineer for the final year of the $34 million design-build project along the TH 52 corridor. The project scope consisted of the construction of a new Diverging Diamond Interchange with frontage/service roads on TH 52 and realignment of approximately three miles of Olmsted CSAH 12. As an extension of MnDOT, Charles managed the field and office staff and was responsible for oversight of the team to ensure verification inspection and testing was conducted in accordance with established standards and procedures in the Quality Management Plan. 30% Commitment 247 550 Cleveland Avenue North | Saint Paul, MN 55114 Phone (651) 659-9001 | (800) 972-6364 | Fax (651) 659-1379 | teamAET.com | AA/EEO This document shall not be reproduced, except in full, without written approval from American Engineering Testing, Inc. April 10, 2026 City of Chanhassen 7700 Market Boulevard Chanhassen, MN 55317 Attn: Ben Phillips – Construction Manager bphillips@ChanhassenMN.gov RE: Quality Assurance Testing Proposal 26-01 Construction Materials Testing City Project No. 26-01 Chanhassen, Minnesota AET Proposal No. P-0052166 Dear Mr. Phillips: Thank you for the opportunity to provide a proposal to perform testing services on the referenced project. This proposal has been prepared in response to your email request on April 7, 2026, and describes our understanding of the project, our anticipated scope of services, our unit rates, and an estimated total fee to perform these services. PROJECT INFORMATION The City of Chanhassen (the City) will be performing a street and utility improvements project during the 2026 construction season. Construction is anticipated to begin May 2026 and be completed July 1, 2026. The project area will include Fox Hollow Drive, Gray Fox Curve, Gray Fox Lane, Pleasant Park Drive, Foxtail Court, Fox Drive, and North Lotus Park Trail. The project will be funded with municipal funds. Plans and Specifications were prepared by Houston Engineering, Inc. We understand Construction Inspection and Contract Management of the project will be performed by the City or their authorized representative. PROJECT APPROACH During the construction improvements, AET will provide experienced MnDOT certified Engineering Technicians to perform sampling and material testing services in accordance with the project specific testing requirements referenced in the Project Manual. For this project, Ryan Schaefer will be AET’s contact. He can be reached at 651-603-6639 (office). AET requires a minimum of 24 hours’ notice of the need for Services. 248 Quality Assurance Testing Proposal 26-01 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052166 Page 2 of 5 SCOPE OF SERVICES Based on our review of the available plans and the scope of services requested in the RFP, our anticipated scope of services is outlined below. These services will be provided on an on-call basis, coordinated through authorized the City’s field personnel. Soils Sampling and Testing Our estimate of the sampling and testing to be performed on the grading and base items is based on the requirements of the RFP. AET will perform MnDOT Relative Density testing (Proctor) as well as in-place density and moisture testing on the following materials: • Utility Trench Backfill • Embankment Fill The MnDOT Dynamic Cone Penetrometer will be used to test compaction on the Class 5 Aggregate Base sections of the project following the MnDOT Penetration Index procedures in accordance with the 2025 SALT SMC. AET will perform the sampling of the soils, granular materials, and Class 5 Aggregate Base materials and transport the samples to our St. Paul, Minnesota laboratory. The City’s field personnel will update AET on the schedule of material placement, material sources (including changes in source), and changes in quantities. Full Depth Reclamation (FDR) AET will perform dynamic cone penetrometer (DCP) testing and moisture content testing of the full depth reclamation material along gradations in accordance with the 2025 SALT SMC. The frequency of these gradations for an FDR project are at the discretion of the Engineer. We assume the City’s Inspector will perform depth checks of the FDR material. Bituminous Pavement Sampling and Testing When placement of the bituminous base and wear layers begins, an experienced Technician II will make site visits on an on-call basis to observe the placement and rolling of the bituminous layers and to perform testing of the bituminous. The technician will help to establish a rolling pattern each day by observing the number of passes the roller makes over the bituminous and measuring the density of the bituminous during the rolling to evaluate how many passes are needed to reach the maximum density. 249 Quality Assurance Testing Proposal 26-01 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052166 Page 3 of 5 AET personnel will sample the bituminous paving mix, during each day of paving, and transport the samples to our St. Paul, Minnesota laboratory. Samples will be tested in our laboratory for MnDOT Gyratory Mix Properties as follows: • Gyratory Density (AASHTO T 312) MnDOT Modified • Rice Specific Gravity (ASTM D2041) • Asphalt Extraction and Aggregate Gradation (ASTM D2172 Method E-11) MnDOT Modified C137 and C117 • Fine Aggregate Angularity (AASHTO T 304, Method A, MnDOT 1206.5) • Coarse Aggregate Angularity, One Face (ASTM D5821) Concrete Sampling and Testing During the placement of concrete, AET will perform field testing consisting of slump, air content, temperature of the plastic concrete, and casting of cylinders for compression testing. The 2025 SALT SMC requires field testing for slump, air content, and temperature per every 100 cubic yards of each type of concrete placed each day. Compressive strength cylinders (1 set of 3 cylinders) are required once per every 300 cubic yards of each type of concrete placed each day; the cylinders will be retrieved the following day for curing and testing in our laboratory. The 3 cylinders are to be tested at 28-days. The RFP requests that we cast sets of 4 cylinders, with compressive strength testing as follows: 1 at 7 days, 3 at 28 days. We have assumed City’s field personnel will be compiling the concrete batch tickets, certificates of compliance, and AET’s field test results of the plastic concrete, which we will provide each day we are on-site performing testing services. REPORTING AET staff will prepare reports for the City to review. These reports will include the results of our field and laboratory testing as performed per the 2025 SALT SMC and testing frequencies referenced in the project documents. AET will complete the Preliminary Grading and Base Report and the Final Grading and Base Report, once provided with final project quantities. Daily field reports will also be prepared and made available upon request. In addition to these reports, once we receive final project quantities, AET will also complete a Final Summary Report of QA Testing after receiving final quantities. 250 Quality Assurance Testing Proposal 26-01 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052166 Page 4 of 5 COST-SAVINGS If all three projects are awarded, significant cost savings can be realized by consolidating the work under a single assigned technician. Because the construction schedules overlap, one technician can efficiently support all three projects during the same mobilization period, eliminating the need for multiple trip charges. This coordinated approach reduces travel and mobilization costs while maintaining consistent workmanship and project oversight, resulting in greater overall value for the client. ESTIMATED FEES Our services will be provided on a unit cost basis according to the unit rates provided in the attached RFP Bid Form. Our monthly invoices will be determined by multiplying the number of personnel hours or tests by their respective unit rates. We have also estimated a total cost which we anticipate will be required to complete the previously described observations and testing services. Our estimated total cost is $98,030.00. We refer you to the attached Materials Testing Estimate as reference to how we arrived at this estimated cost. We caution that this is only an estimated cost. Often, variations in the overall cost of the services occur due to reasons beyond our control, such as weather delays, changes in the contractor’s schedule, unforeseen conditions, or retesting. These variations will affect the actual invoice totals, either increasing or decreasing our total costs for the project from those estimated in this proposal. If more time or tests are required, additional fees may be needed to complete the project testing services. If less time or tests are needed, a cost savings will be realized. We will not, however, exceed the estimated total cost for the project without first obtaining your authorization. TERMS AND CONDITIONS Our services will be performed per the Professional Services Agreement between the City of Chanhassen and AET, once agreed upon by both parties. ACCEPTANCE The City will provide AET with formal authorization prior to the commencement of AET’s services, which are outlined in this proposal. 251 Quality Assurance Testing Proposal 26-01 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052166 Page 5 of 5 GENERAL REMARKS AET appreciates the opportunity to provide this service for you and looks forward to working with you on this project. If you have any questions or need additional information, please contact me. Sincerely, American Engineering Testing Ryan S. Schaefer Robert D. Anderson Geologist II/Transportation Project Manager Manager of Alternative Delivery & Transportation rschaefer@teamAET.com randerson@teamAET.com 651-603-6639 612-685-3079 Attachments: RFP Bid Form 252 TOTAL 2 Compaction Testing on Granular Materials (Nuclear Density Test)EA 60 11A MnDOT Gyratory Bituminous Mix Properties Verification Testing & Rice Testing EA 15 4 Topsoil Borrow Sample & Testing EA 1 10B Cylinder Pick Up Hours HR 5 Gradation Sample and Testing EA 10 6 DCP Tests for Aggregate Base (Class 5)EA 30 10A Concrete Testing and Cylinder Pickup Trip Charge EA 25 EA 10 ITEM NO.ITEM UNITS QUANTITY 14 Geotechnical and Pavement Evaluation Allowance Allowance 1 7 Soils & Granular Materials Testing Trip Charge (ALL)EA 60 11B 9B Concrete Testing Hours HR 125 30 Bituminous Verification Sample Pickup and Testing Hours 11C Bituminous Verification Sample Pickup Trip Charge EA 0 Project Management & Oversight HR 30 12B Roll Pattern Testing Trip Charge EA 10 15A $3,500 $__210.00______ $__95.00_______ 1 Compaction Testing on Soils (Nuclear Density Test)EA 105 0 3 Proctor Sample & Testing (including Moisture Content) EA 10 UNIT PRICE $__45.00_______ $__45.00_______ $__205.00______ 40 HR 9A Concrete Testing & Casting Cylinder Sets (Compressive Strength, Curing, & Handling)*EA 50 *EA indicates a set of 4 cylinders 130 $__375.00______ $__150.00______ $__70.00_______ $__80.00_______ $__126.00______ $__180.00______ $__126.00______ $__45.00_______ TOTAL PRICE $___4,725.00_______ $___2,700.00_______ $___2,050.00_______ $___375.00_________ $___1,500.00_______ $___2,100.00_______ $___4,800.00_______ $___16,380.00______ $___9,000.00_______ $___15,750.00______ $___450.00_________ 13 Evaluation, Reporting, & Analysis Documentation LS 1 $__80.00_______ $__126.00______ $__690.00______ $__126.00______ $__80.00_______ $__126.00______ $__80.00_______ $__1,680.00____ 8 Soils & Granular Materials Testing Hours (ALL)HR $___2,000.00_______ $___5,040.00_______ $___10,350.00______ $_________________ $_________________ $___3,780.00_______ $___800.00_________ $___1,680.00______ $3,500 $___6,300.00_______ $___4,750.00_______ $___98,030.00______ 9C Concrete Testing & Casting Field-Cured Cylinders (Compressive Strength, Curing, & Handling) 12A Roll Pattern Testing Hours HR 15B Project Administration HR 50 253 4/7/2026 Request for Proposals: Construction Materials Testing for 2026 City Reconstruction Project No. 26-01 I. INTRODUCTION The City of Chanhassen is issuing this Request for Proposals (RFP) for construction professional services of approximately a half (2.2) miles of roadway reconstruction, rehabilitation and associated utility and stormwater improvements within the City. In general, the project includes materials testing and sampling, geotechnical evaluations, and recommendations of site conditions during construction. A. RFP Content. This RFP contains the following sections: I. Introduction II. Project Information III. Proposal Requirements B. Addenda/Clarifications. Any changes to this RFP will be made by written addendum. Verbal modification will not be binding. C. Pre-Contractual Expenses. The city will not be responsible for any pre-contractual expenses. Pre-contractual expenses are defined as expenses incurred by the Consultant in: 1. Preparing its proposal in response to this RFP 2. Submitting that proposal to the City of Chanhassen 3. Negotiating with the City of Chanhassen any matter related to that proposal; or 4. Any other expenses incurred by the Consultant prior to the date of execution of the Proposed Agreement. D. Contract Award 1. Consultant shall be required to enter into the City’s standard Professional Services Agreement (attached). 254 4/7/2026 2. Issuance of this RFP and receipt of proposals does not commit the City of Chanhassen to award a contract. The City of Chanhassen reserves the right to postpone opening for its own convenience, to accept or reject any or all proposals received in response to this RFP, to negotiate with other than the selected Consultant should negotiations with the elected be terminated, to negotiate with more than one Consultant simultaneously, or to cancel all or part of this RFP. E. Contact Person. The Consultant's contact for specific questions regarding information in this proposal is: Ben Phillips, (952) 227-1166, Bphillips@ChanhassenMN.gov. II. PROJECT INFORMATION A. Project Area and Identified Improvements. Approximately 2.2 miles of roadway is proposed to be rehabilitated or reconstructed within two residential areas within Chanhassen. The areas proposed for improvements is shown in the attached Figures. The Vasserman Ridge development was originally constructed between 2002 and 2004. It was last seal-coated in 2009. This ~4750-foot (0.90 mile) total street length within the neighborhood is initially programmed to be rehabilitated via mill and overlay but this technique will need to be analyzed and verified by the consultant as the correct approach. The Fox Hollow development was originally constructed between 1985 and 1988 except for Fox Dr which was constructed in 2005 and seal-coated in 2015. The neighborhood has not been rehabilitated but it was seal-coated in 2006. It is currently programmed to be rehabilitated via a full depth reclamation from TH 5 to the intersection with Lake Dr E. A portion of Fox Hollow Dr between Pleasant Park Dr and the cul-de-sac on Fox Hollow Dr is within North Lotus Lake Park and off-set within the existing right-of-way. The City’s 2040 Comprehensive Plan identifies this segment to be re-aligned. Additional analysis will likely be needed for this segment and it is expected to be discussed in detail within the open house meetings and City Council meetings as it will most likely be ‘political’ in nature. It is expected that alternatives will need to be developed and an emphasis on communication will be needed regarding any proposed re- alignment. Fox Hollow Ct is a private street constructed in 2007 and is not planned to be part of the project except where planned work along Fox Hollow Dr interacts with this minor development. 255 4/7/2026 The areas proposed for improvements are shown in Figure A and B below. A full plan set, project specifications, and geotechnical report are available upon request. Please contact Ben Phillips to obtain these documents. Figure A Figure B 256 4/7/2026 B. Project Scope. The objective is to provide construction materials testing and any requested geotechnical evaluations and recommendations of site conditions. Anticipated amounts of various tests needed on this project are detailed below. Please ensure to submit costs for the amounts listed as provided on the attached spreadsheet. 1. Soils and Aggregate Testing a. Soil and aggregation gradation, proctor, moisture, modified DCP testing on Class 5, aggregate quality testing, and specified density nuclear tests of trench backfill for utility work per city specifications: Submit costs for 165 compaction tests (nuclear density test), 10 proctor samples, 1 samples for topsoil borrow testing, 10 gradations (aggregate base, select granular, aggregate backfills), 30 DCP tests with moisture result on Class 5. b. Trip charges and technician time: Submit costs for 60 trips and 130 hours of technician time for soils and aggregate testing. 2. Concrete Testing 257 4/7/2026 a. Slump, air, temperature & 1 set of 4x8 cylinders per 100 CY per mix type per day (4 cylinders is 1 set): Submit costs for Compressive Strength, Curing, & Handling for 50 sets of cylinders and technician time of 125 hours. Submit total costs for Compressive Strength, Curing, & Handling for 10 field-cured cylinders (per cylinder). b. Concrete strength break testing and reports for cylinder sets (one 7-day and three 28-day) and field-cures (as directed by Engineer) cast: Submit costs for sample pickup time of 40 hours and 25 total trips for concrete testing and cylinder pickup. 3. Bituminous Testing a. MnDOT gyratory mix properties verification testing per day and Rice Testing per MnDOT 2360. (1 sample per day per mix type) Submit costs for 15 samples. Submit costs for 15 total trips and 25 hours of technician time for sample pickup and bituminous testing. b. Roll pattern establishment via Nuclear density testing (one per day per mix type). Submit total costs for 10 trips and 30 hours of technician time. 4. Geotechnical and Pavement Evaluation and Recommendations a. This will only be utilized if very poor soils or unstable base is discovered during excavation or utility construction. A $3,500 allowance will be built into the proposal for the consultant to use on an as needed basis for consulting services. 5. Project Management & Oversight Submit cost per attached spreadsheet per hour. 6. Project Administration (Evaluation, Reporting and Analysis Documentation) Consultant shall submit daily reports and other standard documents utilized to summarize daily activity on-site and observations on a routine basis as directed by Engineer. 258 4/7/2026 For example: If roll pattern testing is performed in preparation for paving operations – the tests, timing, location, and observations shall be detailed in a daily report. Final project report summarizing all testing completed. D. Project Schedule. The following is the anticipated project schedule: III. PROPOSAL A. Submission of Proposal. Submit the proposal electronically to: Ben Phillips Construction Manager City of Chanhassen Bphillips@ChanhassenMN.gov Proposals shall be received by 4:00 p.m., April 17th, 2026. Proposals received after this time will not be accepted. B. Proposal Format. Proposals shall be prepared two-sided on 8½" x 11" paper, with all text clear of binding. Use of 11" x 17” fold-out sheets for large tables, charts or diagrams is permissible but shall be limited. The proposal shall be clear and understandable when reproduced in black and white and or color. C. Copies. The Consultant shall submit one (1) electronic copy of the proposal bearing the Consultant's name and address, and clearly marked as following: "26-01 Construction Materials Testing” D. Letter of Transmittal. Include, at a minimum, the following: Start Construction Final Completion May 2026 July 1st, 2027 259 4/7/2026 1. Identification of the offering firm(s), including name, address and telephone number of each firm, 2. Acknowledgement of receipt of RFP addenda, if any, and 3. Name, title, address, email address and telephone numbers of contact person during period of proposal evaluation. E. Consultant Team. Identify all team members and areas of responsibility. Resumes may be requested by City staff during proposal review. F. Understanding of the Project. The Consultant shall provide a brief, concise description that demonstrates the Consultant's understanding of the project and what needs to be done to successfully complete the work scope. G. Consultant Fee. Consultant shall provide the detailed cost breakdown as required in the spreadsheet format attached to the proposal. Any modifications must be approved the City prior to submission. A total not-to-exceed cost for all work shall be included. H. Exceptions and Deviations. The Consultant may include other services outside the scope of this proposal that the firm feels may be needed. The Consultant also may propose cost-saving items. Any exceptions to the requirements in this RFP, including the language in the contractual terms, must be included in the proposal. If the Consultant proposes changes to the scope of work, include a description, reason for the change and added/deducted engineering costs. Segregate all exceptions as a separate element of the proposal under the heading "Exceptions and Deviations". 260 TOTAL 2 Compaction Testing on Granular Materials (Nuclear Density Test) EA 60 $______________ $__________________ $__________________ 11A MnDOT Gyratory Bituminous Mix Properties Verification Testing & Rice Testing EA 15 $______________ $__________________ 4 Topsoil Borrow Sample & Testing EA 1 10B Cylinder Pick Up Hours HR $______________ $__________________ 5 Gradation Sample and Testing EA 10 $______________ $__________________ 6 DCP Tests for Aggregate Base (Class 5) EA 30 $______________ $__________________ 10A Concrete Testing and Cylinder Pickup Trip Charge EA 25 $______________ $__________________ EA 10 $______________ $__________________ ITEM NO. ITEM UNITS QUANTITY UNIT PRICE TOTAL PRICE $__________________ 14 Geotechnical and Pavement Evaluation Allowance Allowance 1 7 Soils & Granular Materials Testing Trip Charge (ALL) EA 60 $______________ $__________________ 11B $__________________9B Concrete Testing Hours HR 125 $______________ 30 $______________ $__________________ Bituminous Verification Sample Pickup and Testing Hours 11C Bituminous Verification Sample Pickup Trip Charge EA 0 $______________ $__________________ $______________ $__________________ Project Management & Oversight HR 30 $______________ $__________________ 12B Roll Pattern Testing Trip Charge EA 10 $______________ 15A $3,500 $3,500 1 Compaction Testing on Soils (Nuclear Density Test) EA 105 $______________ $__________________ 0 $______________ $__________________ 3 Proctor Sample & Testing (including Moisture Content) EA 10 $______________ $__________________ 40 $______________ $__________________ HR 9A Concrete Testing & Casting Cylinder Sets (Compressive Strength, Curing, & Handling) *EA 50 $______________ *EA indicates a set of 4 cylinders 130 $______________ $__________________ 13 Evaluation, Reporting, & Analysis Documentation LS 1 $______________ $__________________ 8 Soils & Granular Materials Testing Hours (ALL) HR $__________________ 9C Concrete Testing & Casting Field-Cured Cylinders (Compressive Strength, Curing, & Handling) 12A Roll Pattern Testing Hours HR 15B Project Administration HR 50 261 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this ________ day of ___________________, 20__, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and __________________________________________ "Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for_____________________. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for quote – __________________ dated ______, 20___; C. Insurance Certificate; D. Consultant’s ______, 20___ proposal for___________________ (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of __________________ Dollars ($_____, inclusive of expenses. Services performed directly by Consultant shall be paid at an hourly rate in accordance with the Proposal, subject to the not to exceed fee. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 262 2 201749v1 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficien cies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each occurrence/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 263 3 201749v1 11. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 13. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 14. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 15. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 264 4 201749v1 16. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 17. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 18. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 19. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 20. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including pa yment for services performed or furnished to the date and time of termination. Dated: _______________, 20__. CITY OF CHANHASSEN BY: _____________________________________________ Elise Ryan, Mayor BY: _____________________________________________ Laurie Hokkanen, City Manager Dated: _______________, 20__. _______________________ BY: _____________________________________________ Its 265 Streets - 2026 Street Improvements Overview Request Owner Charlie Howley, PW Director/City Engineer Department Annual Pvmnt Mgmt Contracted Form Type Capital Improvement Request Type Street Construction/Reconstruction Project Number ST-012-2026 Description The 5-year Capital Pavement Management Plan identi es the planned streets for the next ve years. The Plan is updated every fall to review priorities and needs, but generally intends to keep the overall condition index (OCI) average across all streets at 70 or higher. 2026 Reconstruction 601-6054-XXXX The City uses a Pavement Management System in Cartegraph to monitor the condition of City streets. While proper preventative maintenance extends the life of the street and is cost effective, a street will eventually deteriorate to a point that major maintenance is required. Rehabilitation projects exited the life of the street. In cases when utilities or poor subgrade needs to be replaced or where streets have deteriorated to a point where rehabilitation will no longer be practical, reconstruction of the street is necessary. A feasibility study is written to consider the merits of the project, scope of work, costs, and assessments. The City has an Assessment Policy that identi es what and how much of the project is assessed to bene ting properties. The 2026 project is a full reconstruction scope. Details Type of Project Reconstruction 266 Capital Cost Breakdown Capital Cost FY2026 Total Engineering $870,000 $870,000 Construction/Maintenance $7,885,000 $7,885,000 Total $8,755,000 $8,755,000 Capital Cost FY2026 Budget $8,755,000 Total Budget (all years) $8.755M Project Total $8.755M Capital Cost by Year Construction/Maintenance Engineering 2026 $8,755,000.00 $0 $2.5M $5M $7.5M Capital Cost for Budgeted Years TOTAL $8,755,000.00 Construction/Maintenance (90%)$7,885,000. Engineering (10%)$870,000.00 267 Funding Sources Breakdown Funding Sources FY2026 Total Streets - PMP Funds $2,900,000 $2,900,000 Streets - PMP Assessments $1,935,000 $1,935,000 Utility Fund - Water $990,000 $990,000 Utility Fund - Sewer $800,000 $800,000 Utility Fund - SW Mgmt $2,130,000 $2,130,000 Total $8,755,000 $8,755,000 Funding Sources FY2026 Budget $8,755,000 Total Budget (all years) $8.755M Project Total $8.755M Funding Sources by Year Streets - PMP Assessments Streets - PMP Funds Utility Fund - Sewer Utility Fund - SW Mgmt Utility Fund - Water 2026 $8,755,000.00 $0 $2.5M $5M $7.5M Funding Sources for Budgeted Years TOTAL $8,755,000.00 Streets - PMP Assessments (22%)$1,935,000.0 Streets - PMP Funds (33%)$2,900,000.00 Utility Fund - Sewer (9%)$800,000.00 Utility Fund - SW Mgmt (24%)$2,130,000.00 Utility Fund - Water (11%)$990,000.00 268 City Council Item April 27, 2026 Item Resolution 2026-XX: Approve Construction Materials Testing Agreement for the Market Boulevard Rehabilitation Project No. 25-02 File No.ENG Project No. 25-02 CIP No. ST-012 Item No: D.15 Agenda Section CONSENT AGENDA Prepared By Ben Phillips, Engineering Technician III Reviewed By George Bender SUGGESTED ACTION "The Chanhassen City Council adopts a resolution awarding a consulting agreement for construction materials testing to Braun Intertec for the Market Boulevard Rehabilitation Project No. 25-02" Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY The construction for the Market Boulevard Rehabilitation Project No. 25-02 has been awarded to Valley Paving, Inc. Construction activity is expected to begin mid-May 2026. Construction Materials Testing (CMT) is a required component of the Quality Control/Quality Assurance (QC/QA) process for roadway construction projects of this type, ensuring that all materials - including soils, aggregate base, concrete, and bituminous pavement - meet applicable MnDOT specifications and project requirements. The Engineering Department solicited proposals from two qualified testing firms - Braun Intertec Corporation and American Engineering Testing, Inc. (AET) - consistent with the city's established practice on prior pavement rehabilitation projects. 269 BACKGROUND The project began conceptual design back in February of 2016, starting with a downtown traffic study and developing intersection layout options. After completion of a feasibility study, the project went dormant for a number of years. In early 2021, the design was reignited with an LRIP grant funding application, which was unsuccessful. In 2023, the project was added to the CIP with a targeted construction window, which essentially kicked off the design efforts for this project. Multiple concepts were developed over the next couple of years, and the project grew to include the downtown regional stormwater reuse scope. A previous corridor layout consisting of a single lane of traffic with multiple mini roundabouts was 'Ordered' and advanced to 60% final design before being put on hold in March 2025 for re-evaluation by the City Council. On October 27, 2025, the City Council 'Ordered the Project', which outlined the currently designed layout. DISCUSSION The Engineering Department solicited proposals from American Engineering Testing, Inc. and Braun Intertec Corporation for the construction materials testing and associated professional engineering services required to facilitate the construction of the project. Both firms submitted competitive proposals. The proposals were reviewed to compare the proposed work scopes, testing rates, and estimated costs. This also included review of the level of effort and clarity of each firm's proposal in meeting the specifications of the project. As necessary, quantity and/or testing rate amounts in the proposals were adjusted to facilitate a fair comparison between the proposals. The proposals were analyzed and the results are as follows: Braun Intertec - $72,522.00 American Engineering Testing - $82,235.00 Both firms have the required certified personnel and are capable of completing the required work. Both firms have successfully completed work for the city on past projects. Staff recommends Braun Intertec be selected for this work. Braun Intertec's proposal is on a unit-cost basis and billed per personnel hours and/or testing rates provided in their proposal. Staff recommends an agreement amount of $77,000.00 be awarded to allow for minor adjustments to the testing quantities without the need for processing a contract modification. Braun will submit monthly invoices that staff will review before processing. Staff will review the invoices for accuracy and conformance with the contract. BUDGET 270 Funding for the Market Boulevard Rehabilitation Project No. 25-02 will be through the PMP fund budget established by the city for this project. RECOMMENDATION Staff recommends the City Council adopt a resolution to approve entering into the contract with Braun Intertec in the amount of $77,000.00 for construction material testing professional services which includes a small contingency for additional services that routinely arise during construction. ATTACHMENTS Resolution 2026-XX Award Materials Testing Contract City of Chanhassen Braun Agreement 25-02 Braun- Chanhassen - Market Boulevard Improvements AET 25-02 Construction Materials Testing Proposal 25-02 CMT RFP Final 271 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: Apirl 27 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION AWARDING A CONSULTANT AGREEMENT FOR CONSTRUCTION MATERIALS TESTING FOR THE MARKET BOULEVARD REHABILITATION PROJECT NO. 25-02 WHEREAS, pursuant to a request for proposals for construction material testing for the Market Boulevard Rehabilitation Project No. 25-02, two proposals were received and evaluated that complied with the request for proposal: Bidder Quote Amount Braun Intertec $72,522.00 American Engineering and Testing $82,235.00 WHEREAS, it was evaluated by staff that Braun Intertec had the lowest responsible quote and best met the scope of the request for proposals. A consultant contract amount of $77,000.00 is recommended to be awarded to allow for minor revisions to unit price testing quantities during construction to facilitate not needing to approve a contract revision. NOW, THEREFORE, BE IT RESOLVED by the Chanhassen City Council that the Mayor and City Manager are hereby authorized and directed to enter into a consulting agreement with Braun Intertec in the name of the City of Chanhassen for the construction materials testing professional services for the Market Boulevard Rehabilitation Project No. 25-02 according to the proposal and the plans and specifications on file in the office of the City Engineer. PASSED AND ADOPTED by the Chanhassen City Council on this 27th day of Apirl 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 272 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this 27th day of April, 2026, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and BRAUN INTERTEC CORPORATION ("Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for construction materials testing and associated engineering services. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for quote – Construction Materials Testing Services for #25-02, Distributed April 3rd, 2026; C. Insurance Certificate; D. Consultant’s April 20th, 2026, proposal for $77,000.00 (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of Seventy-seven Thousand Dollars ($77,000.00), inclusive of expenses. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. Notwithstanding the foregoing, the information is not intended or represented to be suitable for reuse by the City or others on extensions or modifications of the services or on any other project. Any such reuse without written verification or adaptation by Consultant for the specific purpose intended will be at the City’s sole 273 2 201749v1 risk, and the City agrees to hold Consultant harmless for all costs and liability arising out of such unauthorized use. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances, at the same time and in the same locality. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, to the extent caused by the negligent execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each claim/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. ALLOCATION OF LIABILITY. Notwithstanding anything to the contrary, in no event will Consultant be liable for any consequential, indirect, incidental, special, exemplary, punitive, or enhanced damages, and in no event will Consultant’s aggregate liability arising out of this Agreement, or the services performed exceed the amount of the applicable insurance limits set forth in the Agreement. 274 3 201749v1 11. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 12. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 13. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 14. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 15. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 275 4 201749v1 16. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 17. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 18. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 19. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 20. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 21. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including payment for services performed or furnished to the date and time of termination. Dated: CITY OF CHANHASSEN BY: Elise Ryan, Mayor BY: Laurie Hokkanen, City Manager 276 5 201749v1 Dated: BRAUN INTERTEC CORPORATION BY: Its 277 April 20, 2026 Proposal 10010488_001 Ben Phillips City of Chanhassen 7700 Market Blvd Chanhassen, MN 55317 Re: Proposal for Construction Materials Testing Services Market Boulevard Improvements S.A.P. 194-123-002, 25-02 Chanhassen, Minnesota Dear Mr. Phillips: Braun Intertec Corporation (Braun Intertec) submits this proposal to provide construction materials testing services for the Market Boulevard Improvements Project in Chanhassen, Minnesota. Our Understanding of Project We understand this project will include selective reclamation and reconstruction of the existing roadways. Roadways involved in this project include Chan View Street and Market Boulevard. Construction will include subgrade preparation, aggregate base placement, reclaimed aggregate base, new concrete curb and gutter, sidewalk, and driveways along with a new bituminous pavement. A small retaining wall will be part of the project. Improvements to the sanitary, storm, and water main utilities will also be part of this project. This is a City of Chanhassen project with state-aid funding. Projects that are constructed with state-aid funding are required to perform Quality Control and Quality Assurance (QC/QA) testing in accordance with the Minnesota Department of Transportation’s (MnDOT’s) 2025 Standard Specifications for Construction and MnDOT’s Schedule of Materials Control. This project is using MnDOT’s 2025 State Aid for Local Transportation (SALT) Schedule of Materials Control. Personnel with MnDOT certifications must complete the monitoring and testing. Braun Intertec will perform the QA field testing on the project as listed in our scope of services and as shown on our attached cost estimate table. The contractor will be responsible for performing all of the required QC testing and submitting all the documentation upon completion of the project. An audit of the project could be conducted upon completion. The audit may include reviewing tests and paperwork provided by your QC/QA representative. Available Project Information This proposal was prepared using the following documents and information. ▪ Project 90 percent plans prepared by Kimley-Horn and Associates, Inc., dated February 20, 2026. 278 City of Chanhassen Market Boulevard Improvements Proposal 10010488_001 April 20, 2026 Braun Intertec Page 2 ▪ City of Chanhassen Standard Specifications and Detail Plates prepared by the City of Chanhassen, dated January 22, 2026. ▪ Request for Proposals provided by the City of Chanhassen, dated February 9 ,2026 and provided to Braun Intertec via email on April 7, 2026. Braun Intertec Project Team For this project we propose using Tom Loosbrock as a lead senior technician and Jacob Collins as our project manager. Tom and Jacob will be supported by account leader Andrew Valerius, and principal engineer Charles Cadenhead. The project team has provided services on many City of Chanhassen projects in the past including: Crimson Bay Street Improvements, Galpin Boulevard, 2024 Street Reconstruction, 2023 Mill and Overlay Project, Orchard Lane Area Improvements, Minnewashta Manor Neighborhood Street Reconstruction, and the 2023, 2022, 2017, and 2016 Street Resurfacing and Rehabilitation Projects and state-aid projects Lake Lucy Road Rehabilitation, Lake Drive Improvements, and Minnewashta Parkway Rehabilitation. Tom Loosbrock is a senior engineering assistant with more than 20 years of experience in materials testing and is responsible for field operation coordinating, general project management; soil density testing using nuclear and sand cone methods; soil excavation observations; DCP testing, concrete testing and bituminous testing. Tom has worked on many state-aid projects throughout his career and is familiar with MnDOT specification, and the schedule of materials control. Jacob Collins is a project manager and will be the main point of contact for this project. Jacob has more than 18 years of experience with special inspections and testing. His extensive on-site testing and special inspection experience related to concrete, masonry, structural steel, fireproofing, soils as well as with MnDOT testing for transportation will help any project as project manager. Jacob also assists technicians on- site with training to help ensure the tests and observations are done properly in accordance with the project at hand. Andrew Valerius is a senior project manager with more than 20 years experience who is responsible for overseeing the quality control and day-to-day operations of engineering technicians involved in roadway and bridge projects, especially for state-aid and federally-funded projects. He has extensive experience working with the Minnesota Department of Transportation’s (MnDOT) Schedule of Materials Control and MnDOT’s Standard Specifications for Construction. Internally, he help leads the Braun Intertec transportation construction materials testing group for the State of Minnesota. Andrew also helps organize and presents at many educational sessions that focus on MnDOT’s specifications and procedures. Andrew’s past experience providing field services, such as soil density testing, concrete testing, bituminous and concrete batch plant observations, and testing services has allowed him to gain the necessary knowledge of field testing practices and practical site experience to perform his senior project manager role at a high level and deliver quality results safely. 279 City of Chanhassen Market Boulevard Improvements Proposal 10010488_001 April 20, 2026 Braun Intertec Page 3 Charles Cadenhead has more than 30 years of experience in the transportation industry and more than 25 years of experience in delivering construction projects for owners (MnDOT and Anoka County) and other clients. With every project, from design-bid-build to design-build Charles has been one of the primary individuals entrusted with quality oversight from all aspects. While working for MnDOT his primary focus was on the construction side of projects, however with his experience at Anoka County and as a consultant he has been involved in both design and construction quality management. At Anoka County he was involved as early as the right-of-way process and used his expertise in construction to help manage risks associated with the design of projects. Projects have been various in size from simple span bridges and mill and overlays to large design-build projects with over $200 million in construction. Charles brings years of contract administration and change management experience to bear in order to arrive at a successfully completed project. Resumes for Tom Loosbrock, Jacob Collins, Andrew Valerius, and Charles Cadenhead are attached to highlight their expertise and experience with projects similar to this one. Braun Intertec Project Personnel For this project, we will provide technicians that are MnDOT certified in each specialized field. For the proposed scope of services, our staff will have the following certifications: ▪ Aggregate Production ▪ Grading & Base Tester ▪ Concrete Field Tester ▪ Bituminous Street Inspector ▪ Bituminous Plant Tester ▪ MnDOT or ACI Strength Testing Accredited Laboratory In the 2025 SALT Schedule of Material Control, which is part of this project’s testing requirements, MnDOT requires laboratories performing acceptance tests for payment to be accredited by the AASHTO Resource (formerly AASHTO Materials Reference Laboratory [AMRL]) for all test procedures performed. Braun Intertec is one of the few independent testing companies that is accredited in the metro area. With Braun Intertec’s Metro Material Laboratory typically operating 24 hours a day, laboratory test results are delivered in a timely manner. Scope of Services Testing services will be performed on an on-call, as-needed basis as requested and scheduled by you or your on-site project personnel. Based on our understanding of the project, we propose the following services. 280 City of Chanhassen Market Boulevard Improvements Proposal 10010488_001 April 20, 2026 Braun Intertec Page 4 Soil Related Services ▪ Perform nuclear gauge density tests on sub-grade preparation, common embankment, select granular embankment, retaining wall backfill, and utility backfill materials. ▪ Perform Dynamic Cone Penetrometer (DCP) tests on aggregate base material. ▪ Perform Full Depth Reclaim Dynamic Cone Penetrometer (DCP) tests on full depth reclaim (FDR) materials. ▪ Perform moisture content tests at time of compaction on sub-grade preparation, common embankment, select granular embankment, retaining wall and utility backfill and aggregate base. ▪ Perform gradation tests on full depth reclaim, select granular borrow, retaining wall backfill and aggregate base materials. ▪ Perform laboratory standard Proctor tests on backfill and fill materials. ▪ Prepare the preliminary and final grading and base report along with assembling the random sampling locations report for the aggregate base according to MnDOT Specifications. Concrete Field Testing Related Services ▪ Sample and test the plastic concrete for slump, air content, and temperature prior to placement. We assume that we will be able to appropriately dispose of excess concrete (and associated wash water) on site at no additional cost to us. ▪ Prepare 4-inch by 8-inch cylinders for compressive strength testing. A set of 4 cylinders will be cast, with 1 tested at 7 days and 3 at 28 days for each set cast. Per the request for proposal, we have included 10 field cure cylinders, if additional field cure cylinders are requested, each additional cylinder will be charged at the unit price listed in our cost estimate. ▪ Laboratory compressive strength testing of cylinders. Bituminous Related Services ▪ Collect verification samples per MnDOT’s 2360 specification and randomly select one sample per day per mix to run quality assurance tests on. Perform quality assurance tests on the verification samples which include the following tests: Rice specific gravity, asphalt content, extracted aggregate gradation, gyratory density, coarse aggregate angularity, and fine aggregate angularity. Compare agency test results with contractor’s test results for compliance with MnDOT 2360 specification. ▪ Measure the in-place wet density of the fresh bituminous with a nuclear density gauge to observe and document the contractor’s roll pattern (ordinary compaction). Reporting and Project Management Test results will be issued weekly for the project as the various tasks are performed. If, at any time, there are failing tests which do not appear to be in accordance with the plans and specifications or MnDOT’s Schedule of Materials Control, we will notify the engineer’s representative and any others that we are directed to notify. 281 City of Chanhassen Market Boulevard Improvements Proposal 10010488_001 April 20, 2026 Braun Intertec Page 5 Before the final project closeout, we will issue a final report. The report will include the following: ▪ Braun Intertec technician roster for technicians that conducted testing on the project. ▪ Completed MnDOT Materials Certification Exceptions Summary for items tested by Braun Intertec. ▪ Completed Preliminary and Final Grading and Base Report. ▪ Moisture, Density, DCP, Proctor and Gradation tests. ▪ Concrete compressive strength results. ▪ Bituminous verification test results. ▪ Bituminous contractor’s summary sheets. ▪ Copies of concrete and bituminous plant certifications. Basis of Scope of Work The costs associated with the proposed scope of services were estimated using the following assumptions. If the construction schedule is modified or the contractor completes the various phases of the project at different frequencies or durations than shown in this proposal, we may need to adjust the overall cost accordingly. The scope of work and number of trips required to perform these services are as shown in the attached table. Notable assumptions in developing our estimate include: ▪ We were provided estimated quantities of tests, hours, and quantities to use for the purposes of this estimate. These numbers were provided within the Request for Proposal. ▪ We understand it will take 40 trips to complete the nuclear density gauge, dynamic cone penetration, and soil sampling on this project. ▪ We understand 45 sets of concrete tests will be required to complete the project. We understand that 10 additional field-cured cylinders may be requested for the project. ▪ We understand bituminous paving will be completed in 8 days for this project. ▪ We assume MnDOT Metro Inspections will perform concrete batch plant monitoring and testing for this project. ▪ We assume MnDOT Metro Inspections will perform bituminous plant monitoring and testing for this project. ▪ We assume your full-time on-site construction observer will observe the test rolling for this project. ▪ We assume the project engineer of record will review and approve the contractor’s quality control submittals and test results. 282 City of Chanhassen Market Boulevard Improvements Proposal 10010488_001 April 20, 2026 Braun Intertec Page 6 ▪ You, or others you may designate, will provide us with current and approved plans and specifications for the project. Modification to these plans must also be sent to us so we can review their incorporation into the work. ▪ We will require a minimum of 24 hours’ notice for scheduling inspections for a specific time. Shorter than 24 hours’ notice may impact our ability to perform the requested services, and the associated impacts will be the responsibility of others. If the work is completed at different rates than described above, this proposal should be revised. Cost and Invoicing We will furnish the services described herein for an estimated fee of $72,522. Our estimated costs are based on industry averages for construction production. Depending on the contractor’s performance, our costs may be significantly reduced or slightly higher than estimated. A tabulation showing our estimated hourly and/or unit rates associated with our proposed scope of services is also attached. The actual cost of our services will be based on the actual units or hours expended to meet the requirements of the project documents. This cost estimate was developed with the understanding that the scope of services defined herein will be required and requested during our normal work hours of 6:00 a.m. to 4:00 p.m., Monday through Friday. Services that we are asked to provide to meet the project requirements or the contractor’s construction schedule outside our normal business hours will be invoiced using an overtime rate factor. The factor for services provided outside our normal work hours or on Saturday will be 1.25 times the listed hourly rate for the service provided. The factor for services provided on Sunday or legal holidays will be 1.5 times the listed hourly rate for the service provided. We have not included premiums for overtime in our cost estimate; however, we recommend that allowances and contingencies be made for overtime charges based on conversations with the contractor. You will be billed only for services provided on a time and materials basis. Because our services are directly controlled by the schedule and performance of others, the actual cost may vary from our estimate. It is difficult to project all of the services and the quantity of services that may be required for any project. If services are required that are not discussed above, we will provide them at the rates shown in the attached table or, if not shown, at our current Schedule of Charges. We will invoice you on a monthly basis. 283 City of Chanhassen Market Boulevard Improvements Proposal 10010488_001 April 20, 2026 Braun Intertec Page 7 General Remarks We will be happy to meet with you to discuss our scope of services further and clarify the various scope components. We appreciate the opportunity to present this proposal to you. After review this proposal, if selected, we will attach our estimate to the city provided terms and conditions after legal review within Braun Intertec and the City of Chanhassen. Braun Intertec will not release any written reports until we have received a signed agreement. We appreciate the opportunity to present this proposal to you. We will be happy to meet with you to discuss our proposed scope of services further and clarify the various scope components. Braun Intertec will not release any written reports until we have received a signed agreement. Ordering services from Braun Intertec constitutes acceptance of the terms of this proposal. To have questions answered or schedule a time to meet and discuss our approach to this project further, please contact Jacob Collins at 612.418.8570 (jacollins@braunintertec.com). Sincerely, Braun Intertec Corporation Jacob D. Collins Project Manager Andrew M. Valerius Director, Senior Project Manager Charles M. Cadenhead, Jr., PE Vice President, Principal Engineer Attachments: Cost Estimate Table City of Chanhassen Provided – Qty Item Price List Resumes –Jacob Collins, Andrew Valerius, and Charles Cadenhead The proposal is accepted, and Braun Intertec is authorized to proceed. _____________________________________________ Authorizer’s Firm _____________________________________________ Authorizer’s Signature _____________________________________________ Authorizer’s Name (please print or type) _____________________________________________ Authorizer’s Title _____________________________________________ Date 284 1 Fee Estimate 10010488_001 Chanhassen - 25-02 Market Blvd SAP 194-123-002 Client: Work Site Address: City of Chanhassen Ben Phillips 7700 Market Blvd Chanhassen, MN 55317-8363 Chanhassen, Minnesota 55317 Qty/Hours Rate Amount Task 1: Construction Materials Testing Subtask 1.1: Soils Testing $17,910.00 Soil Compaction Testing - Nuclear - Item 8 60.00 102.00 $6,120.00 Soil Compaction Testing - Non Nuclear - Item 8 45.00 102.00 $4,590.00 Soil Sample pick-up - Item 8 15.00 102.00 $1,530.00 Nuclear moisture-density meter charge, per hour 60.00 32.00 $1,920.00 Compaction Testing on Soils - Item 1 50 Ea @ 1 Qty 50.00 Compaction Testing on Granular - Item 2 10 Ea @ 1 Qty 10.00 Trip Charge - Soils Trip Charge - Item 7 40.00 50.00 $2,000.00 Geotechnical Evaluation Allowance - Item 14 1.00 1,750.00 $1,750.00 Subtask 1.2: Concrete Testing $17,550.00 Concrete Testing - Item 9B 125.00 102.00 $12,750.00 Concrete Cylinder Pick Up - Item 10B 25.00 102.00 $2,550.00 Trip Charge - Concrete Trip Charge - Item 10A 45.00 50.00 $2,250.00 Subtask 1.3: Asphalt Testing $6,300.00 Sample pick-up - Asphalt Sample pick-up - Item 11B 20.00 102.00 $2,040.00 Compaction Testing - Nuclear - Asphalt Roll Pattern - Item 12A 15.00 102.00 $1,530.00 Trip Charge - Asphalt Trip Charge 10.00 50.00 $500.00 Sample pick-up Trip Charge - Item 11C 5 Ea @ 1 Qty 5.00 Roll Pattern Trip Charge - Item 12B 5 Ea @ 1 Qty 5.00 Nuclear moisture-density meter charge, per hour - Item 12A 15.00 32.00 $480.00 Pavement Evaluation Allowance - Item 14 1.00 1,750.00 $1,750.00 Subtask 1.4: Laboratory Testing $19,742.00 Soil Proctor MD Relationship (Standard) each - Item 3 11.00 216.00 $2,376.00 Soil Topsoil Testing with Nutrients MnDOT 3877 2B each - Item 4 2.00 445.00 $890.00 Sieve Analysis with No. 200 wash (ASTM C136 and C117) - Item 5 12.00 168.00 $2,016.00 Concrete Compressive Strength Cylinders ASTM C39 each 190.00 42.00 $7,980.00 Concrete Cylinder Sets 45 Sets @ 4 Qty 180.00 Field-Cured Cylinders 10 Ea @ 1 Qty 10.00 MnDOT Asphalt Verification, per sample - Item 11A 8.00 810.00 $6,480.00 Subtask 1.5: Project Management $11,020.00 Project Manager - Item 15A 15.00 186.00 $2,790.00 Project Assistant - Item 15B 30.00 102.00 $3,060.00 Senior Project Manager - Item 13 4.00 218.00 $872.00 Principal Engineer - Item 13 2.00 254.00 $508.00 Project Manager - Item 13 15.00 186.00 $2,790.00 Final Report - SAP Final Report - Item 13 1.00 1,000.00 $1,000.00 Task 1 Total: $72,522.00 Project Total $72,522.00 285 Chanhassen - Market Blvd Improvement Project 25-02 (SAP 194-123-002) $890 11A MnDOT Gyratory Bituminous Mix Properties Verification Testing & Rice Testing EA 8 $810 $6,480 4 Topsoil Borrow Sample & Testing EA 2 $445.00 $2,550 10B Cylinder Pick Up Hours HR 25 $102 $0 5 Gradation Sample and Testing EA $2,376 $50 45 $50 $2,250 9B Concrete Testing Hours HR 125 $102 $12,750 9C Concrete Testing & Casting Field-Cured Cylinders (Compressive Strength, Curing, & Handling)EA 10 $42 $420 10A Concrete Testing and Cylinder Pickup Trip Charge Roll Pattern Testing Hours HR 15 $134 EA 11B Bituminous Verification Sample Pickup and Testing Hours HR 20 $102 120 $102 7 3 Proctor Sample & Testing (including Moisture Content) EA 11 $216.00 $12,240 8 Soils & Granular Materials Testing Hours (ALL) HR $2,016 6 DCP Tests for Aggregate Base (Class 5) EA 30 $0 $2,000 $168 12 Soils & Granular Materials Testing Trip Charge (ALL) EA 40 Compaction Testing on Soils (Nuclear Density Test) EA 75 $21.33 $1,600 ITEM NO. ITEM UNITS QUANTITY UNIT PRICE 45 $168 $7,560 9A Concrete Testing & Casting Cylinder Sets (Compressive Strength, Curing, & Handling)*EA $72,522 15A Project Management & Oversight HR 15 $2,790 $186 $3,500 Geotechnical and Pavement Evaluation Allowance Allowance 1 $3,500 $5,170 $5,170 *EA indicates a set of 4 cylinders TOTAL 11C Bituminous Verification Sample Pickup Trip Charge EA 5 $50 $250 COMMENTS Charged per hour as "Nuclear moisture-density meter" Assumes 1.5 Ea per hour estimate (50 hours assumed) Charged per hour as "Nuclear moisture-density meter" Assumes 1.5 Ea per hour estimate (10 hours assumed) No additional charge per each DCP. Cost is only per hour of technician. TOTAL PRICE 2 Compaction Testing on Granular Materials (Nuclear Density Test)EA 15 $21.33 $320 1 Will be charged per cylinder. Price displayed to left is per set assuming 4 cylinders. $2,040 Charges include Final Report (ea), Project Manager (hour), Senior Project Manager (hour), and Principal Engineer (hour) 15B Project Administration HR 30 $102 $3,060 $2,010 Price listed is combined lines of "nuclear moisture-density meter charge" and "Compaction Testing - Nuclear" both per hour 12B Roll Pattern Testing Trip Charge Half listed with "Soils Testing" for Geotechnical Evaluation and half listed with "Pavement Testing" for Pavement Evaluation $250 13 EA 5 $50 14 Evaluation, Reporting, & Analysis Documentation LS 1 12A 286 Thomas R. Loosbrock Field Operations Coordinator, Senior Field Technician Mr. Loosbrock is a field operations coordinator responsible for field scheduling; general project management; soil excavation observations; soil density testing; reinforced concrete observations & testing; reinforced masonry observations & testing and pre-stressed concrete inspections. Tom is familiar with MnDOT specifications, MnDOT schedule of materials control, and has been the lead technician on many state-aid and federal projects throughout his career. Tom was responsible for managing, performing field observations, and testing on the following projects and has more than 20 years of experience: Project Experience ▪ Galpin Boulevard Improvements SAP 194-115-004, Chanhassen, MN (Spring 2024 to Fall 2025) ▪ Chanhassen 2025 Pavement Rehabilitation 25-01, Chanhassen, MN (Summer 2025) ▪ 2024 City of Chanhassen City Pavement Rehabilitation 24-01, Chanhassen, MN (Summer 2024 to Summer 2025) ▪ 2023 City of Chanhassen Mill & Overlay Projects, Chanhassen, MN (Summer 2023 to Fall 2023) ▪ 2023 City of Chanhassen Pavement Rehabilitation Project Chanhassen, MN (Summer 2023 ▪ 2023 City of Chaska Street Reconstruction, Chaska, MN (Summer 2023 ▪ 2022 Lake Lucy Road Rehab Project, Chanhassen, MN (Summer 2022) ▪ 2022 City of Chanhassen Reconstruction, Chanhassen, MN (Summer 2022) ▪ 2022 City of Chaska Street Reconstruction, Chaska, MN (Summer 2022) ▪ 2021 City of Chanhassen Street Reconstruction, Chanhassen, MN (Summer 2021) ▪ 2021 City of Chaska Street Reconstruction, Chaska, MN (Summer 2021) ▪ 2020 City of Chaska Street Reconstruction, Chaska, MN (Summer 2020) ▪ 2019 City of Chaska Street Reconstruction, Chaska, MN (Summer 2019) ▪ City of Chanhassen Lake Drive Improvements, Chanhassen, MN (Summer 2019) ▪ 2018 City of Chaska Street Reconstruction (Summer 2018) ▪ CSAH 83, Shakopee, MN (Summer 2016 to Fall 2017) ▪ TH 5 Reconstruction, Waconia, MN (Summer 2015 to Spring 2016) ▪ Vicksburg Lane Reconstruction, Plymouth, MN (Summer 2015 to Fall 20 Experience Industry: 20 years Braun Intertec: 4 years Education B.S., Agricultural Systems Technology, South Dakota State University Certifications International Code Council (ICC) Certified: Reinforced Concrete Special Inspector, Structural Masonry Special Inspector, Prestressed Concrete Special Inspector, Soils Special Inspector No. 1136593 American Concrete Institute (ACI) Concrete Field Testing Technician Grade I No. 00936257 MnDOT Certified: Aggregate Production Grading and Base Level I & II Bituminous Street Level I Bituminous Plant Inspector Level I Concrete Field Level I & II Concrete Plant Inspector Level I Bridge Construction Level I & II No. 07515 287 *While employed by another firm. Jacob D. Collins Project Manager Jacob joined Braun Intertec in 2022 as a project manager. Jacob has more than 20 years of experience with special inspections and testing. He now acts as a project manager for commercial and transportation projects. His extensive on-site testing and special inspection experience related to concrete, masonry, structural steel, fireproofing, soils as well as with MnDOT testing for transportation will help any project as project manager. Jacob also assists technicians on-site with training to help ensure the tests and observations are done properly in accordance with the project at hand. Project Experience ▪ Preska Hall – Mankato State University – Mankato, MN (2011-2012)* ▪ St. Cloud State University Integrated Science and Engineering Laboratory Facility (ISELF) – St. Cloud, MN (2012-2013)* ▪ Herb Brooks National Hockey Center – Entrance Expansion – St. Cloud, MN –2012-2013)* ▪ North Hennepin Community College – Bioscience and Health Career Center – Brooklyn Park, MN – (2013-2014)* ▪ Mall of America – Phase 1C Expansion – Bloomington, MN – (2014-2016)* ▪ Encore Apartments – Minneapolis, MN – (2015-2016)* ▪ University of Minnesota – Athletes Village – Minneapolis, MN (2016-2017)* ▪ Various Local Municipality Street and Utility Improvements – Anoka, Brooklyn Center, Coon Rapids, Maple Grove, Ramsey, Robbinsdale – (2017-2022)* ▪ North Loop Apartments – Project 1 – Minneapolis, MN (2018-2019)* ▪ 1701 Nicollet Avenue Apartments – NICO I – Minneapolis, MN (2019)* ▪ 2924 Bryant Avenue Apartments – Minneapolis, MN (2020)* ▪ Robbinsdale Water System Improvements – Water Treatment Facility – Robbinsdale, MN – (2020-2022)* ▪ Cityline Apartments – Minneapolis, MN – (2021-2022)* ▪ NICO II Apartments – Minneapolis, MN – (2021-2022)* Experience Industry: 20 years Braun Intertec: 4 years Education Civil Engineering University of Minnesota Certifications PTI Level 2 Unbonded PT Inspector ICC Structural Steel 1 Framing and Bolting ICC Structural Steel 2 Welding ICC Steel Reinforced Concrete ICC Fireproofing ICC Soils ACI Field Technician MnDOT Aggregate Production MnDOT Concrete Field MnDOT Concrete Plant MnDOT Bituminous Street MnDOT Bituminous Plant MnDOT Grading & Base Tester MnDOT Grading & Base Inspector 288 Jacob D. Collins Project Manager Page 2 *While employed by another firm. ▪ University of Minnesota – Microbial Cell Production Facility (MCPF) – St. Paul, MN – (2021-2022)* ▪ Farmington – 2022 Street and Utility Improvements – Farmington, MN (2022) ▪ St. Therese Senior Community – Corcoran, MN (2022-2024) ▪ Cottage Grove 100th Street, 105th Street, & Ideal Avenue Improvements – Cottage Grove, MN (2022-2023) ▪ Cottage Grove – South District Street and Utility Improvements – Cottage Grove, MN (2022-2023) ▪ Northfield 2022 NW Area Mill and Overlay Project – Northfield, MN (2022) ▪ Brooklyn Center – Woodbine Area Improvements / 53rd Avenue Mill & Overlay – SAP 109-116-003, SAP 109113-002 – Brooklyn Center, MN (2022) ▪ Crew Carwash – West St. Paul – West St. Paul, MN (2022) ▪ Edina Community Center 2022 Improvements – Edina, MN (2022) ▪ City of Cottage Grove – Glacial Valley Park Improvements (2022-2023) ▪ City of Carver – Ironwood Park Improvements – Carver, MN (2022-2023) ▪ Carver Elementary 2022 Addition – Carver, MN (2022-2023) ▪ Chanhassen – 2022 Lake Lucy Road Rehabilitation – SAP 253-102-001 – Chanhassen, MN (2022) ▪ Cottage Grove – E Point Douglas and Jamaica Avenue – SAP 180-110-014, Cottage Grove, MN (2023-2024) ▪ City of Brooklyn Center – 2023 Street and Utility Improvements – CP 23-01, CP 23-02, and CP 23-03 – Brooklyn Center, MN (2023) ▪ City of Maple Grove – Lakeview Knolls Site Pickleball – Maple Grove, MN (2023) ▪ Cottage Grove – Low Zone Water Treatment Plant – Cottage Grove, MN (2023-2025) ▪ Chanhassen – 2023 City Pavement Rehabilitation – CP 23-01 – Chanhassen, MN (2023) ▪ Ramsey – The COR Grading Improvements – Ramsey, MN (2023) ▪ Chanhassen – Galpin Boulevard Reconstruction – SAP 194-115-004 – Chanhassen, MN (2024-Current) ▪ TH 41 / Organic Recycling Facility Driveway Intersection Improvements – SP 7010-115 – Shakopee, MN (2024) ▪ County Road 5 Extension – SAP 043-605-016 SAP 043-609-019 – Winsted, MN (2024-2025) ▪ Brooklyn Center Orchard Lane East Improvements – Brooklyn Center, MN – (2024-2025) ▪ Cottage Grove - Intermediate Zone Water Treatment Plant – Cottage Grove, MN (2025-Current) ▪ Chanhassen – Crimson Bay Road Rehabilitation – SP 1002-123 – Chanhassen, MN (2025-Current) ▪ Northfield Mill Towns State Trail – Northfield, MN (2025-Current) ▪ Maple Grove The Commons and Waldon Shores Area Street Reconstruction – CP 2025-03 – Maple Grove, MN (2025) 289 Andrew M. Valerius Director, Senior Project Manager Andrew is a senior project manager who is responsible for overseeing the quality control and day-to-day operations of engineering technicians involved in roadway and bridge projects. Specializing in state-aid and federally-funded projects, he has extensive experience working with the Minnesota Department of Transportation’s (MnDOT) Schedule of Materials Control and MnDOT’s Standard Specifications for Construction. From past work he has a working relationship with MnDOT staff and is able to get timely responses to questions and resolve issues to keep projects on schedule. Internally, Andrew helps lead the Braun Intertec transportation construction materials testing group for the State of Minnesota. Andrew also helps organize and presents at many educational sessions that focus on MnDOT’s specifications and procedures. Andrew’s past experience providing field services, such as soil density testing, concrete testing, bituminous and concrete batch plant observations, and testing services has allowed him to gain the necessary knowledge of field testing practices and practical site experience to perform his senior project manager role at a high level to deliver quality results safely. Project Experience Andrew has worked on numerous local government projects including many MnDOT state-aid and federally funded projects while with Braun Intertec. He has provided material testing oversight and review for the following cities: ▪ City of Bloomington, Bloomington, MN Oversaw the Construction Material Testing for the City of Bloomington’s projects during the 2024, 2019, 2017, 2016, 2015, 2014, and 2011 construction season.* Also provided oversight of the Normandale Boulevard Reconstruction Project and the Old Cedar Avenue Roadway and Trail Improvement Project during the 2017 and 2018 Construction Seasons for the City of Bloomington. ▪ City of Lakeville, Lakeville, MN — Oversaw the Construction Material Testing for the City of Lakeville’s projects since 2009.* ▪ City of Apple Valley, Apple Valley, MN — Oversaw the Construction Material Testing for the City of Apple Valley’s projects since 2010.* ▪ City of Edina, Edina, MN Oversaw the Construction Material Testing for the City of Edina’s state aid/federal projects since 2009.* Experience Industry: 20 years Braun Intertec: 20 years Education B.S. Technology Assessment and Management St. Cloud State University Certifications MnDOT Certified #13631 Aggregate Production Concrete Field Tester & Inspector Grading & Base Tester & Inspector Concrete Plant Tester Bituminous Plant Tester Bituminous Street Inspector 290 Andrew M. Valerius Associate Director, Senior Project Manager Page 2 ▪ City of Chaska, Chaska, MN Oversaw the Construction Material Testing for the City of Chaska’s state aid/federal projects since 2009.* ▪ City of Plymouth, Plymouth, MN Oversaw the Construction Material Testing for various City of Plymouth’s state aid/ federal projects since 2009.* ▪ City of St. Paul, St. Paul, MN Oversaw the Construction Material Testing for the City of St. Paul’s projects during the 2009 construction season. Currently provides a supporting role to our John Rutherford our project manager.* ▪ City of St. Louis Park, St. Louis Park, MN -- Oversaw the Construction Material Testing for various City of St. Louis Park’s state aid/ federal projects since 2009.* ▪ City of Hastings, Hastings, MN Oversaw the Construction Material Testing for various City of Hastings’ projects since 2009.* ▪ MN State Government Shutdown, Various Cities, MN Provided project management for bituminous and concrete batch plant observations and testing for numerous cities and projects during the three week government shutdown in 2011.* MnDOT Project Experience Andrew has worked on numerous MnDOT projects while with Braun Intertec. He has provided materials testing oversight and review for the following major projects: ▪ TH 13/101, Savage, MN Schedule Materials Control Coordinator responsible for ensuring overall compliance with the Schedule of Materials Control, verify testing rates, and preparing year end materials certification for the project. Mr. Valerius coordinated with the QC/QA staff and also filled in for the Quality Manager/Construction Quality Manager at times during construction. ▪ I-35W Bridge over the Mississippi River, Minneapolis, MN Performed more than 1,000 hours of grading and base testing required for this major bridge replacement project. ▪ Central Corridor Light Rail Project, West and East Project, Minneapolis and St. Paul, MN Providing a supporting role to our Project Managers with guidance in MnDOT testing procedures and protocol. ▪ Advance Traffic Improvements Central Corridor Light Rail Project, Minneapolis, MN Oversaw construction materials testing on the Advance Traffic Improvements project which included many streets around the University of Minnesota. ▪ 4th Street Advanced Utilities, Central Corridor Light Rail Project, St. Paul, MN Provided Project Management oversight on the 4th Street Advanced Utility project on numerous streets in downtown St. Paul. 291 Charles Cadenhead, PE Vice President, Principal Engineer Charles brings more than 30 years of experience in the transportation industry and more than 26 years of experience in delivering construction projects for owners (MnDOT and Anoka County) and other clients. With every project, from design-bid-build to design-build Charles has been one of the primary individuals entrusted with quality oversight from all aspects. While working for MnDOT his primary focus was on the construction side of projects, however with his experience at Anoka County and as a consultant he has been involved in both design and construction quality management. At Anoka County he was involved as early as the right-of-way process and used his expertise in construction to help manage risks associated with the design of projects. Projects have been various in size from simple span bridges and mill and overlays to large design-build projects with over $400 million in construction. Charles brings years of contract administration and change management experience to bear in order to arrive at a successfully completed project. Project Experience For the past 8 years Charles has served as a Principal in Charge of municipal and state projects for Braun Intertec working with Project Managers and Technicians to provide engineering expertise and guidance. Below are larger projects in which Charles was heavily involved in the development and implementation of project construction, quality, and completion to meet the various requirements needed to satisfy high quality projects. TH494 Design Build | MnDOT Bloomington, Minnesota | 8/2024 - Present Quality Manager. MnDOT is reconstructing the I494 with additional lanes, bridges, retaining walls, movement of utilities and multiple staging efforts to reduce congestion on this heavily trafficked corridor. Charles is the Quality Manager for the project and oversees the design Quality Manager and Construction Quality Manager for this project. Charles was responsible for setting up the five quality manuals for the project and has worked with the designer, contractor, and owner to help manage the delivery of the project while meeting the project quality standards. 25% Commitment Experience MN Transportation: 30 years MnDOT: 15 years Design-Build projects: 4 years Anoka County: 5 years Design-Build projects: 2 years Private Sector: 14 years Design Build projects: 8 years Certifications Professional Engineer - Minnesota 292 Charles Cadenhead, PE Vice President, Principal Engineer Page 2 TH 52 Design Build | MnDOT Zumbrota, Minnesota | 7/2021 – 10/2023 Quality Manager. MnDOT reconstructed the Trunk Highway 52 mainline, approximately 20 miles, with new concrete pavement using the design-build project delivery method for the work. Charles was the Quality Manager for the project and oversees the design Quality Manager and Construction Quality Manager for this project. Charles was responsible for setting up the five quality manuals for the project and worked with the designer, contractor, and owner to help manage the delivery of the project while meeting the project quality standards. 25% Commitment I-94 Maple Grove to Rogers Design- Build | MnDOT Maple Grove, Minnesota | 9/2019 – 7/2022 Quality Manager. MnDOT is adding a lane to I-94 between Maple Grove and Rogers using the design-build project delivery method for the project. Charles is the Quality Manager for the project and oversees the Design Quality Manager and Construction Quality Manager for this project. He has set up the five quality manuals for the project and works with the designer, contractor, and owner to help the delivery of the project meeting the project quality standards. 25% Commitment TH 371 Design-Build | MnDOT Nisswa, Minnesota | 9/2015 – 11/2017 Consultant Project Manager/Change Management. The reroute of TH 371 by Pequot Lakes is MnDOT, District 3, is a design-build project to allow travelers to avoid traffic congestion in the town of Pequot Lakes while allowing local traffic to move easier in the community. Charles is the consultant team project manager, contract administrator for MnDOT and the construction quality manager for this project that was completed in the fall of 2017. 30% Commitment I-35W/4th Street Design-Build | MnDOT Consultant Manager/Contract Administrator | 5/2014 – 11/2016 This MnDOT project incorporated the realignment of an overpass bridge, additional lane construction, retaining walls and contaminated material removal management. Charles performed the duties of contract administrator and consultant project manager for the entirety of the project. This busy urban project necessitated tight time controls on the traffic impacts on the interstate system and design modifications from the initial proposed layout. Charles was heavily involved in the weekly construction meetings and helping staff new to the design-build project delivery method. Total cost control and negotiations on the project led to an increase in the bid amount by less than 1% on the overall project costs. 30% Commitment Elk Run Design-Build | MnDOT Oronoco, Minnesota | 5/2012 – 11/2012 Construction/Project Engineer. Charles served as a construction engineer for the final year of the $34 million design-build project along the TH 52 corridor. The project scope consisted of the construction of a new Diverging Diamond Interchange with frontage/service roads on TH 52 and realignment of approximately three miles of Olmsted CSAH 12. As an extension of MnDOT, Charles managed the field and office staff and was responsible for oversight of the team to ensure verification inspection and testing was conducted in accordance with established standards and procedures in the Quality Management Plan. 30% Commitment 293 550 Cleveland Avenue North | Saint Paul, MN 55114 Phone (651) 659-9001 | (800) 972-6364 | Fax (651) 659-1379 | teamAET.com | AA/EEO This document shall not be reproduced, except in full, without written approval from American Engineering Testing, Inc. April 10, 2026 City of Chanhassen 7700 Market Boulevard Chanhassen, MN 55317 Attn: Ben Phillips – Construction Manager bphillips@ChanhassenMN.gov RE: Quality Assurance Testing Proposal 25-02 Construction Materials Testing S.A.P. 194-123-002 City Project No. 25-02 Chanhassen, Minnesota AET Proposal No. P-0052164 Dear Mr. Phillips: Thank you for the opportunity to provide a proposal to perform testing services on the referenced project. This proposal has been prepared in response to your email request on April 7, 2026, and describes our understanding of the project, our anticipated scope of services, our unit rates, and an estimated total fee to perform these services. PROJECT INFORMATION The City of Chanhassen (the City) will be performing a street, utility, and pump house reconstruction project during the 2026 construction season. Construction is anticipated to begin May 1, 2026, and be completed October 30th, 2026. The project area will include Market Boulevard from TH 5 to Chan View and Chan View from Market Boulevard to Laredo Drive. The project will be funded with a mix of state aid and municipal funds. Plans and Specifications were prepared by Kimley Horn & Associates. We understand Construction Inspection and Contract Management of the project will be performed by the City or their authorized representative. PROJECT APPROACH During the construction improvements, AET will provide experienced MnDOT certified Engineering Technicians to perform sampling and material testing services in accordance with the 2025 State Aid for Local Transportation Schedule of Materials Control (2025 SALT SMC) and project specific testing requirements referenced in the Project Manual. For this project, Ryan 294 Quality Assurance Testing Proposal 25-02 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052164 Page 2 of 6 Schaefer will be AET’s contact. He can be reached at 651-603-6639 (office). AET requires a minimum of 24 hours’ notice of the need for Services. We understand that the City will contract with MnDOT Metro Inspections for bituminous and concrete plant monitoring. The City will coordinate with MnDOT Metro Inspections for plant inspections. SCOPE OF SERVICES Based on our review of the available plans and the scope of services requested in the RFP, our anticipated scope of services is outlined below. These services will be provided on an on-call basis, coordinated through authorized the City’s field personnel. Soils Sampling and Testing Our estimate of the sampling and testing to be performed on the grading and base items is based on the requirements of the RFP. AET will perform MnDOT Relative Density testing (Proctor) as well as in-place density and moisture testing on the following materials: • Utility Trench Backfill • Embankment Fill • Subgrade Preparation The MnDOT Dynamic Cone Penetrometer will be used to test compaction on the Class 5 Aggregate Base sections of the project following the MnDOT Penetration Index procedures in accordance with the 2025 SALT SMC. AET will perform the sampling of the soils, granular materials, and Class 5 Aggregate Base materials and transport the samples to our St. Paul, Minnesota laboratory. The City’s field personnel will update AET on the schedule of material placement, material sources (including changes in source), and changes in quantities. Full Depth Reclamation (FDR) AET will perform dynamic cone penetrometer (DCP) testing and moisture content testing of the full depth reclamation material along gradations in accordance with the 2025 SALT SMC. The frequency of these gradations for an FDR project are at the discretion of the Engineer. We assume the City’s Inspector will perform depth checks of the FDR material. 295 Quality Assurance Testing Proposal 25-02 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052164 Page 3 of 6 Precast Modular Block Retaining Wall Soil Testing During placement of fill behind the retaining wall, a Technician II will visit the site on an on-call basis to test the compaction of the fill. The technician will perform the following services: • In-place field density tests to evaluate the compaction of the fill soils using a nuclear density gauge. • MnDOT Proctor tests for each different type of fill encountered at the test locations. • Obtain samples of sand fill and/or aggregate base materials for sieve analysis tests and direct shear test (if requested). Bituminous Pavement Sampling and Testing When placement of the bituminous base and wear layers begins, an experienced Technician II will make site visits on an on-call basis to observe the placement and rolling of the bituminous layers and to perform testing of the bituminous. The technician will help to establish a rolling pattern each day by observing the number of passes the roller makes over the bituminous and measuring the density of the bituminous during the rolling to evaluate how many passes are needed to reach the maximum density. AET personnel will sample the bituminous paving mix, during each day of paving, and transport the samples to our St. Paul, Minnesota laboratory. Samples will be tested in our laboratory for MnDOT Gyratory Mix Properties as follows: • Gyratory Density (AASHTO T 312) MnDOT Modified • Rice Specific Gravity (ASTM D2041) • Asphalt Extraction and Aggregate Gradation (ASTM D2172 Method E-11) MnDOT Modified C137 and C117 • Fine Aggregate Angularity (AASHTO T 304, Method A, MnDOT 1206.5) • Coarse Aggregate Angularity, One Face (ASTM D5821) Concrete Sampling and Testing During the placement of concrete, AET will perform field testing consisting of slump, air content, temperature of the plastic concrete, and casting of cylinders for compression testing. The 2025 SALT SMC requires field testing for slump, air content, and temperature per every 100 cubic yards of each type of concrete placed each day. Compressive strength cylinders (1 set of 3 cylinders) are required once per every 300 cubic yards of each type of concrete placed each day; the cylinders will be retrieved the following day for curing and testing in our laboratory. The 296 Quality Assurance Testing Proposal 25-02 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052164 Page 4 of 6 3 cylinders are to be tested at 28-days. The RFP requests that we cast sets of 4 cylinders, with compressive strength testing as follows: 1 at 7 days, 3 at 28 days. We have assumed City’s field personnel will be compiling the concrete batch tickets, certificates of compliance, and AET’s field test results of the plastic concrete, which we will provide each day we are on-site performing testing services. REPORTING AET staff will prepare reports for the City to review. These reports will include the results of our field and laboratory testing as performed per the 2025 SALT SMC and testing frequencies referenced in the project documents. AET will complete the Preliminary Grading and Base Report and the Final Grading and Base Report, once provided with final project quantities. Daily field reports will also be prepared and made available upon request. In addition to these reports, once we receive final project quantities, AET will also complete a Final Summary Report of QA Testing to satisfy State Aid Requirements after receiving final project quantities, provide a roster of certified personnel performing testing on the project, as well as the completed IA report (if required). INDEPENDENT ASSURANCE Due to this project’s proximity to MnDOT’s Right of Way, MnDOT Independent Assurance (IA) may be required. AET staff will coordinate with IA to schedule audits of AET field and laboratory staff performing sampling and testing for this project, if required. Through the MnDOT Tester Inventory form, we will ensure all AET staff providing services to this project meet the requirements set forth by IA. COST-SAVINGS If all three projects are awarded, significant cost savings can be realized by consolidating the work under a single assigned technician. Because the construction schedules overlap, one technician can efficiently support all three projects during the same mobilization period, eliminating the need for multiple trip charges. This coordinated approach reduces travel and mobilization costs while maintaining consistent workmanship and project oversight, resulting in greater overall value for the client. 297 Quality Assurance Testing Proposal 25-02 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052164 Page 5 of 6 ESTIMATED FEES Our services will be provided on a unit cost basis according to the unit rates provided in the attached RFP Bid Form. Our monthly invoices will be determined by multiplying the number of personnel hours or tests by their respective unit rates. We have also estimated a total cost which we anticipate will be required to complete the previously described observations and testing services. Our estimated total cost is $82,235.00. We refer you to the attached Materials Testing Estimate as reference to how we arrived at this estimated cost. We caution that this is only an estimated cost. Often, variations in the overall cost of the services occur due to reasons beyond our control, such as weather delays, changes in the contractor’s schedule, unforeseen conditions, or retesting. These variations will affect the actual invoice totals, either increasing or decreasing our total costs for the project from those estimated in this proposal. If more time or tests are required, additional fees may be needed to complete the project testing services. If less time or tests are needed, a cost savings will be realized. We will not, however, exceed the estimated total cost for the project without first obtaining your authorization. TERMS AND CONDITIONS Our services will be performed per the Professional Services Agreement between the City of Chanhassen and AET, once agreed upon by both parties. ACCEPTANCE The City will provide AET with formal authorization prior to the commencement of AET’s services, which are outlined in this proposal. 298 Quality Assurance Testing Proposal 25-02 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052164 Page 6 of 6 GENERAL REMARKS AET appreciates the opportunity to provide this service for you and looks forward to working with you on this project. If you have any questions or need additional information, please contact me. Sincerely, American Engineering Testing Ryan S. Schaefer Robert D. Anderson Geologist II/Transportation Project Manager Manager of Alternative Delivery & Transportation rschaefer@teamAET.com randerson@teamAET.com 651-603-6639 612-685-3079 Attachments: RFP Bid Form 299 *EA indicates a set of 4 cylinders 40 13 Evaluation, Reporting, & Analysis Documentation LS 1 8 Soils & Granular Materials Testing Hours (ALL)HR 9C Concrete Testing & Casting Field-Cured Cylinders (Compressive Strength, Curing, & Handling) 12A Roll Pattern Testing Hours HR 1 Compaction Testing on Soils (Nuclear Density Test)EA 0 10 3 Proctor Sample & Testing (including Moisture Content) EA 5 30 15B Project Administration HR 20 Project Management & Oversight HR 25 12B Roll Pattern Testing Trip Charge EA 4 HR 15A $3,500 $__210.00______ $__95.00_______ 30 Bituminous Verification Sample Pickup and Testing Hours 11C Bituminous Verification Sample Pickup Trip Charge EA 4 ITEM NO.ITEM UNITS QUANTITY 14 Geotechnical and Pavement Evaluation Allowance Allowance 1 7 Soils & Granular Materials Testing Trip Charge (ALL)EA 9 11B 9B Concrete Testing Hours HR 45 9A Concrete Testing & Casting Cylinder Sets (Compressive Strength, Curing, & Handling)*EA 20 10A Concrete Testing and Cylinder Pickup Trip Charge EA 20 EA 20 Gradation Sample and Testing EA 4 6 DCP Tests for Aggregate Base (Class 5)EA 20 TOTAL 2 Compaction Testing on Granular Materials (Nuclear Density Test)EA 0 UNIT PRICE $__45.00_______ $__45.00_______ $__205.00______ 11A MnDOT Gyratory Bituminous Mix Properties Verification Testing & Rice Testing EA 4 $__80.00______ $__126.00______ $__690.00______ $__126.00______ $__80.00_______ $__126.00______ $__80.00_______ $__1,680.00____ $___1,600.00_______ $___3,780.00_______ $___2,760.00_______ $___1,260.00_______ $___320.00_________ $___3,780.00_______ $___320.00_________ $___1,680.00_______ $3,500 $___5,250.00_______ $___1,900.00_______ $___45,105.00______ 4 Topsoil Borrow Sample & Testing EA 0 10B Cylinder Pick Up Hours HR $__375.00______ $__150.00______ $__70.00_______ $__80.00_______ $__126.00______ $__180.00______ $__126.00______ $__45.00_______ TOTAL PRICE $_________________ $_________________ $___1,025.00_______ $_________________ $___600.00_________ $___1,400.00_______ $___720.00_________ $___5,040.00_______ $___3,600.00_______ $___5,670.00_______ $___900.00_________ 5 300 2/9/2026 Request for Proposals: Construction Materials Testing for Market Blvd Improvement Project No. #25-02 (SAP 194-123-002) I. INTRODUCTION The City of Chanhassen is issuing this Request for Proposals (RFP) for construction material testing services of approximately a half (0.5) miles of roadway reconstruction, rehabilitation and associated utility and stormwater improvements within the City. In general, the project includes materials testing and sampling, geotechnical evaluations, and recommendations of site conditions during construction. A. RFP Content. This RFP contains the following sections: I. Introduction II. Project Information III. Proposal Requirements B. Addenda/Clarifications. Any changes to this RFP will be made by written addendum. Verbal modification will not be binding. C. Pre-Contractual Expenses. The city will not be responsible for any pre-contractual expenses. Pre-contractual expenses are defined as expenses incurred by the Consultant in: 1. Preparing its proposal in response to this RFP 2. Submitting that proposal to the City of Chanhassen 3. Negotiating with the City of Chanhassen any matter related to that proposal; or 4. Any other expenses incurred by the Consultant prior to the date of execution of the Proposed Agreement. D. Contract Award 1. Consultant shall be required to enter into the City’s standard Professional Services Agreement (attached). 301 2/9/2026 2. Issuance of this RFP and receipt of proposals does not commit the City of Chanhassen to award a contract. The City of Chanhassen reserves the right to postpone opening for its own convenience, to accept or reject any or all proposals received in response to this RFP, to negotiate with other than the selected Consultant should negotiations with the elected be terminated, to negotiate with more than one Consultant simultaneously, or to cancel all or part of this RFP. E. Contact Person. The Consultant's contact for specific questions regarding information in this proposal is: Ben Phillips, (952) 227-1166, Bphillips@ChanhassenMN.gov. II. PROJECT INFORMATION A. Project Area and Identified Improvements. About a half (0.5) mile of roadway are proposed to be rehabilitated or reconstructed with this project. 0.4 Miles of Market Blvd lies north of Highway 5 and south of Chan View. 0.1 Miles (400 feet) of Chan View lies between Laredo Dr. to the east and Market Blvd to the west. The areas proposed for improvements are shown in the Figure below. A full Plan Set, Project Specifications, and Geotechnical Report for the project can be found here: https://chanhassen.sharefile.com/f/fo33f21a-2ac7-456c-9d3a-cbd0bd2c48ca 302 2/9/2026 B. Project Scope. The objective is to provide construction materials testing and any requested geotechnical evaluations and recommendations of site conditions during construction. Anticipated amounts of various tests needed on this project are detailed below. Please ensure to submit costs for the amounts listed as provided on the attached spreadsheet. 1. Soils and Aggregate Testing a. Soil and aggregation gradation, proctor, moisture, modified DCP testing on Class 5, aggregate quality testing, and specified density nuclear tests of trench backfill for utility work per city specifications: Submit costs for 90 compaction tests (nuclear density test), 11 proctor samples, 2 samples for topsoil borrow testing, 12 gradations (aggregate base, select granular, aggregate backfills), 30 DCP tests with moisture result on Class 5. b. Trip charges and technician time: Submit costs for 40 trips and 120 hours of technician time for soils and aggregate testing. 2. Concrete Testing a. Slump, air, temperature & 1 set of 4x8 cylinders per 100 CY per mix type per day (4 cylinders is 1 set): Submit costs for Compressive Strength, Curing, & Handling for 45 sets of cylinders and technician time of 125 hours. Submit total costs for Compressive Strength, Curing, & Handling for 10 field-cured cylinders (per cylinder). b. Concrete strength break testing and reports for cylinder sets (one 7-day and three 28-day) and field-cures (as directed by Engineer) cast: Submit costs for sample pickup time of 25 hours and 45 total trips for concrete testing and cylinder pickup. 3. Bituminous Testing a. MnDOT gyratory mix properties verification testing per day and Rice Testing per MnDOT 2360. (1 sample per day per mix type) 303 2/9/2026 Submit costs for 8 samples. Submit costs for 8 total trips and 20 hours of technician time for sample pickup and bituminous testing. b. Roll pattern establishment via Nuclear density testing (one per day per mix type). Submit total costs for 5 trips and 15 hours of technician time. 4. Geotechnical and Pavement Evaluation and Recommendations a. This would only be utilized if poor soils or unstable base is discovered during excavation or utility construction. A $3,500 allowance shall be built into the proposal for the consultant to use on an as needed basis for these services. 5. Project Management & Oversight Submit cost per attached spreadsheet per hour. 6. Project Administration (Evaluation, Reporting and Analysis Documentation) Consultant shall submit daily reports and other standard documents utilized to summarize daily activity on-site and observations on a routine basis as directed by Engineer. For example: If roll pattern testing is performed in preparation for paving operations – the tests, timing, location, and observations shall be detailed in a daily report. Final project report summarizing all testing completed. D. Project Schedule. The following is the anticipated project schedule: III. PROPOSAL A. Submission of Proposal. Submit the proposal electronically to: Start Construction Substantial Construction Complete May 1st, 2026 October 30th, 2026 304 2/9/2026 Ben Phillips Construction Manager City of Chanhassen Bphillips@ChanhassenMN.gov Proposals shall be received by 4:00 p.m., April 17th, 2026. Proposals received after this time will not be accepted. B. Proposal Format. Proposals shall be prepared two-sided on 8½" x 11" paper, with all text clear of binding. Use of 11" x 17” fold-out sheets for large tables, charts or diagrams is permissible but shall be limited. The proposal shall be clear and understandable when reproduced in black and white and/or in color. C. Copies. The Consultant shall submit one (1) electronic copy of the proposal bearing the Consultant's name and address, and clearly marked as following: "25-02 Construction Materials Testing” D. Letter of Transmittal. Include, at a minimum, the following: 1. Identification of the offering firm(s), including name, address and telephone number. 2. Acknowledgement of receipt of RFP addenda, if any. 3. Name, title, address, email address and telephone numbers of contact person during period of proposal evaluation. E. Consultant Team. Identify all team members and areas of responsibility. Resumes may be requested by City staff during proposal review. F. Understanding of the Project. The Consultant shall provide a brief, concise description that demonstrates the Consultant's understanding of the project and what needs to be done to successfully complete the work scope. G. Consultant Fee. Consultant shall provide the detailed cost breakdown as required in the spreadsheet format attached to the proposal. Any modifications must be approved the City prior to submission. A total not-to-exceed cost for all work shall be included. H. Exceptions and Deviations. The Consultant may include other services outside the scope of this proposal that the firm feels may be needed. The Consultant also may propose cost-saving items. Any exceptions to the requirements in this RFP, including the language in the contractual terms, must be included in the proposal. If the Consultant proposes changes to the scope of work, include a description, reason for the change and added/deducted engineering costs. Segregate all exceptions as a separate element of the proposal under the heading "Exceptions and Deviations". 305 TOTAL 2 Compaction Testing on Granular Materials (Nuclear Density Test) EA 15 $______________ $__________________ $__________________ 11A MnDOT Gyratory Bituminous Mix Properties Verification Testing & Rice Testing EA 8 $______________ $__________________ 4 Topsoil Borrow Sample & Testing EA 2 10B Cylinder Pick Up Hours HR $______________ $__________________ 5 Gradation Sample and Testing EA 12 $______________ $__________________ 6 DCP Tests for Aggregate Base (Class 5) EA 30 $______________ 9A Concrete Testing & Casting Cylinder Sets (Compressive Strength, Curing, & Handling) *EA 45 $______________ $__________________ 10A Concrete Testing and Cylinder Pickup Trip Charge EA 45 $______________ $__________________ ITEM NO. ITEM UNITS QUANTITY UNIT PRICE TOTAL PRICE $__________________ 14 Geotechnical and Pavement Evaluation Allowance Allowance 1 7 Soils & Granular Materials Testing Trip Charge (ALL) EA 40 $______________ $__________________ 11B $__________________9B Concrete Testing Hours HR 125 $______________ EA 10 $______________ $__________________ 12B Roll Pattern Testing Trip Charge EA 5 $______________ HR 15A $3,500 $3,500 15B Project Administration HR 30 $______________ $__________________ Project Management & Oversight HR 15 $______________ $__________________ 15 $______________ $__________________ Bituminous Verification Sample Pickup and Testing Hours 1 Compaction Testing on Soils (Nuclear Density Test) EA 75 $______________ $__________________ 20 $______________ $__________________ 11C Bituminous Verification Sample Pickup Trip Charge 3 Proctor Sample & Testing (including Moisture Content) EA 11 $______________ $__________________ 25 $______________ $__________________ EA 5 $______________ $__________________ *EA indicates a set of 4 cylinders 120 $______________ $__________________ 13 Evaluation, Reporting, & Analysis Documentation LS 1 $______________ $__________________ 8 Soils & Granular Materials Testing Hours (ALL) HR $__________________ 9C Concrete Testing & Casting Field-Cured Cylinders (Compressive Strength, Curing, & Handling) 12A Roll Pattern Testing Hours HR 306 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this ________ day of ___________________, 20__, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and __________________________________________ "Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for_____________________. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for quote – __________________ dated ______, 20___; C. Insurance Certificate; D. Consultant’s ______, 20___ proposal for___________________ (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of __________________ Dollars ($_____, inclusive of expenses. Services performed directly by Consultant shall be paid at an hourly rate in accordance with the Proposal, subject to the not to exceed fee. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 307 2 201749v1 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficien cies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each occurrence/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 308 3 201749v1 11. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 13. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 14. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 15. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 309 4 201749v1 16. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 17. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 18. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 19. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 20. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including pa yment for services performed or furnished to the date and time of termination. Dated: _______________, 20__. CITY OF CHANHASSEN BY: _____________________________________________ Elise Ryan, Mayor BY: _____________________________________________ Laurie Hokkanen, City Manager Dated: _______________, 20__. _______________________ BY: _____________________________________________ Its 310 City Council Item April 27, 2026 Item Resolution 2026-XX: Approve Construction Materials Testing Agreement for the 2026 Great Plains Blvd/Lake Drive East Rehabilitation Project No. 26-02 File No.ENG Project No. 26-02 CIP No. ST-012 Item No: D.16 Agenda Section CONSENT AGENDA Prepared By Ben Phillips, Engineering Technician III Reviewed By George Bender SUGGESTED ACTION "The Chanhassen City Council adopts a resolution awarding a consulting agreement for construction materials testing to Braun Intertec for the 2026 Great Plains Boulevard/Lake Drive East Rehabilitation Project No. 26-02" Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY The construction of the 2026 Great Plains Blvd/Lake Drive East Rehabilitation Project (City Project No. 26-02) has been awarded to Northwest Asphalt, Inc. The contractor has indicated it intends to begin construction in July 2026. Construction Materials Testing (CMT) is a required component of the Quality Control/Quality Assurance (QC/QA) process for roadway construction projects of this type, ensuring that all materials - including soils, aggregate base, concrete, and bituminous pavement - meet the applicable MnDOT specifications and project requirements. The Engineering Department solicited proposals from two qualified testing firms - Braun Intertec Corporation and American Engineering Testing, Inc. (AET) - consistent with the city's established 311 practice on prior pavement rehabilitation projects. BACKGROUND As part of the overall Pavement Management Program (PMP), the city annually plans to rehabilitate a section or sections of public streets across the city. The Five-Year Capital Improvement Plan (CIP) identifies the near-term streets to be rehabilitated. Key dates and items relative to this project: On May 16, 2025, the Engineering Department released an RFP for design and construction services for the 26-02 project. On June 20, 2025, the Engineering Department released an RFP for geotechnical services for the 26-02 project. On June 23, 2025, the City Council approved a Professional Services Agreement with I&S Group, Inc. (ISG) for design and construction services for the project. On July 14, 2025, the City Council approved a Professional Services Agreement with Braun Intertec for geotechnical exploration and engineering services in association with the 26-02 design contract. On October 27, 2025, the City Council called for a Public Hearing to be held regarding the proposed improvements on November 10, 2025. On October 30, 2025, the Engineering Department hosted a public Open House meeting at City Hall to discuss the project and respond to questions with the impacted properties. Approximately 27 residents attended and 2 comment cards were received. An additional 14 responses were received in follow-up to the survey that was distributed to the area. On November 10, 2025, the City Council accepted the feasibility study, conducted a Public Hearing regarding the improvements, and authorized the preparation of Plans and Specifications. On January 26, 2026, the City Council accepted the plans and specifications and authorized the advertisement for bids for the project. On February 20, 2026, ISG and the Engineering Department hosted a bid opening. On March 9, 2026, the City Council called for a Public Hearing regarding the proposed assessments for the 26-02 project to be held on March 23, 2026. On March 10, 2026, the Engineering Department hosted a second public open house for the project in the training room at City Hall. 11 residents attended and no comment cards were received. 2 other resident inquiries were received and followed-up upon after the open house. Lastly, additional follow-up occurred with both the American Legion and Discovery United Methodist Church to answer additional questions and follow-up with their letter to the City received February 23, 2026. On March 23, 2026, the City Council accepted the bids, awarding a construction contract and 312 adopted the final assessment roll for the 26-02 project. On April 7, 2026, the Engineering Department distributed Request for Quotations (RFQs) for construction material testing (CMT) professional services for the 26-02 project. On April 17, 2026, the Engineering Department received two proposals in response to the RFQ for construction material testing. DISCUSSION The Engineering Department solicited proposals from American Engineering Testing, Inc. and Braun Intertec Corporation for the construction materials testing and associated professional engineering services required to facilitate the construction of the project. Both firms submitted competitive proposals. The proposals were reviewed to compare the proposed work scopes, testing rates, and estimated costs. This also included review of the level of effort and clarity of each firm's proposal in meeting the specifications of the project. As necessary, quantity and/or testing rate amounts in the proposals were adjusted to facilitate a fair comparison between the proposals. The proposals were analyzed and the results are as follows: Braun Intertec - $41,258.00 American Engineering Testing - $47,205.00 Both firms have the required certified personnel and are capable of completing the required work. Both firms have successfully completed work for the city on past projects. Staff recommends Braun Intertec be selected for this work. Braun Intertec's proposal is on a unit-cost basis and billed per personnel hours and/or testing rates provided in their proposal. Staff recommends an agreement amount of $44,000.00 be awarded to allow for minor adjustments to the testing quantities without the need for processing a contract modification. Braun will submit monthly invoices that staff will review before processing. Staff will review the invoices for accuracy and conformance with the contract. BUDGET Funding for the 2026 Great Plains Boulevard/Lake Drive East Rehabilitation Project No. 26-02 will be through the PMP fund budget established by the city for the 26-02 project. RECOMMENDATION Staff recommends the City Council approve entering into the contract with Braun Intertec for construction material testing professional services. ATTACHMENTS Resolution 2026-XX Award Materials Testing Contract City of Chanhassen Braun Agreement 26-02 AET 26-02 Construction Materials Testing Proposal 313 Proposal - Lake Drive E Rehabilitation Project 26-02 CMT RFP Final 314 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 27, 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION AWARDING A CONSULTANT AGREEMENT FOR CONSTRUCTION MATERIALS TESTING ON THE 2026 GREAT PLAINS/LAKE DRIVE EAST REHABILITATION PROJECT NO. 26-02 WHEREAS, pursuant to a request for proposals for construction material testing for the 2026 Great Plains/Lake Drive East Rehabilitation Project No. 26-02, two proposals were received and evaluated that complied with the request for proposal: Bidder Quote Amount Braun Intertec $41,258.00 American Engineering and Testing $47,205.00 WHEREAS, it was evaluated by staff that Braun Intertec had the lowest responsible quote and best met the scope of the request for proposals. A consultant contract amount of $44,000.00 is recommended to be awarded to allow for minor revisions to unit price testing quantities during construction to facilitate not needing to approve minor contract revisions. NOW, THEREFORE, BE IT RESOLVED by the Chanhassen City Council that the Mayor and City Manager are hereby authorized and directed to enter into a consulting agreement with Braun Intertec in the name of the City of Chanhassen for the construction materials testing professional services for the 2026 Great Plains/Lake Drive East Rehabilitation Project No. 26-02 according to the proposal and the plans and specifications on file in the office of the City Engineer. PASSED AND ADOPTED by the Chanhassen City Council on this 27th day of April 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 315 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this 27th day of April, 2026, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and BRAUN INTERTEC CORPORATION ("Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for construction materials testing and associated engineering services. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for quote – Construction Materials Testing Services for #26-02, Distributed April 7th, 2026; C. Insurance Certificate; D. Consultant’s April 20th, 2026, proposal for $41,258.00 (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of Forty-four Thousand Dollars ($44,000.00), inclusive of expenses. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. Notwithstanding the foregoing, the information is not intended or represented to be suitable for reuse by the City or others on extensions or modifications of the services or on any other project. Any such reuse without written verification or adaptation by Consultant for the specific purpose intended will be at the City’s sole 316 2 201749v1 risk, and the City agrees to hold Consultant harmless for all costs and liability arising out of such unauthorized use. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances, at the same time and in the same locality. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, to the extent caused by the negligent execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each claim/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. ALLOCATION OF LIABILITY. Notwithstanding anything to the contrary, in no event will Consultant be liable for any consequential, indirect, incidental, special, exemplary, punitive, or enhanced damages, and in no event will Consultant’s aggregate liability arising out of this Agreement, or the services performed exceed the amount of the applicable insurance limits set forth in the Agreement. 317 3 201749v1 11. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 12. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 13. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 14. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 15. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 318 4 201749v1 16. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyr ight in connection with the services agreed to be performed under the Contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 17. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 18. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 19. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 20. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 21. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including payment for services performed or furnished to the date and time of termination. Dated: CITY OF CHANHASSEN BY: Elise Ryan, Mayor BY: Laurie Hokkanen, City Manager 319 5 201749v1 Dated: BRAUN INTERTEC CORPORATION BY: Its 320 550 Cleveland Avenue North | Saint Paul, MN 55114 Phone (651) 659-9001 | (800) 972-6364 | Fax (651) 659-1379 | teamAET.com | AA/EEO This document shall not be reproduced, except in full, without written approval from American Engineering Testing, Inc. April 10, 2026 City of Chanhassen 7700 Market Boulevard Chanhassen, MN 55317 Attn: Ben Phillips – Construction Manager bphillips@ChanhassenMN.gov RE: Quality Assurance Testing Proposal 26-02 Construction Materials Testing S.A.P. Nos. 194-110-006 & 194-119-002 City Project No. 26-02 Chanhassen, Minnesota AET Proposal No. P-0052167 Dear Mr. Phillips: Thank you for the opportunity to provide a proposal to perform testing services on the referenced project. This proposal has been prepared in response to your email request on April 7, 2026, and describes our understanding of the project, our anticipated scope of services, our unit rates, and an estimated total fee to perform these services. PROJECT INFORMATION The City of Chanhassen (the City) will be performing a street improvements project during the 2026 construction season. Construction is anticipated to begin May 2026 and be completed July 1, 2026. The project area will include Lake Drive East from Great Plains Boulevard until just west of Dakota Avenue and Great Plans Boulevard from TH 5 to just south of Lake Drive East. The project will be funded with a mix of state aid and municipal funds. Plans and Specifications were prepared by ISG, Inc. We understand Construction Inspection and Contract Management of the project will be performed by the City or their authorized representative. PROJECT APPROACH During the construction improvements, AET will provide experienced MnDOT certified Engineering Technicians to perform sampling and material testing services in accordance with the 2025 State Aid for Local Transportation Schedule of Materials Control (2025 SALT SMC) and project specific testing requirements referenced in the Project Manual. For this project, Ryan 321 Quality Assurance Testing Proposal 26-02 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052167 Page 2 of 5 Schaefer will be AET’s contact. He can be reached at 651-603-6639 (office). AET requires a minimum of 24 hours’ notice of the need for Services. We understand that the City will contract with MnDOT Metro Inspections for bituminous and concrete plant monitoring. The City will coordinate with MnDOT Metro Inspections for plant inspections. SCOPE OF SERVICES Based on our review of the available plans and the scope of services requested in the RFP, our anticipated scope of services is outlined below. These services will be provided on an on-call basis, coordinated through authorized the City’s field personnel. Soils Sampling and Testing Based upon the information provided to us at the time of this proposal, we have assumed no new embankments will be constructed, as well as no improvements to existing utilities that will require open cut trenches and soil testing to be performed. The MnDOT Dynamic Cone Penetrometer will be used to test compaction on Class 5 Aggregate Base sections of the project following the MnDOT Penetration Index procedures in accordance with the 2025 SALT SMC. AET will perform the sampling of the Class 5 Aggregate Base materials and transport the samples to our St. Paul, Minnesota laboratory. The City’s field personnel will update AET on the schedule of material placement, material sources (including changes in source), and changes in quantities. Full Depth Reclamation (FDR) AET will perform dynamic cone penetrometer (DCP) testing and moisture content testing of the full depth reclamation material along gradations in accordance with the 2025 SALT SMC. The frequency of these gradations for an FDR project are at the discretion of the Engineer. We assume the City’s Inspector will perform depth checks of the FDR material. Bituminous Pavement Sampling and Testing When placement of the bituminous base and wear layers begins, an experienced Technician II will make site visits on an on-call basis to observe the placement and rolling of the bituminous layers and to perform testing of the bituminous. The technician will help to establish a rolling pattern each day by observing the number of passes the roller makes over the bituminous and 322 Quality Assurance Testing Proposal 26-02 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052167 Page 3 of 5 measuring the density of the bituminous during the rolling to evaluate how many passes are needed to reach the maximum density. AET personnel will sample the bituminous paving mix, during each day of paving, and transport the samples to our St. Paul, Minnesota laboratory. Samples will be tested in our laboratory for MnDOT Gyratory Mix Properties as follows: • Gyratory Density (AASHTO T 312) MnDOT Modified • Rice Specific Gravity (ASTM D2041) • Asphalt Extraction and Aggregate Gradation (ASTM D2172 Method E-11) MnDOT Modified C137 and C117 • Fine Aggregate Angularity (AASHTO T 304, Method A, MnDOT 1206.5) • Coarse Aggregate Angularity, One Face (ASTM D5821) Concrete Sampling and Testing During the placement of concrete, AET will perform field testing consisting of slump, air content, temperature of the plastic concrete, and casting of cylinders for compression testing. The 2025 SALT SMC requires field testing for slump, air content, and temperature per every 100 cubic yards of each type of concrete placed each day. Compressive strength cylinders (1 set of 3 cylinders) are required once per every 300 cubic yards of each type of concrete placed each day; the cylinders will be retrieved the following day for curing and testing in our laboratory. The 3 cylinders are to be tested at 28-days. The RFP requests that we cast sets of 4 cylinders, with compressive strength testing as follows: 1 at 7 days, 3 at 28 days. We have assumed City’s field personnel will be compiling the concrete batch tickets, certificates of compliance, and AET’s field test results of the plastic concrete, which we will provide each day we are on-site performing testing services. REPORTING AET staff will prepare reports for the City to review. These reports will include the results of our field and laboratory testing as performed per the 2025 SALT SMC and testing frequencies referenced in the project documents. AET will complete the Preliminary Grading and Base Report and the Final Grading and Base Report, once provided with final project quantities. Daily field reports will also be prepared and made available upon request. In addition to these reports, once we receive final project quantities, AET will also complete a Final Summary Report of QA Testing to satisfy State Aid Requirements after receiving final project quantities, provide a roster 323 Quality Assurance Testing Proposal 26-02 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052167 Page 4 of 5 of certified personnel performing testing on the project, as well as the completed IA report (if required). INDEPENDENT ASSURANCE Due to this project’s proximity to MnDOT’s Right of Way, MnDOT Independent Assurance (IA) may be required. AET staff will coordinate with IA to schedule audits of AET field and laboratory staff performing sampling and testing for this project, if required. Through the MnDOT Tester Inventory form, we will ensure all AET staff providing services to this project meet the requirements set forth by IA. COST-SAVINGS If all three projects are awarded, significant cost savings can be realized by consolidating the work under a single assigned technician. Because the construction schedules overlap, one technician can efficiently support all three projects during the same mobilization period, eliminating the need for multiple trip charges. This coordinated approach reduces travel and mobilization costs while maintaining consistent workmanship and project oversight, resulting in greater overall value for the client. ESTIMATED FEES Our services will be provided on a unit cost basis according to the unit rates provided in the attached RFP Bid Form. Our monthly invoices will be determined by multiplying the number of personnel hours or tests by their respective unit rates. We have also estimated a total cost which we anticipate will be required to complete the previously described observations and testing services. Our estimated total cost is $45,105.00. We refer you to the attached Materials Testing Estimate as reference to how we arrived at this estimated cost. We caution that this is only an estimated cost. Often, variations in the overall cost of the services occur due to reasons beyond our control, such as weather delays, changes in the contractor’s schedule, unforeseen conditions, or retesting. These variations will affect the actual invoice totals, either increasing or decreasing our total costs for the project from those estimated in this proposal. If more time or tests are required, additional fees may be needed to complete the project testing services. If less time or tests are needed, a cost savings will be realized. We will not, however, exceed the estimated total cost for the project without first obtaining your authorization. 324 Quality Assurance Testing Proposal 26-02 Construction Materials Testing, Chanhassen, MN April 10, 2026 AET Proposal No. P-0052167 Page 5 of 5 TERMS AND CONDITIONS Our services will be performed per the Professional Services Agreement between the City of Chanhassen and AET, once agreed upon by both parties. ACCEPTANCE The City will provide AET with formal authorization prior to the commencement of AET’s services, which are outlined in this proposal. GENERAL REMARKS AET appreciates the opportunity to provide this service for you and looks forward to working with you on this project. If you have any questions or need additional information, please contact me. Sincerely, American Engineering Testing Ryan S. Schaefer Robert D. Anderson Geologist II/Transportation Project Manager Manager of Alternative Delivery & Transportation rschaefer@teamAET.com randerson@teamAET.com 651-603-6639 612-685-3079 Attachments: RFP Bid Form 325 *EA indicates a set of 4 cylinders 40 13 Evaluation, Reporting, & Analysis Documentation LS 1 8 Soils & Granular Materials Testing Hours (ALL)HR 9C Concrete Testing & Casting Field-Cured Cylinders (Compressive Strength, Curing, & Handling) 12A Roll Pattern Testing Hours HR 1 Compaction Testing on Soils (Nuclear Density Test)EA 0 10 3 Proctor Sample & Testing (including Moisture Content) EA 5 30 15B Project Administration HR 20 Project Management & Oversight HR 25 12B Roll Pattern Testing Trip Charge EA 4 HR 15A $3,500 $__210.00______ $__95.00_______ 30 Bituminous Verification Sample Pickup and Testing Hours 11C Bituminous Verification Sample Pickup Trip Charge EA 4 ITEM NO.ITEM UNITS QUANTITY 14 Geotechnical and Pavement Evaluation Allowance Allowance 1 7 Soils & Granular Materials Testing Trip Charge (ALL)EA 9 11B 9B Concrete Testing Hours HR 45 9A Concrete Testing & Casting Cylinder Sets (Compressive Strength, Curing, & Handling)*EA 20 10A Concrete Testing and Cylinder Pickup Trip Charge EA 20 EA 20 Gradation Sample and Testing EA 4 6 DCP Tests for Aggregate Base (Class 5)EA 20 TOTAL 2 Compaction Testing on Granular Materials (Nuclear Density Test)EA 0 UNIT PRICE $__45.00_______ $__45.00_______ $__205.00______ 11A MnDOT Gyratory Bituminous Mix Properties Verification Testing & Rice Testing EA 4 $__80.00______ $__126.00______ $__690.00______ $__126.00______ $__80.00_______ $__126.00______ $__80.00_______ $__1,680.00____ $___1,600.00_______ $___3,780.00_______ $___2,760.00_______ $___1,260.00_______ $___320.00_________ $___3,780.00_______ $___320.00_________ $___1,680.00_______ $3,500 $___5,250.00_______ $___1,900.00_______ $___45,105.00______ 4 Topsoil Borrow Sample & Testing EA 0 10B Cylinder Pick Up Hours HR $__375.00______ $__150.00______ $__70.00_______ $__80.00_______ $__126.00______ $__180.00______ $__126.00______ $__45.00_______ TOTAL PRICE $_________________ $_________________ $___1,025.00_______ $_________________ $___600.00_________ $___1,400.00_______ $___720.00_________ $___5,040.00_______ $___3,600.00_______ $___5,670.00_______ $___900.00_________ 5 326 April 20, 2026 Proposal 10010907_001 Ben Phillips City of Chanhassen 7700 Market Blvd Chanhassen, MN 55317 Re: Proposal for Construction Materials Testing Services Lake Drive E Rehabilitation Project SAP 194-119-002, SAP 194-110-006, City Project 26-02 Chanhassen, Minnesota Dear Mr. Phillips: Braun Intertec Corporation (Braun Intertec) submits this proposal to provide construction materials testing services for the Lake Drive E Rehabilitation Project in Chanhassen, Minnesota. Our Understanding of Project We understand that this project will primarily involve reclamation of existing roadways. Roadways involved in this project include Lake Drive East and Great Plains Boulevard. Construction will include reclaiming existing surfaced, reclaimed aggregate base, new concrete curb and gutter, sidewalk, and driveways along with a new bituminous pavement. Incidental improvements to the utilities will also be part of this project. This is a City of Chanhassen project with state-aid funding. Projects that are constructed with state-aid funding are required to perform Quality Control and Quality Assurance (QC/QA) testing in accordance with the Minnesota Department of Transportation’s (MnDOT’s) 2025 Standard Specifications for Construction and MnDOT’s Schedule of Materials Control. This project is using MnDOT’s 2025 State Aid for Local Transportation (SALT) Schedule of Materials Control. Personnel with MnDOT certifications must complete the monitoring and testing. Braun Intertec will perform the QA field testing on the project as listed in our scope of services and as shown on our attached cost estimate table. The contractor will be responsible for performing all of the required QC testing and submitting the documentation upon completion of the project. An audit of the project could be conducted upon completion. The audit may include reviewing tests and paperwork provided by your QC/QA representative. Available Project Information This proposal was prepared using the following documents and information. ▪ Project plans prepared by ISG, dated January 29, 2026. ▪ City of Chanhassen Standard Specifications and Detail Plates prepared by the City of Chanhassen, dated January 22, 2026. 327 City of Chanhassen Lake Drive E Rehabilitation Project Proposal 10010907_001 April 20, 2026 Braun Intertec Page 2 ▪ Request for Proposals provided by the City of Chanhassen, dated February 9 ,2026 and provided to Braun Intertec via email on April 7, 2026. ▪ Conversations with Ben Phillips (City of Chanhassen) confirming requested testing quantities regarding compaction testing and soils trip charges. Braun Intertec Project Team For this project we propose using Tom Loosbrock as a lead senior technician and Jacob Collins as our project manager. Tom and Jacob will be supported by director, Andrew Valerius, and principal engineer, Charles Cadenhead. The project team has provided services on many City of Chanhassen projects in the past including: Crimson Bay Street Improvements, Galpin Boulevard, 2024 Street Reconstruction, 2023 Mill and Overlay Project, Orchard Lane Area Improvements, Minnewashta Manor Neighborhood Street Reconstruction, and the 2023, 2022, 2017, and 2016 Street Resurfacing and Rehabilitation Projects and state-aid projects Lake Lucy Road Rehabilitation, Lake Drive Improvements, and Minnewashta Parkway Rehabilitation. Tom Loosbrock is a senior engineering assistant with more than 20 years of experience in materials testing and is responsible for field operation coordinating, general project management; soil density testing using nuclear and sand cone methods; soil excavation observations; DCP testing, concrete testing and bituminous testing. Tom has worked on many state-aid projects throughout his career and is familiar with MnDOT specification, and the schedule of materials control. Jacob Collins is a project manager and will be the main point of contact for this project. Jacob has more than 18 years of experience with special inspections and testing. His extensive on-site testing and special inspection experience related to concrete, masonry, structural steel, fireproofing, soils as well as MnDOT testing for transportation will help any project as project manager. Jacob also assists technicians on-site with training to help ensure the tests and observations are done properly in accordance with the project at hand. Andrew Valerius is a senior project manager with more than 20 years experience who is responsible for overseeing the quality control and day-to-day operations of engineering technicians involved in roadway and bridge projects, especially for state-aid and federally-funded projects. He has extensive experience working with the Minnesota Department of Transportation’s (MnDOT) Schedule of Materials Control and MnDOT’s Standard Specifications for Construction. Internally, he help leads the Braun Intertec transportation construction materials testing group for the State of Minnesota. Andrew also helps organize and presents at many educational sessions that focus on MnDOT’s specifications and procedures. Andrew’s past experience providing field services, such as soil density testing, concrete testing, bituminous and concrete batch plant observations, and testing services has allowed him to gain the necessary knowledge of field testing practices and practical site experience to perform his senior project manager role at a high level and deliver quality results safely. Charles Cadenhead has more than 30 years of experience in the transportation industry and more than 25 years’ of experience in delivering construction projects for owners (MnDOT and Anoka County) and other clients. With every project, from design-bid-build to design-build Charles has been one of the primary individuals 328 City of Chanhassen Lake Drive E Rehabilitation Project Proposal 10010907_001 April 20, 2026 Braun Intertec Page 3 entrusted with quality oversight from all aspects. While working for MnDOT his primary focus was on the construction side of projects, however with his experience at Anoka County and as a consultant he has been involved in both design and construction quality management. At Anoka County he was involved as early as the right-of-way process and used his expertise in construction to help manage risks associated with the design of projects. Projects have been various in size from simple span bridges and mill and overlays to large design-build projects with over $200 million in construction. Charles brings years of contract administration and change management experience to bear in order to arrive at a successfully completed project. Resumes for Tom Loosbrock, Jacob Collins, Andrew Valerius, and Charles Cadenhead are attached to highlight their expertise and experience with projects similar to this one. Braun Intertec Project Personnel For this project, we will provide technicians that are MnDOT certified in each specialized field. For the proposed scope of services, our staff will have the following certifications: ▪ Aggregate Production ▪ Grading & Base Tester ▪ Concrete Field Tester ▪ Bituminous Street Inspector ▪ Bituminous Plant Tester ▪ MnDOT or ACI Strength Testing Accredited Laboratory In the 2025 SALT Schedule of Material Control, which is part of this project’s testing requirements, MnDOT requires laboratories performing acceptance tests for payment to be accredited by the AASHTO Resource (formerly AASHTO Materials Reference Laboratory [AMRL]) for all test procedures performed. Braun Intertec is one of the few independent testing companies that is accredited in the metro area. With Braun Intertec’s Metro Material Laboratory typically operating 24 hours a day, laboratory test results are delivered in a timely manner. Scope of Services Testing services will be performed on an on-call, as-needed basis as requested and scheduled by you or your on-site project personnel. Based on our understanding of the project, we propose the following services. 329 City of Chanhassen Lake Drive E Rehabilitation Project Proposal 10010907_001 April 20, 2026 Braun Intertec Page 4 Soil Related Services ▪ Perform nuclear gauge density tests on utility backfill and sub-grade preparation materials. ▪ Perform Full Depth Reclaim Dynamic Cone Penetrometer (DCP) tests on full depth reclaim (FDR) materials. ▪ Perform moisture content tests at time of compaction on full depth reclaim, sub-grade preparation and utility backfill. ▪ Perform gradation tests on full depth reclaim materials. ▪ Perform laboratory standard Proctor tests on backfill and fill materials. ▪ Prepare the preliminary and final grading and base report according to MnDOT Specifications. Concrete Field Testing Related Services ▪ Sample and test the plastic concrete for slump, air content, and temperature prior to placement. We assume that we will be able to appropriately dispose of excess concrete (and associated wash water) on site at no additional cost to us. ▪ Prepare 4-inch by 8-inch cylinders for compressive strength testing. A set of four cylinders will be cast, with one tested at 7 days and three at 28 days for each set cast. Per the request for proposal, we have included 20 field cure cylinders. If additional field cure cylinders are requested, each additional cylinder will be charged at the unit price listed in our cost estimate. ▪ Laboratory compressive strength testing of cylinders. Bituminous Related Services ▪ Collect verification samples per MnDOT’s 2360 specification and randomly select one sample per day per mix to run quality assurance tests on. Perform quality assurance tests on the verification samples which include the following tests: Rice specific gravity, asphalt content, extracted aggregate gradation, gyratory density, coarse aggregate angularity, and fine aggregate angularity. Compare agency test results with contractor’s test results for compliance with MnDOT 2360 specification. ▪ Measure the in-place wet density of the fresh bituminous with a nuclear density gauge to observe and document the contractor’s roll pattern (ordinary compaction). Reporting and Project Management Test results will be issued weekly for the project as the various tasks are performed. If, at any time, there are failing tests which do not appear to be in accordance with the plans and specifications or MnDOT’s Schedule of Materials Control, we will notify the engineer’s representative and any others that we are directed to notify. Before the final project closeout, we will issue a final report. The report will include the following: ▪ Braun Intertec technician roster for technicians that conducted testing on the project. 330 City of Chanhassen Lake Drive E Rehabilitation Project Proposal 10010907_001 April 20, 2026 Braun Intertec Page 5 ▪ Completed MnDOT Materials Certification Exceptions Summary for items tested by Braun Intertec. ▪ Completed Preliminary and Final Grading and Base Report. ▪ Moisture, Density, DCP, Proctor, and Gradation tests. ▪ Concrete compressive strength results. ▪ Bituminous verification test results. ▪ Bituminous contractor’s summary sheets. ▪ Copies of concrete and bituminous plant certifications. Basis of Scope of Work The costs associated with the proposed scope of services were estimated using the following assumptions. If the construction schedule is modified or the contractor completes the various phases of the project at different frequencies or durations than shown in this proposal, we may need to adjust the overall cost accordingly. The scope of work and number of trips required to perform these services are as shown in the attached table. Notable assumptions in developing our estimate include: ▪ We were provided estimated quantities of tests, hours, and quantities to use for the purposes of this estimate. These numbers were provided within the Request for Proposal. ▪ We understand it will take 15 trips to complete the nuclear density gauge, dynamic cone penetration, and soil sampling on this project. ▪ We understand that 20 sets of concrete tests will be required to complete the project. We understand that 20 additional field-cured cylinders may be requested for the project. ▪ We understand that bituminous paving requiring sampling and testing will be completed in 4 days for this project. ▪ We assume MnDOT Metro Inspections will perform concrete batch plant monitoring and testing for this project. ▪ We assume MnDOT Metro Inspections will perform bituminous plant monitoring and testing for this project. ▪ We assume your full-time on-site construction observer will observe the test rolling for this project. ▪ We assume the project engineer of record will review and approve the contractor’s quality control submittals and test results. ▪ You, or others you may designate, will provide us with current and approved plans and specifications for the project. Modification to these plans must also be sent to us so we can review their incorporation into the work. 331 City of Chanhassen Lake Drive E Rehabilitation Project Proposal 10010907_001 April 20, 2026 Braun Intertec Page 6 ▪ We will require a minimum of 24 hours’ notice for scheduling inspections for a specific time. Shorter than 24 hours’ notice may impact our ability to perform the requested services, and the associated impacts will be the responsibility of others. If the work is completed at different rates than described above, this proposal should be revised. Cost and Invoicing We will furnish the services described herein for an estimated fee of $41,258. Our estimated costs are based on industry averages for construction production. Depending on the contractor’s performance, our costs may be significantly reduced or slightly higher than estimated. A tabulation showing our estimated hourly and/or unit rates associated with our proposed scope of services is also attached. The actual cost of our services will be based on the actual units or hours expended to meet the requirements of the project documents. This cost estimate was developed with the understanding that the scope of services defined herein will be required and requested during our normal work hours of 6:00 a.m. to 4:00 p.m., Monday through Friday. Services that we are asked to provide to meet the project requirements or the contractor’s construction schedule outside our normal business hours will be invoiced using an overtime rate factor. The factor for services provided outside our normal work hours or on Saturday will be 1.25 times the listed hourly rate for the service provided. The factor for services provided on Sunday or legal holidays will be 1.5 times the listed hourly rate for the service provided. We have not included premiums for overtime in our cost estimate; however, we recommend that allowances and contingencies be made for overtime charges based on conversations with the contractor. You will be billed only for services provided on a time and materials basis. Because our services are directly controlled by the schedule and performance of others, the actual cost may vary from our estimate. It is difficult to project all of the services and the quantity of services that may be required for any project. If services are required that are not discussed above, we will provide them at the rates shown in the attached table or, if not shown, at our current Schedule of Charges. We will invoice you on a monthly basis. 332 City of Chanhassen Lake Drive E Rehabilitation Project Proposal 10010907_001 April 20, 2026 Braun Intertec Page 7 General Remarks We will be happy to meet with you to discuss our scope of services further and clarify the various scope components. We appreciate the opportunity to present this proposal to you. After review this proposal, if selected, we will attach our estimate to the city provided terms and conditions after legal review within Braun Intertec and the City of Chanhassen. Braun Intertec will not release any written reports until we have received a signed agreement. We appreciate the opportunity to present this proposal to you. We will be happy to meet with you to discuss our proposed scope of services further and clarify the various scope components. Braun Intertec will not release any written reports until we have received a signed agreement. Ordering services from Braun Intertec constitutes acceptance of the terms of this proposal. To have questions answered or schedule a time to meet and discuss our approach to this project further, please contact Jacob Collins at 612.418.8570 or (JaCollins@braunintertec.com). Sincerely, Braun Intertec Corporation Jacob D. Collins Project Manager Andrew M. Valerius Director, Senior Project Manager Charles M. Cadenhead, Jr., PE Vice President, Principal Engineer Attachments: Cost Estimate Table City of Chanhassen Provided – Quantity Item Price List Resumes –Tom Loosbrock, Jacob Collins, Andrew Valerius, and Charles Cadenhead The proposal is accepted, and Braun Intertec is authorized to proceed. _____________________________________________ Authorizer’s Firm _____________________________________________ Authorizer’s Signature _____________________________________________ Authorizer’s Name (please print or type) _____________________________________________ Authorizer’s Title _____________________________________________ Date 333 1 Fee Estimate 10010907_001 Chanhassen 26-02 Lake Drive E Rehabilitation SAP 194-110-006 Client: Work Site Address: City of Chanhassen Ben Phillips 7700 Market Blvd Chanhassen, MN 55317-8363 Lake Drive East Chanhassen, Minnesota 55317 Qty/Hours Rate Amount Task 1: Construction Materials Testing Subtask 1.1: Soils Testing $7,220.00 Soil Compaction Testing - Nuclear - Item 8 20.00 102.00 $2,040.00 Soil Compaction Testing - Non Nuclear - DCP Testing - Item 8 10.00 102.00 $1,020.00 Soil Sample pick-up - Item 8 10.00 102.00 $1,020.00 Nuclear moisture-density meter charge, per hour - Item 1 and ooooooiItem 2 20.00 32.00 $640.00 Trip Charge - Soils Trip Charge - Item 7 15.00 50.00 $750.00 Geotechnical Evaluation Allowance - Item 14 1.00 1,750.00 $1,750.00 Subtask 1.2: Concrete Testing $8,650.00 Concrete Testing - Item 9B 45.00 102.00 $4,590.00 Concrete Cylinder Pick Up - Item 10B 30.00 102.00 $3,060.00 Trip Charge - Concrete Trip Charge - Item 10A 20.00 50.00 $1,000.00 Subtask 1.3: Pavement Testing $7,190.00 Asphalt Sample pick-up - Item 11B 10.00 102.00 $1,020.00 Nuclear - Roll Pattern Testing - Item 12A 30.00 102.00 $3,060.00 Nuclear moisture-density meter charge, per hour - Roll Pattern - ooooooiItem 12A 30.00 32.00 $960.00 Trip Charge - Asphalt Trip Charge 8.00 50.00 $400.00 Asphalt Sample pick-up - Item 11C 4 Ea @ 1 Qty 4.00 Roll Pattern - Item 12B 4 Ea @ 1 Qty 4.00 Pavement Evaluation Allowance - Item 14 1.00 1,750.00 $1,750.00 Subtask 1.4: Laboratory Testing $9,192.00 Soil Proctor MD Relationship (Standard) each - Item 3 5.00 216.00 $1,080.00 Sieve Analysis with No. 200 wash (ASTM C136 and C117) - Item 5 4.00 168.00 $672.00 Concrete Compressive Strength Cylinders ASTM C39 each 100.00 42.00 $4,200.00 Concrete Cylinder Sets 20 Sets @ 4 Qty 80.00 Field-cured Cylinders 20 Ea @ 1 Qty 20.00 MnDOT Asphalt Verification, per sample - Item 11A 4.00 810.00 $3,240.00 Subtask 1.5: Project Management $9,006.00 Project Manager - Item 15A 25.00 186.00 $4,650.00 Project Assistant - Item 15B 20.00 102.00 $2,040.00 Project Manager - Item 13 2.00 186.00 $372.00 Senior Project Manager - Item 13 2.00 218.00 $436.00 Principal Engineer - Item 13 2.00 254.00 $508.00 Final Report - Final SAP Report - Item 13 1.00 1,000.00 $1,000.00 Task 1 Total: $41,258.00 Project Total $41,258.00 334 $4,020 Price listed is combined lines of "nuclear moisture-density meter charge" and "Compaction Testing - Nuclear" both per hour 12B Roll Pattern Testing Trip Charge Half listed with "Soils Testing" for Geotechnical Evaluation and half listed with "Pavement Testing" for Pavement Evaluation $200 13 EA 4 $50 14 Evaluation, Reporting, & Analysis Documentation LS 1 12A Charges include Final Report (ea), Project Manager (hour), Senior Project Manager (hour), and Principal Engineer (hour) 15B Project Administration HR 20 $102 $2,040 2 Compaction Testing on Granular Materials (Nuclear Density Test)EA 10 $32.00 $320 1 Will be charged per cylinder. Price displayed to left is per set assuming 4 cylinders. $200 COMMENTS Charged per hour as "Nuclear moisture-density meter" Assumes 1 Ea per hour estimate (10 hours assumed) Charged per hour as "Nuclear moisture-density meter" Assumes 1 Ea per hour estimate (10 hours assumed) No additional charge per each DCP. Cost is only per hour of technician. TOTAL PRICE $1,020 20 $168 $3,360 9A Concrete Testing & Casting Cylinder Sets (Compressive Strength, Curing, & Handling)*EA $41,258 15A Project Management & Oversight HR 25 $4,650 $186 $3,500 Geotechnical and Pavement Evaluation Allowance Allowance 1 $3,500 $2,316 $2,316 *EA indicates a set of 4 cylinders TOTAL Compaction Testing on Soils (Nuclear Density Test) EA 10 $32.00 $320 ITEM NO. ITEM UNITS QUANTITY UNIT PRICE 3 Proctor Sample & Testing (including Moisture Content) EA 5 $216.00 $4,080 8 Soils & Granular Materials Testing Hours (ALL) HR $672 6 DCP Tests for Aggregate Base (Class 5) EA 20 $0 $750 $168 4 Soils & Granular Materials Testing Trip Charge (ALL) EA 15 Roll Pattern Testing Hours HR 30 $134 EA 11B Bituminous Verification Sample Pickup and Testing Hours HR 10 $102 11C Bituminous Verification Sample Pickup Trip Charge EA 4 $50 $50 20 $50 $1,000 9B Concrete Testing Hours HR 45 $102 $4,590 9C Concrete Testing & Casting Field-Cured Cylinders (Compressive Strength, Curing, & Handling)EA 20 $42 $840 10A Concrete Testing and Cylinder Pickup Trip Charge 40 $102 7 Chanhassen - 2026 Lake Drive E Rehabilitation City Project 26-02 (SAP 194-110-006) $0 11A MnDOT Gyratory Bituminous Mix Properties Verification Testing & Rice Testing EA 4 $810 $3,240 4 Topsoil Borrow Sample & Testing EA 0 $445.00 $3,060 10B Cylinder Pick Up Hours HR 30 $102 $0 5 Gradation Sample and Testing EA $1,080 335 Thomas R. Loosbrock Field Operations Coordinator, Senior Field Technician Mr. Loosbrock is a field operations coordinator responsible for field scheduling; general project management; soil excavation observations; soil density testing; reinforced concrete observations & testing; reinforced masonry observations & testing and pre-stressed concrete inspections. Tom is familiar with MnDOT specifications, MnDOT schedule of materials control, and has been the lead technician on many state-aid and federal projects throughout his career. Tom was responsible for managing, performing field observations, and testing on the following projects and has more than 20 years of experience: Project Experience ▪ Galpin Boulevard Improvements SAP 194-115-004, Chanhassen, MN (Spring 2024 to Fall 2025) ▪ Chanhassen 2025 Pavement Rehabilitation 25-01, Chanhassen, MN (Summer 2025) ▪ 2024 City of Chanhassen City Pavement Rehabilitation 24-01, Chanhassen, MN (Summer 2024 to Summer 2025) ▪ 2023 City of Chanhassen Mill & Overlay Projects, Chanhassen, MN (Summer 2023 to Fall 2023) ▪ 2023 City of Chanhassen Pavement Rehabilitation Project Chanhassen, MN (Summer 2023 ▪ 2023 City of Chaska Street Reconstruction, Chaska, MN (Summer 2023 ▪ 2022 Lake Lucy Road Rehab Project, Chanhassen, MN (Summer 2022) ▪ 2022 City of Chanhassen Reconstruction, Chanhassen, MN (Summer 2022) ▪ 2022 City of Chaska Street Reconstruction, Chaska, MN (Summer 2022) ▪ 2021 City of Chanhassen Street Reconstruction, Chanhassen, MN (Summer 2021) ▪ 2021 City of Chaska Street Reconstruction, Chaska, MN (Summer 2021) ▪ 2020 City of Chaska Street Reconstruction, Chaska, MN (Summer 2020) ▪ 2019 City of Chaska Street Reconstruction, Chaska, MN (Summer 2019) ▪ City of Chanhassen Lake Drive Improvements, Chanhassen, MN (Summer 2019) ▪ 2018 City of Chaska Street Reconstruction (Summer 2018) ▪ CSAH 83, Shakopee, MN (Summer 2016 to Fall 2017) ▪ TH 5 Reconstruction, Waconia, MN (Summer 2015 to Spring 2016) ▪ Vicksburg Lane Reconstruction, Plymouth, MN (Summer 2015 to Fall 20 Experience Industry: 20 years Braun Intertec: 4 years Education B.S., Agricultural Systems Technology, South Dakota State University Certifications International Code Council (ICC) Certified: Reinforced Concrete Special Inspector, Structural Masonry Special Inspector, Prestressed Concrete Special Inspector, Soils Special Inspector No. 1136593 American Concrete Institute (ACI) Concrete Field Testing Technician Grade I No. 00936257 MnDOT Certified: Aggregate Production Grading and Base Level I & II Bituminous Street Level I Bituminous Plant Inspector Level I Concrete Field Level I & II Concrete Plant Inspector Level I Bridge Construction Level I & II No. 07515 336 *While employed by another firm. Jacob D. Collins Project Manager Jacob joined Braun Intertec in 2022 as a project manager. Jacob has more than 20 years of experience with special inspections and testing. He now acts as a project manager for commercial and transportation projects. His extensive on-site testing and special inspection experience related to concrete, masonry, structural steel, fireproofing, soils as well as with MnDOT testing for transportation will help any project as project manager. Jacob also assists technicians on-site with training to help ensure the tests and observations are done properly in accordance with the project at hand. Project Experience ▪ Preska Hall – Mankato State University – Mankato, MN (2011-2012)* ▪ St. Cloud State University Integrated Science and Engineering Laboratory Facility (ISELF) – St. Cloud, MN (2012-2013)* ▪ Herb Brooks National Hockey Center – Entrance Expansion – St. Cloud, MN –2012-2013)* ▪ North Hennepin Community College – Bioscience and Health Career Center – Brooklyn Park, MN – (2013-2014)* ▪ Mall of America – Phase 1C Expansion – Bloomington, MN – (2014-2016)* ▪ Encore Apartments – Minneapolis, MN – (2015-2016)* ▪ University of Minnesota – Athletes Village – Minneapolis, MN (2016-2017)* ▪ Various Local Municipality Street and Utility Improvements – Anoka, Brooklyn Center, Coon Rapids, Maple Grove, Ramsey, Robbinsdale – (2017-2022)* ▪ North Loop Apartments – Project 1 – Minneapolis, MN (2018-2019)* ▪ 1701 Nicollet Avenue Apartments – NICO I – Minneapolis, MN (2019)* ▪ 2924 Bryant Avenue Apartments – Minneapolis, MN (2020)* ▪ Robbinsdale Water System Improvements – Water Treatment Facility – Robbinsdale, MN – (2020-2022)* ▪ Cityline Apartments – Minneapolis, MN – (2021-2022)* ▪ NICO II Apartments – Minneapolis, MN – (2021-2022)* Experience Industry: 20 years Braun Intertec: 4 years Education Civil Engineering University of Minnesota Certifications PTI Level 2 Unbonded PT Inspector ICC Structural Steel 1 Framing and Bolting ICC Structural Steel 2 Welding ICC Steel Reinforced Concrete ICC Fireproofing ICC Soils ACI Field Technician MnDOT Aggregate Production MnDOT Concrete Field MnDOT Concrete Plant MnDOT Bituminous Street MnDOT Bituminous Plant MnDOT Grading & Base Tester MnDOT Grading & Base Inspector 337 Jacob D. Collins Project Manager Page 2 *While employed by another firm. ▪ University of Minnesota – Microbial Cell Production Facility (MCPF) – St. Paul, MN – (2021-2022)* ▪ Farmington – 2022 Street and Utility Improvements – Farmington, MN (2022) ▪ St. Therese Senior Community – Corcoran, MN (2022-2024) ▪ Cottage Grove 100th Street, 105th Street, & Ideal Avenue Improvements – Cottage Grove, MN (2022-2023) ▪ Cottage Grove – South District Street and Utility Improvements – Cottage Grove, MN (2022-2023) ▪ Northfield 2022 NW Area Mill and Overlay Project – Northfield, MN (2022) ▪ Brooklyn Center – Woodbine Area Improvements / 53rd Avenue Mill & Overlay – SAP 109-116-003, SAP 109113-002 – Brooklyn Center, MN (2022) ▪ Crew Carwash – West St. Paul – West St. Paul, MN (2022) ▪ Edina Community Center 2022 Improvements – Edina, MN (2022) ▪ City of Cottage Grove – Glacial Valley Park Improvements (2022-2023) ▪ City of Carver – Ironwood Park Improvements – Carver, MN (2022-2023) ▪ Carver Elementary 2022 Addition – Carver, MN (2022-2023) ▪ Chanhassen – 2022 Lake Lucy Road Rehabilitation – SAP 253-102-001 – Chanhassen, MN (2022) ▪ Cottage Grove – E Point Douglas and Jamaica Avenue – SAP 180-110-014, Cottage Grove, MN (2023-2024) ▪ City of Brooklyn Center – 2023 Street and Utility Improvements – CP 23-01, CP 23-02, and CP 23-03 – Brooklyn Center, MN (2023) ▪ City of Maple Grove – Lakeview Knolls Site Pickleball – Maple Grove, MN (2023) ▪ Cottage Grove – Low Zone Water Treatment Plant – Cottage Grove, MN (2023-2025) ▪ Chanhassen – 2023 City Pavement Rehabilitation – CP 23-01 – Chanhassen, MN (2023) ▪ Ramsey – The COR Grading Improvements – Ramsey, MN (2023) ▪ Chanhassen – Galpin Boulevard Reconstruction – SAP 194-115-004 – Chanhassen, MN (2024-Current) ▪ TH 41 / Organic Recycling Facility Driveway Intersection Improvements – SP 7010-115 – Shakopee, MN (2024) ▪ County Road 5 Extension – SAP 043-605-016 SAP 043-609-019 – Winsted, MN (2024-2025) ▪ Brooklyn Center Orchard Lane East Improvements – Brooklyn Center, MN – (2024-2025) ▪ Cottage Grove - Intermediate Zone Water Treatment Plant – Cottage Grove, MN (2025-Current) ▪ Chanhassen – Crimson Bay Road Rehabilitation – SP 1002-123 – Chanhassen, MN (2025-Current) ▪ Northfield Mill Towns State Trail – Northfield, MN (2025-Current) ▪ Maple Grove The Commons and Waldon Shores Area Street Reconstruction – CP 2025-03 – Maple Grove, MN (2025) 338 Andrew M. Valerius Director, Senior Project Manager Andrew is a senior project manager who is responsible for overseeing the quality control and day-to-day operations of engineering technicians involved in roadway and bridge projects. Specializing in state-aid and federally-funded projects, he has extensive experience working with the Minnesota Department of Transportation’s (MnDOT) Schedule of Materials Control and MnDOT’s Standard Specifications for Construction. From past work he has a working relationship with MnDOT staff and is able to get timely responses to questions and resolve issues to keep projects on schedule. Internally, Andrew helps lead the Braun Intertec transportation construction materials testing group for the State of Minnesota. Andrew also helps organize and presents at many educational sessions that focus on MnDOT’s specifications and procedures. Andrew’s past experience providing field services, such as soil density testing, concrete testing, bituminous and concrete batch plant observations, and testing services has allowed him to gain the necessary knowledge of field testing practices and practical site experience to perform his senior project manager role at a high level to deliver quality results safely. Project Experience Andrew has worked on numerous local government projects including many MnDOT state-aid and federally funded projects while with Braun Intertec. He has provided material testing oversight and review for the following cities: ▪ City of Bloomington, Bloomington, MN Oversaw the Construction Material Testing for the City of Bloomington’s projects during the 2024, 2019, 2017, 2016, 2015, 2014, and 2011 construction season.* Also provided oversight of the Normandale Boulevard Reconstruction Project and the Old Cedar Avenue Roadway and Trail Improvement Project during the 2017 and 2018 Construction Seasons for the City of Bloomington. ▪ City of Lakeville, Lakeville, MN — Oversaw the Construction Material Testing for the City of Lakeville’s projects since 2009.* ▪ City of Apple Valley, Apple Valley, MN — Oversaw the Construction Material Testing for the City of Apple Valley’s projects since 2010.* ▪ City of Edina, Edina, MN Oversaw the Construction Material Testing for the City of Edina’s state aid/federal projects since 2009.* Experience Industry: 20 years Braun Intertec: 20 years Education B.S. Technology Assessment and Management St. Cloud State University Certifications MnDOT Certified #13631 Aggregate Production Concrete Field Tester & Inspector Grading & Base Tester & Inspector Concrete Plant Tester Bituminous Plant Tester Bituminous Street Inspector 339 Andrew M. Valerius Associate Director, Senior Project Manager Page 2 ▪ City of Chaska, Chaska, MN Oversaw the Construction Material Testing for the City of Chaska’s state aid/federal projects since 2009.* ▪ City of Plymouth, Plymouth, MN Oversaw the Construction Material Testing for various City of Plymouth’s state aid/ federal projects since 2009.* ▪ City of St. Paul, St. Paul, MN Oversaw the Construction Material Testing for the City of St. Paul’s projects during the 2009 construction season. Currently provides a supporting role to our John Rutherford our project manager.* ▪ City of St. Louis Park, St. Louis Park, MN -- Oversaw the Construction Material Testing for various City of St. Louis Park’s state aid/ federal projects since 2009.* ▪ City of Hastings, Hastings, MN Oversaw the Construction Material Testing for various City of Hastings’ projects since 2009.* ▪ MN State Government Shutdown, Various Cities, MN Provided project management for bituminous and concrete batch plant observations and testing for numerous cities and projects during the three week government shutdown in 2011.* MnDOT Project Experience Andrew has worked on numerous MnDOT projects while with Braun Intertec. He has provided materials testing oversight and review for the following major projects: ▪ TH 13/101, Savage, MN Schedule Materials Control Coordinator responsible for ensuring overall compliance with the Schedule of Materials Control, verify testing rates, and preparing year end materials certification for the project. Mr. Valerius coordinated with the QC/QA staff and also filled in for the Quality Manager/Construction Quality Manager at times during construction. ▪ I-35W Bridge over the Mississippi River, Minneapolis, MN Performed more than 1,000 hours of grading and base testing required for this major bridge replacement project. ▪ Central Corridor Light Rail Project, West and East Project, Minneapolis and St. Paul, MN Providing a supporting role to our Project Managers with guidance in MnDOT testing procedures and protocol. ▪ Advance Traffic Improvements Central Corridor Light Rail Project, Minneapolis, MN Oversaw construction materials testing on the Advance Traffic Improvements project which included many streets around the University of Minnesota. ▪ 4th Street Advanced Utilities, Central Corridor Light Rail Project, St. Paul, MN Provided Project Management oversight on the 4th Street Advanced Utility project on numerous streets in downtown St. Paul. 340 Charles Cadenhead, PE Vice President, Principal Engineer Charles brings more than 30 years of experience in the transportation industry and more than 26 years of experience in delivering construction projects for owners (MnDOT and Anoka County) and other clients. With every project, from design-bid-build to design-build Charles has been one of the primary individuals entrusted with quality oversight from all aspects. While working for MnDOT his primary focus was on the construction side of projects, however with his experience at Anoka County and as a consultant he has been involved in both design and construction quality management. At Anoka County he was involved as early as the right-of-way process and used his expertise in construction to help manage risks associated with the design of projects. Projects have been various in size from simple span bridges and mill and overlays to large design-build projects with over $400 million in construction. Charles brings years of contract administration and change management experience to bear in order to arrive at a successfully completed project. Project Experience For the past 8 years Charles has served as a Principal in Charge of municipal and state projects for Braun Intertec working with Project Managers and Technicians to provide engineering expertise and guidance. Below are larger projects in which Charles was heavily involved in the development and implementation of project construction, quality, and completion to meet the various requirements needed to satisfy high quality projects. TH494 Design Build | MnDOT Bloomington, Minnesota | 8/2024 - Present Quality Manager. MnDOT is reconstructing the I494 with additional lanes, bridges, retaining walls, movement of utilities and multiple staging efforts to reduce congestion on this heavily trafficked corridor. Charles is the Quality Manager for the project and oversees the design Quality Manager and Construction Quality Manager for this project. Charles was responsible for setting up the five quality manuals for the project and has worked with the designer, contractor, and owner to help manage the delivery of the project while meeting the project quality standards. 25% Commitment Experience MN Transportation: 30 years MnDOT: 15 years Design-Build projects: 4 years Anoka County: 5 years Design-Build projects: 2 years Private Sector: 14 years Design Build projects: 8 years Certifications Professional Engineer - Minnesota 341 Charles Cadenhead, PE Vice President, Principal Engineer Page 2 TH 52 Design Build | MnDOT Zumbrota, Minnesota | 7/2021 – 10/2023 Quality Manager. MnDOT reconstructed the Trunk Highway 52 mainline, approximately 20 miles, with new concrete pavement using the design-build project delivery method for the work. Charles was the Quality Manager for the project and oversees the design Quality Manager and Construction Quality Manager for this project. Charles was responsible for setting up the five quality manuals for the project and worked with the designer, contractor, and owner to help manage the delivery of the project while meeting the project quality standards. 25% Commitment I-94 Maple Grove to Rogers Design- Build | MnDOT Maple Grove, Minnesota | 9/2019 – 7/2022 Quality Manager. MnDOT is adding a lane to I-94 between Maple Grove and Rogers using the design-build project delivery method for the project. Charles is the Quality Manager for the project and oversees the Design Quality Manager and Construction Quality Manager for this project. He has set up the five quality manuals for the project and works with the designer, contractor, and owner to help the delivery of the project meeting the project quality standards. 25% Commitment TH 371 Design-Build | MnDOT Nisswa, Minnesota | 9/2015 – 11/2017 Consultant Project Manager/Change Management. The reroute of TH 371 by Pequot Lakes is MnDOT, District 3, is a design-build project to allow travelers to avoid traffic congestion in the town of Pequot Lakes while allowing local traffic to move easier in the community. Charles is the consultant team project manager, contract administrator for MnDOT and the construction quality manager for this project that was completed in the fall of 2017. 30% Commitment I-35W/4th Street Design-Build | MnDOT Consultant Manager/Contract Administrator | 5/2014 – 11/2016 This MnDOT project incorporated the realignment of an overpass bridge, additional lane construction, retaining walls and contaminated material removal management. Charles performed the duties of contract administrator and consultant project manager for the entirety of the project. This busy urban project necessitated tight time controls on the traffic impacts on the interstate system and design modifications from the initial proposed layout. Charles was heavily involved in the weekly construction meetings and helping staff new to the design-build project delivery method. Total cost control and negotiations on the project led to an increase in the bid amount by less than 1% on the overall project costs. 30% Commitment Elk Run Design-Build | MnDOT Oronoco, Minnesota | 5/2012 – 11/2012 Construction/Project Engineer. Charles served as a construction engineer for the final year of the $34 million design-build project along the TH 52 corridor. The project scope consisted of the construction of a new Diverging Diamond Interchange with frontage/service roads on TH 52 and realignment of approximately three miles of Olmsted CSAH 12. As an extension of MnDOT, Charles managed the field and office staff and was responsible for oversight of the team to ensure verification inspection and testing was conducted in accordance with established standards and procedures in the Quality Management Plan. 30% Commitment 342 2/9/2026 Request for Proposals: Construction Materials Testing for 2026 Lake Dr. E Rehabilitation Project No. 26-02 (SAP 194-119-002 & 194-110-006) I. INTRODUCTION The City of Chanhassen is issuing this Request for Proposals (RFP) for construction professional services of approximately a half (0.5) miles of roadway reconstruction, rehabilitation and associated utility and stormwater improvements within the City. In general, the project includes materials testing and sampling, geotechnical evaluations, and recommendations of site conditions during construction. A. RFP Content. This RFP contains the following sections: I. Introduction II. Project Information III. Proposal Requirements B. Addenda/Clarifications. Any changes to this RFP will be made by written addendum. Verbal modification will not be binding. C. Pre-Contractual Expenses. The city will not be responsible for any pre-contractual expenses. Pre-contractual expenses are defined as expenses incurred by the Consultant in: 1. Preparing its proposal in response to this RFP 2. Submitting that proposal to the City of Chanhassen 3. Negotiating with the City of Chanhassen any matter related to that proposal; or 4. Any other expenses incurred by the Consultant prior to the date of execution of the Proposed Agreement. D. Contract Award 1. Consultant shall be required to enter into the City’s standard Professional Services Agreement (attached). 343 2/9/2026 2. Issuance of this RFP and receipt of proposals does not commit the City of Chanhassen to award a contract. The City of Chanhassen reserves the right to postpone opening for its own convenience, to accept or reject any or all proposals received in response to this RFP, to negotiate with other than the selected Consultant should negotiations with the elected be terminated, to negotiate with more than one Consultant simultaneously, or to cancel all or part of this RFP. E. Contact Person. The Consultant's contact for specific questions regarding information in this proposal is: Ben Phillips, (952) 227-1166, Bphillips@ChanhassenMN.gov. II. PROJECT INFORMATION A. Project Area and Identified Improvements. Approximately a half (0.5) mile of roadway is proposed to be rehabilitated or reconstructed within a commercial area which also provides access to a residential area of Chanhassen. The project area consists of two primary MSA streets: Lake Dr E between Great Plains Blvd and Dakota Ave plus Great Plains Blvd between TH 5 and Lake Dr E. Both segments have been designated by the city as municipal state aid segments. The area proposed for improvements is shown in the attached Figures. Lake Dr E was originally constructed between 1983 and 1987. It was last seal- coated in 2012. This ~1450-foot street segment is currently programmed to be rehabilitated via a full depth reclamation from the tie in point on the east end near Dakota Ave to the intersection with Great Plains Blvd. This ~550-foot segment of Great Plains Blvd was originally constructed in 1973, last reconstructed in 1991, and last rehabilitated in 2001. It was seal-coated in 2013. It is currently programmed to be rehabilitated via a full depth reclamation from TH 5 to the intersection with Lake Dr E. The intersection of Great Plains Blvd and Lake Dr E is expected to either be rehabilitated via a full depth reclamation or reconstructed and reconfigured after a full intersection analysis has been completed and the City has selected the preferred configuration. It is expected the preliminary design include an intersection control evaluation report including performing traffic counts. The areas proposed for improvements are shown in the Figure below. A full plan set, project specifications, and geotechnical report are available upon request. Please contact Ben Phillips to obtain these documents. 344 2/9/2026 B. Project Scope. The objective is to provide construction materials testing and any requested geotechnical evaluations and recommendations of site conditions. Anticipated amounts of various tests needed on this project are detailed below. Please ensure to submit costs for the amounts listed as provided on the attached spreadsheet. 1. Soils and Aggregate Testing a. Soil and aggregation gradation, proctor, moisture, modified DCP testing on Class 5, aggregate quality testing, and specified density nuclear tests of trench backfill for utility work per city specifications: Submit costs for 20 compaction tests (nuclear density test), 5 proctor samples, 4 gradations (aggregate base, select granular, aggregate backfills), 20 DCP tests with moisture result on Class 5. b. Trip charges and technician time: Submit costs for 15 trips and 40 hours of technician time for soils and aggregate testing. 345 2/9/2026 2. Concrete Testing a. Slump, air, temperature & 1 set of 4x8 cylinders per 100 CY per mix type per day (4 cylinders is 1 set): Submit costs for Compressive Strength, Curing, & Handling for 20 sets of cylinders and technician time of 45 hours. Submit total costs for Compressive Strength, Curing, & Handling for 20 field-cured cylinders (per cylinder). b. Concrete strength break testing and reports for cylinder sets (one 7-day and three 28-day) and field-cures (as directed by Engineer) cast: Submit costs for sample pickup time of 30 hours and 20 total trips for concrete testing and cylinder pickup. 3. Bituminous Testing a. MnDOT gyratory mix properties verification testing per day and Rice Testing per MnDOT 2360. (1 sample per day per mix type) Submit costs for 4 samples. Submit costs for 4 total trips and 10 hours of technician time for sample pickup and bituminous testing. b. Roll pattern establishment via nuclear density testing (one per day per mix type). Submit total costs for 4 trips and 30 hours of technician time. 4. Geotechnical and Pavement Evaluation and Recommendations a. This would only be utilized if very poor soils or unstable base is discovered during excavation or utility construction. A $3,500 allowance will be built into the proposal for the consultant to use on an as needed basis for consulting services. 5. Project Management & Oversight plus Project Administration Submit cost per attached spreadsheet per hour. 6. Evaluation, Reporting and Analysis Documentation 346 2/9/2026 Consultant shall submit daily reports and other standard documents utilized to summarize daily activity on-site and observations on a routine basis as directed by Engineer. For example: If roll pattern testing is performed in preparation for paving operations – the tests, timing, location, and observations shall be detailed in a daily report. Final project report summarizing all testing completed. D. Project Schedule. The following is the anticipated project schedule: III. PROPOSAL A. Submission of Proposal. Submit the proposal electronically to: Ben Phillips Construction Manager City of Chanhassen Bphillips@ChanhassenMN.gov Proposals shall be received by 4:00 p.m., April 17th, 2026. Proposals received after this time will not be accepted. B. Proposal Format. Proposals shall be prepared two-sided on 8½" x 11" paper, with all text clear of binding. Use of 11" x 17” fold-out sheets for large tables, charts or diagrams is permissible but shall be limited. The proposal shall be clear and understandable when reproduced in black and white and or color. C. Copies. The Consultant shall submit one (1) electronic copy of the proposal bearing the Consultant's name and address, and clearly marked as following: "26-02 Construction Materials Testing” D. Letter of Transmittal. Include, at a minimum, the following: Start Construction Final Completion May 2026 July 1st, 2027 347 2/9/2026 1. Identification of the offering firm(s), including name, address and telephone number of each firm, 2. Acknowledgement of receipt of RFP addenda, if any, and 3. Name, title, address, email address and telephone numbers of contact person during period of proposal evaluation. E. Consultant Team. Identify all team members and areas of responsibility. Resumes may be requested by City staff during proposal review. F. Understanding of the Project. The Consultant shall provide a brief, concise description that demonstrates the Consultant's understanding of the project and what needs to be done to successfully complete the work scope. G. Consultant Fee. Consultant shall provide the detailed cost breakdown as required in the spreadsheet format attached to the proposal. Any modifications must be approved the City prior to submission. A total not-to-exceed cost for all work shall be included. H. Exceptions and Deviations. The Consultant may include other services outside the scope of this proposal that the firm feels may be needed. The Consultant also may propose cost-saving items. Any exceptions to the requirements in this RFP, including the language in the contractual terms, must be included in the proposal. If the Consultant proposes changes to the scope of work, include a description, reason for the change and added/deducted engineering costs. Segregate all exceptions as a separate element of the proposal under the heading "Exceptions and Deviations". 348 *EA indicates a set of 4 cylinders 40 $______________ $__________________ 13 Evaluation, Reporting, & Analysis Documentation LS 1 $______________ $__________________ 8 Soils & Granular Materials Testing Hours (ALL) HR $__________________ 9C Concrete Testing & Casting Field-Cured Cylinders (Compressive Strength, Curing, & Handling) 12A Roll Pattern Testing Hours HR 1 Compaction Testing on Soils (Nuclear Density Test) EA 0 $______________ $__________________ 10 $______________ $__________________ 3 Proctor Sample & Testing (including Moisture Content) EA 5 $______________ $__________________ 30 $______________ $__________________ 15B Project Administration HR 20 $______________ $__________________ Project Management & Oversight HR 25 $______________ $__________________ 12B Roll Pattern Testing Trip Charge EA 4 $______________ HR 15A $3,500 $3,500 30 $______________ $__________________ Bituminous Verification Sample Pickup and Testing Hours 11C Bituminous Verification Sample Pickup Trip Charge EA 4 $______________ $__________________ ITEM NO. ITEM UNITS QUANTITY UNIT PRICE TOTAL PRICE $__________________ 14 Geotechnical and Pavement Evaluation Allowance Allowance 1 7 Soils & Granular Materials Testing Trip Charge (ALL) EA 9 $______________ $__________________ 11B $__________________9B Concrete Testing Hours HR 45 $______________ 9A Concrete Testing & Casting Cylinder Sets (Compressive Strength, Curing, & Handling) *EA 20 $______________ $__________________ 10A Concrete Testing and Cylinder Pickup Trip Charge EA 20 $______________ $__________________ EA 20 $______________ $__________________ Gradation Sample and Testing EA 4 $______________ $__________________ 6 DCP Tests for Aggregate Base (Class 5) EA 20 $______________ TOTAL 2 Compaction Testing on Granular Materials (Nuclear Density Test) EA 0 $______________ $__________________ $__________________ 11A MnDOT Gyratory Bituminous Mix Properties Verification Testing & Rice Testing EA 4 $______________ $__________________ 4 Topsoil Borrow Sample & Testing EA 0 10B Cylinder Pick Up Hours HR $______________ $__________________ 5 349 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this ________ day of ___________________, 20__, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and __________________________________________ "Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for_____________________. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for quote – __________________ dated ______, 20___; C. Insurance Certificate; D. Consultant’s ______, 20___ proposal for___________________ (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of __________________ Dollars ($_____, inclusive of expenses. Services performed directly by Consultant shall be paid at an hourly rate in accordance with the Proposal, subject to the not to exceed fee. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 350 2 201749v1 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficien cies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each occurrence/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 351 3 201749v1 11. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 13. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 14. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 15. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 352 4 201749v1 16. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 17. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 18. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 19. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 20. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including pa yment for services performed or furnished to the date and time of termination. Dated: _______________, 20__. CITY OF CHANHASSEN BY: _____________________________________________ Elise Ryan, Mayor BY: _____________________________________________ Laurie Hokkanen, City Manager Dated: _______________, 20__. _______________________ BY: _____________________________________________ Its 353 City Council Item April 27, 2026 Item Resolution 2026-XX: Accepting a $2,561.31 Donation from the Chanhassen Athletic Association for Lake Ann Park Ballfield 1, 4, and 5 Irrigation Improvements File No.Item No: D.17 Agenda Section CONSENT AGENDA Prepared By Luke Kegley, Recreation Supervisor Reviewed By Jerry Ruegemer SUGGESTED ACTION “The City Council adopts a resolution approving the acceptance of a $2,561.31 donation from the Chanhassen Athletic Association for irrigation work at Lake Ann Park Ballfields 1, 4, and 5." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY The Chanhassen Athletic Association (CAA) is a long-standing partner in administering youth sports programs for the community. CAA has committed to donate $2,561.31 to the City of Chanhassen to fund 50% of additional required irrigation improvements at Lake Ann Park ballfields 1, 4, and 5, as part of the ongoing Lake Ann Park ballfield improvement project. The city will cover the remaining 50% of the cost of required irrigation work ($2,561.31). BACKGROUND This $2,561.31 donation from CAA follows two larger donations of $66,871.71 (March 2026) and $19,669.83 (November 2025) to cover the costs of a comprehensive improvement project at Lake Ann Park ballfields 1-6, in full. During the initial phases of the Spring 2026 work on this project, contractors from Minnesota Sodding Company (MSC) identified a need for additional irrigation improvements on 354 ballfields 1, 4, and 5 to ensure the long-term health and maintenance of the new field surfaces. This additional irrigation work will ensure that the infrastructure supporting fields 1, 4, and 5 is updated concurrently with the surface renovations already underway. DISCUSSION Lake Ann ballfields 1, 4, and 5 are high-use facilities that require consistent irrigation to maintain safety and playability. To ensure the long-term health of these fields, MSC has recommended adjusting and improving the existing irrigation systems to accommodate the newly restored infield edges and sod. Completing this work now prevents future disruptions to the playing surfaces and aligns with the City's strategic goal of maintaining infrastructure to the highest level. The total cost for these specific irrigation improvements is $5,122.61. The $2,561.31 donation from CAA will fund 50% of the required irrigation work, with the city matching that amount to complete the work in full. The city recognizes and appreciates the CAA’s ongoing generosity and commitment to this project. BUDGET RECOMMENDATION “Staff recommends that the City Council adopts a resolution approving the acceptance of a $2,561.31 donation from the Chanhassen Athletic Association for irrigation work at Lake Ann Park Ballfields 1, 4, and 5." ATTACHMENTS CAA Ball Field Resolution 1, 4, & 5 Minnesota Sodding Company Quote CAA Ball Field 1, 4, and 5 Donation Agreement March 23, 2026 City Council Item D. 13 November 24, 2025 City Council Item F. 12 355 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 27, 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION ACCEPTING A DONATION FROM CHANHASSEN ATHLETIC ASSOCIATION BE IT RESOLVED that the Chanhassen City Council hereby accepts the donation from the Chanhassen Athletic Association of $2,561.31, for improvements to ball fields 1, 4, and 5 at Lake Ann Park. BE IT FURTHER RESOLVED that city staff is hereby directed to prepare a letter to the Chanhassen Athletic Association thanking them for their contribution towards ball field improvements at Lake Ann Park. PASSED AND ADOPTED by the Chanhassen City Council this 27th day of April 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 356 City of Chanhassen Proposal Client Name: Minnesota Sodding Company Project Name: Estimate ID:EST6131842 Date:Apr 09, 2026 Chanhassen, MN 55317Jobsite Address: Chanhassen- Lake Ann Irrigation Adjustments on Field #1 7901 Park Place Chanhassen, MN 55317Billing Address: $1,643.81Move 3 Heads on Field #1 ·Remove the 3 heads with their swing joints behind 2nd base. ·Trench in new pipe to reset the heads along the new infield arc ·Reset the heads, test the system and set the heads for proper coverage $1,643.81Subtotal $0.00Taxes $1,643.81Estimate Total Estimate authorized by:Estimate approved by: Company Representative Customer Representative Signature Date:Signature Date: mnsodco.comp. 651-438-3867 f. 651-438-3867 14 Old Deerfield Rd email: rweinbrenner@mnsodco.comWelch, MN 55089 Page 1 of 1Chanhassen- Lake Ann Irrigation Adjustments on Field #1 [EST6131842] 357 City of Chanhassen Proposal Client Name: Minnesota Sodding Company Project Name: Estimate ID:EST6132761 Date:Apr 09, 2026 Chanhassen, MN 55317Jobsite Address: Chanhassen- Lake Ann Fields 4 & 5 Arc Resod 7901 Park Place Chanhassen, MN 55317Billing Address: $3,478.80Lake Ann - Resod 4' New on Fields 4 & 5 ·Cut out sod and exisiting lips along the outfield arcs(320 linear ft.) ·Work around existing irrigations heads ·Set grade to the proper levels to allow for proper infield drainage. ·Adjust irrigation head heights as needed ·Resod the arcs at 4 ft. to provide a clean, level outfield arc ·Sod watering is the responsibility of the client following the completed installation $3,478.80Subtotal $0.00Taxes $3,478.80Estimate Total Estimate authorized by:Estimate approved by: Company Representative Customer Representative Signature Date:Signature Date: mnsodco.comp. 651-438-3867 f. 651-438-3867 14 Old Deerfield Rd email: rweinbrenner@mnsodco.comWelch, MN 55089 Page 1 of 1Chanhassen- Lake Ann Fields 4 & 5 Arc Resod [EST6132761] 358 AGREEMENT THIS DONATION AGREEMENT (“Agreement”) entered into this ___ day of ____, 2026, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation (“City”), and CHANHASSEN ATHLETIC ASSOCIATION, a Minnesota Nonprofit Corporation (“Donor”). NOW, THEREFORE, IN CONSIDERATION OF THEIR MUTUAL COVENANTS THE PARTIES AGREE AS FOLLOWS: 1. Approval. This Agreement is contingent upon the City Council adopting a resolution pursuant to Minnesota Statutes Section 465.03 accepting the donation subject to the terms of this agreement. 2. Donation. The Donar donates $2,561.31 to the City to cover 50% of additional required irrigation improvements to ball fields 1, 4, and 5, as described in Exhibit A, at Lake Ann Park in Chanhassen (“Project”). The Donor shall make one payment to the City of $2,561.31 on April 28, 2026. If the City in its sole discretion decides not to proceed with the Project, the City will return any donated funds the City has received pursuant to this Agreement to the Donor. If Donor does not provide the payment to the City by the above date, the City may, in its sole discretion, decide not to proceed with the Project. No work may begin on the Project until Donor provides payment to the City. 3. Naming. A plaque will be installed by the City in a location adjacent to the Project to recognize the donation. 4. Maintenance. The Project shall be maintained by the City of Chanhassen. 5. Decommissioning. The Project may be decommissioned based on the following reasons at the City’s discretion: a. The Project has reached the end of its useful life. b. The Project is damaged to a point where repair becomes financially burdensome to the City. c. The City Council determines that the site is needed for another public use. 6. Termination. This Agreement may be terminated: a. By either party upon material breach by the other, provided that the breaching party fails to cure such breach within (10) days after written notice; b. By mutual written agreement of the parties. If terminated without cause by the Donor, Donor shall remain responsible for any donations already agreed upon. 7. Severability. If any provision, term, or condition of this Agreement is found to be or become unenforceable or invalid, it shall not affect the remaining provisions, terms, and 359 conditions of this Agreement, unless such invalid or unenforceable provision, term, or condition renders this Agreement impossible to perform. Such remaining terms and conditions of the Agreement shall continue in full force and effect and shall continue to operate as the parties’ entire agreement. 8. Force Majeure. Neither Party will be liable for any failure or delay in performing an obligation under this Agreement that is due to any of the following causes, to the extent beyond its reasonable control: acts of God, accident, riots, war, terrorist act, epidemic, pandemic, quarantine, civil commotion, natural catastrophes, governmental acts or omissions, changes in laws or regulations, national strikes, fire, explosion, generalized lack of availability of raw materials or energy. For the avoidance of doubt, Force Majeure shall not include (a) financial distress nor the inability of either party to make a profit or avoid a financial loss, (b) changes in market prices or conditions, or (c) a party's financial inability to perform its obligations hereunder. 9. Relationship of the Parties. Nothing contained in this Agreement shall be deemed or construed as creating a joint venture or partnership between the parties. 10. Waivers. Failure of either party to object to any default, or to any other act or omission of the other, which is in violation of the terms of this Donation Agreement, will not be deemed a waiver of the right to object to any subsequent default, act or omission, whether similar or dissimilar. 11. Governing Law and Venue. This Donation Agreement will be governed by the laws of the State of Minnesota, without reference to its conflict of laws provisions. Any legal proceeding arising from this Donation Agreement will be venued in the state or federal courts with jurisdiction in Carver County, Minnesota. 12. Data Practices. Donor acknowledges that the City is subject to the Minnesota Government Data Practices Act, Minnesota Statues, Chapter 13, and its associated Rules (the “Act”), as well as other state or federal law applicable to government data. Donor further acknowledges and understands that this Donation Agreement and the data provided by Donor in this Donation Agreement will become subject to the Act and will be classified pursuant to the Act. The City will use any Donor data solely for purposes of the Program, and will not disclose Donor data except as may be required by the Act, other applicable law, or Order of a court of competent jurisdiction. 13. Entire Agreement. This Agreement represents the entire agreement of the parties and is a final, complete, and all inclusive statement of the terms thereof, and supersedes and terminates any prior agreement(s), understandings, or written or verbal representations made between the parties with respect thereto. IN WITNESS WHEREOF, the parties hereto have entered into this Agreement as of the day and year first above written. 360 CITY: CITY OF CHANHASSEN: By: ________________________________ Elise Ryan, Mayor By: ________________________________ Laurie Hokkanen, City Manager DONOR: CHANHASSEN ATHLETIC ASSOCIATION: By: ________________________________ Its:___________________________ 361 City Council Item March 23, 2026 Item Resolution 2026-XX: Approval of $66,871.71 Donation and Award Bid for Lake Ann Park Ballfield 1, 2, and 3 Improvements File No.Item No: D.13 Agenda Section CONSENT AGENDA Prepared By Priya Wall, Recreation Manager Reviewed By Jerry Ruegemer SUGGESTED ACTION “The City Council adopts a resolution approving the acceptance of a $66,871.71 donation from the Chanhassen Athletic Association and approves the $66,871.71 bid of Minnesota Sodding Company for improvements at the Lake Ann Park Ballfields 1, 2, and 3." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY The Chanhassen Athletic Association (CAA) is a parent/adult-led organization that has successfully administered youth sports programs within the community for over 50 years. CAA would like to donate $66,871.71 to the City of Chanhassen to finance necessary improvements at Lake Ann Park ballfields 1, 2, and 3. BACKGROUND This $66,871.71 donation is the second of two donations from the Chanhassen Athletic Association (CAA), the first of which was approved by City Council on November 24, 2025. Each of these donations covers one part in a two-part project to improve ballfields 1-6 at Lake Ann Park. The donation approved on November 24, 2025 will support improvements to fields 4, 5, and 6, and the 362 proposed $66,871.71 donation will support improvements to fields 1, 2, and 3. Work on all ball fields (1-6) will take place in Spring 2026, beginning as soon as weather allows. CAA has partnered with the city on numerous occasions to enhance local athletic facilities. Past contributions include the installation of scoreboards at Lake Susan Park and Lake Ann Park, dugout improvements at both parks, athletic lighting at Lake Susan Park, batting cage upgrades at Lake Ann Park, the remodeling of the Lake Ann ball field concession stand, and installation of storage sheds at Bandimere Park and Lake Ann Park. Additionally, CAA has supported various field improvement projects over the years. After 30 plus years of use, ballfields 1, 2, and 3 at Lake Ann Park are in need of repair. The base paths and infield edges have become built up. With years of use, the ag-lime has migrated beyond the infield areas while the grass continues to grow through, which creates a negative user experience for base runners and infielders. Staff have taken measures to mitigate the effects and reduce these raised edges; however, the scope of work and equipment required to fully address the underlying issues are beyond our current capabilities. DISCUSSION Ballfields 1, 2, and 3 at Lake Ann Park are some of Chanhassen’s most heavily utilized athletic fields, hosting over 350 hours of youth and adult sports practices, games, and tournaments annually. These fields serve as key locations for local baseball and softball leagues, as well as other community recreation activities. CAA's contribution will fund several key improvements on fields 1, 2, and 3, including sod removal to eliminate built-up lips along infield edges and outfield arcs, resetting and importing ag-lime to restore proper grading and surface drainage, and completing precision grading using machine-controlled equipment to ensure a safe and consistent playing surface. Additional improvements include installing new home plates and pitching rubbers, as well as new base anchors at multiple distances to support varying levels of play. Fields 2 and 3 will also include removal of existing mounds and construction of ag-lime areas to accommodate temporary mounds, providing flexibility for different age groups and field configurations. Topdressing of infield turf areas will further improve surface quality and playability. This field reconstruction will ensure that Lake Ann Park ballfields 1, 2, and 3 are a safe and enjoyable destination for our local associations and all other user groups, while maintaining the city's strategic goal of maintaining our infrastructure to the highest level. Quotes for the ballfield improvements were received from the following companies: Company Quote Minnesota Sodding Company*$66,871.71 JS Stewart Companies, Inc.$67,199.00 *Bolded low quote The city recognizes and appreciates the CAA’s ongoing generosity and commitment to enhancing Chanhassen’s athletic facilities for over 50 years. BUDGET 363 RECOMMENDATION “Staff recommends that the City Council adopts a resolution approving the acceptance of a $66,871.71 donation from the Chanhassen Athletic Association and approves the $66,871.71 bid of Minnesota Sodding Company for improvements at the Lake Ann Park Ballfields 1, 2, and 3." ATTACHMENTS CAA Ball Field Resolution 1, 2, and 3 CAA Ball Field 1, 2, and 3 Donation Agreement Minnesota Sodding Company Quote JS Stewart Companies Inc. Quote Quote Comparisons Minnesota Sodding Company Contract November 24, 2025 City Council Item F.12 364 City Council Item November 24, 2025 Item Resolution 2025-XX: Approval of $19,669.83 Donation and Award Bid for Lake Ann Park Ballfield 4, 5, and 6 Improvements File No.Item No: F.12 Agenda Section CONSENT AGENDA Prepared By Priya Wall, Recreation Manager Reviewed By Jerry Ruegemer SUGGESTED ACTION “The City Council adopts a resolution approving the acceptance of an $19,669.83 donation from the Chanhassen Athletic Association and approves the $19,669.83 bid of Minnesota Sodding Company for improvements at the Lake Ann Park Ballfields 4, 5, and 6." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY The Chanhassen Athletic Association (CAA) is a parent/adult-led organization that has successfully administered youth sports programs within the community for over 50 years. CAA would like to donate $19,669.83 to the City of Chanhassen to finance necessary improvements at Lake Ann Park ballfields 4, 5, and 6. BACKGROUND The Chanhassen Athletic Association (CAA) has partnered with the city on numerous occasions to enhance local athletic facilities. Past contributions include the installation of scoreboards at Lake Susan Park and Lake Ann Park, dugout improvements at both parks, athletic lighting at Lake Susan Park, batting cage upgrades at Lake Ann Park, the remodeling of the Lake Ann ball field concession stand, 365 and installation of storage sheds at Bandimere Park and Lake Ann Park. Additionally, CAA has supported various field improvement projects over the years. After 30 plus years of use, ballfields 4, 5, and 6 at Lake Ann Park are in need of repair. The base paths and infield edges have become built up. With years of use, the ag-lime has migrated beyond the infield areas while the grass continues to grow through, which creates a negative user experience for base runners and infielders. Staff have taken measures to mitigate the effects and reduce these raised edges; however, the scope of work and equipment required to fully address the underlying issues are beyond our current capabilities. DISCUSSION Ballfields 4, 5, and 6 at Lake Ann Park are some of Chanhassen’s most heavily utilized athletic fields, hosting over 350 hours of youth and adult sports practices, games, and tournaments annually. These fields serve as key locations for local baseball and softball leagues, as well as other community recreation activities. CAA's contribution will fund several key improvements, including the installation of new home plates and pitching rubbers, the removal and replacement of existing home plates, pitching rubbers, and base anchors, and the installation of three new sets of base anchors on each field at 60-, 65-, and 70-foot distances. Additional improvements include cutting sod to the designated arc, relocating ag-lime between fields, and completing 3D machine-controlled grading of the infields to ensure proper drainage. This field reconstruction and will ensure that Lake Ann Park ballfields 4, 5, and 6 are a safe and enjoyable destination for our local associations and all other user groups, while maintaining the city's strategic goal of maintaining our infrastructure to the highest level. Quotes for the ballfield improvements were received from the following companies: *Bolded low quote Company Quote Minnesota Sodding Company $19,669.83 JS Stewart Companies, Inc.$ 21,755.00 The city recognizes and appreciates the CAA’s ongoing generosity and commitment to enhancing Chanhassen’s athletic facilities for over 50 years. BUDGET RECOMMENDATION “Staff recommends that the City Council adopts a resolution approving the acceptance of an $19,669.83 donation from the Chanhassen Athletic Association and approves the $19,669.83 bid of Minnesota Sodding Company for improvements at the Lake Ann Park Ballfields." ATTACHMENTS CAA Ball Field Resolution 366 CAA Ball Field 4, 5, and 6 Donation Agreement Minnesota Sodding Company Quote JS Stewart Companies Inc. Quote Quote Comparisons 367 City Council Item April 27, 2026 Item Resolution 2026-XX: Authorize Contract for Engineering Design and Construction Services for the 2027 City Pavement Rehabilitation Project (27- 01) File No.ENG Project No. 27-01 CIP Project No. ST-012 Item No: D.18 Agenda Section CONSENT AGENDA Prepared By George Bender, Assistant City Engineer Reviewed By Charlie Howley SUGGESTED ACTION "The Chanhassen City Council adopts a resolution authorizing a Professional Services Agreement with Short Elliott Hendrickson for engineering design and construction services related to the 2027 City Pavement Rehabilitation Project." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY Consider authorizing a professional services agreement with SEH for engineering design and construction administration services for the 2027 City Pavement Rehabilitation Project. BACKGROUND As part of the overall Pavement Management Program (PMP), the city annually plans to rehabilitate a section or sections of public streets across the city. The 5-year Capital Improvement Plan (CIP) identifies the near-term streets to be rehabilitated. This 2027 project includes approximately 3.4 miles of city streets for rehabilitation. 368 Key dates and items relative to this project: On March 11, 2026, the Engineering Department released a Request for Proposals (RFP) for geotechnical services for the 27-01, 27-02, and 27-03 projects. On March 20, 2026, the Engineering Department released a Request for Proposals (RFP) for engineering design and construction services for the 27-01 project. On April 2, 2026, the Engineering Department received 2 proposals for geotechnical professional services related to the 27-01, 27-02, and 27-03 projects. On April 10, 2026, the Engineering Department received 6 proposals for engineering professional services related to the 27-01 project. On April 13, 2026, the City Council approved a Professional Services Agreement with Braun Intertec for geotechnical exploration and engineering services in association with the 27-01, 27- 02, and 27-03 design contracts. DISCUSSION One of the early steps in the overall project development process for our street projects is to engage design consultants regarding the project and establish an agreement with a consultant to support city staff from a workload management perspective. Staff developed a Request for Proposals (RFP) and distributed it to seven (7) qualified consulting firms. Six (6) firms submitted proposals. Staff evaluated the proposals based on the requirements of the RFP, which established the following criteria: Completeness and overall quality of the Proposal, including demonstrating an understanding of the scope and process (35%) Experience and resources of the firm and personnel, including the ability to meet the project schedule (35%) Fee (30%) Comprehensive scores were developed through the review process for each proposal, and a summary of the results of the evaluation are shown in the table below. The overall scoring spreadsheet has also been attached for reference. Firm Fee Overall Score SEH $496,803.00 86.0% Houston Engineering $658,862.00 80.2% WSB $757,689.00 80.1% ISG $647,330.00 76.2% Bolton & Menk $830,267.00 73.2% Kimley-Horn $626,737.00 66.2% A cost of $496,803 represents 11.4% of the $4,341,000 project budget. The city will still need to issue a contract for construction materials testing but in conjunction with the $68,000 contract for geotechnical services (13% total) this is a fair percentage for engineering design and construction professional services. 369 The overall schedule for the project is as follows: Milestone Task Date Award Consultant Contract April 27, 2026 Accept Feasibility Report; Call Public Hearing September 14, 2026 Neighborhood Project Open House #1 September 16, 2026 Public Hearing regarding Feasibility; Order Project September 28, 2026 Approve Plans and Specifications; Authorize Ad for Bid January 25, 2027 Bid Opening February 18, 2027 Call Assessment Hearing March 8, 2027 Neighborhood Project Open House #2 March 10, 2027 Public Hearing regarding Assessments; Award Construction Contract March 22, 2027 Start Construction May 3, 2027 Substantial Completion October 30, 2027 Final Completion & Begin 2-year warranty period June 9, 2028 BUDGET The overall project budget approved with the 2026-30 Capital Improvement Plan is shown in the table below, and the CIP budgetary sheet from FY 2026 has been attached for reference. The CIP sheet represents both the 27-01 and 27-02. The 27-02 project area (Lake Riley Blvd reconstruction) was split from the 27-01 project areas to ensure all of the project areas can be constructed in 2028. Mapping has been attached that identifies the streets proposed to be rehabilitated and/or reconstructed with the 27-01 project. Fund Budget PMP (Street)$3,197,000 Surface Water $310,000 Sanitary Sewer $317,000 Watermain $517,000 Total $4,341,000 RECOMMENDATION Staff recommends authorizing a contract with SEH in a not-to-exceed amount of $496,803 for engineering design and construction administration services for the 2027 City Pavement Rehabilitation Project. ATTACHMENTS Resolution 27-01 Proposal Evaluation Summary 27-01 and 27-02 Combined CIP Budget 5-Year CIP Map for Streets - 2026-2030 370 All Maps for 27-01 RFP 27-01 RFP with exhibits PROFESSIONAL SERVICES AGREEMENT for 27-01 371 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 27, 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION AUTHORIZING ENTERING INTO A PROFESSIONAL SERVICES AGREEMENT WITH SEH, INC. FOR ENGINEERING DESIGN AND CONSTRUCTION SERVICES RELATED TO THE 2027 CITY PAVEMENT REHABILITATION PROJECT NO. 27-01 WHEREAS, the City has a Pavement Management Program (PMP) that is supported by the 5-yr Capital Improvement Plan (CIP); and WHEREAS, part of the PMP and CIP is to perform annual rehabilitation of various public streets and related infrastructure; and WHEREAS, the annual City Pavement Rehabilitation Project requires professional design services; and WHEREAS, the City solicited proposals from multiple qualified design consulting firms; and WHEREAS, multiple responsive proposals were received and evaluated by City Staff; and WHEREAS, the fee proposed by the highest ranked proposal fits within the established project budget. NOW, THEREFORE, BE IT RESOLVED that the Chanhassen City Council hereby authorizes entering into a Professional Services Agreement with SEH, Inc. for engineering design and construction services related to the 2027 City Pavement Rehabilitation Project. Passed and adopted by the Chanhassen City Council this 27th day of April, 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 372 Completeness Resources Fee Reviewer #1 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score 35%35%30.0%100.0% Kimley-Horn 23%23%626,737.00$ 23.8%69.8% SEH 31%25%496,803.00$ 30.0%86.0% Bolton & Menk 29%33%830,267.00$ 18.0%80.0% WSB 25%31%757,689.00$ 19.7%75.7% Houston 33%29%658,862.00$ 22.6%84.6% ISG 27%27%647,330.00$ 23.0%77.0% Reviewer #2 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score Kimley-Horn 20%20%626,737.00$ 23.8%63.8% SEH 30%30%496,803.00$ 30.0%90.0% Bolton & Menk 28%27%830,267.00$ 18.0%73.0% WSB 34%35%757,689.00$ 19.7%88.7% Houston 33%31%658,862.00$ 22.6%86.6% ISG 30%25%647,330.00$ 23.0%78.0% Reviewer #3 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score Kimley-Horn 23%23%626,737.00$ 23.8%69.8% SEH 28%27%496,803.00$ 30.0%85.0% Bolton & Menk 29%30%830,267.00$ 18.0%77.0% WSB 32%33%757,689.00$ 19.7%84.7% Houston 27%28%658,862.00$ 22.6%77.6% ISG 27%25%647,330.00$ 23.0%75.0% Reviewer #4 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score Kimley-Horn 20%20%626,737.00$ 23.8%63.8% SEH 27%23%496,803.00$ 30.0%80.0% Bolton & Menk 30%25%830,267.00$ 18.0%73.0% WSB 30%30%757,689.00$ 19.7%79.7% Houston 25%30%658,862.00$ 22.6%77.6% ISG 30%25%647,330.00$ 23.0%78.0% Reviewer #5 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score Kimley-Horn 25%15%626,737.00$ 23.8%63.8% SEH 32%27%496,803.00$ 30.0%89.0% Bolton & Menk 25%20%830,267.00$ 18.0%63.0% WSB 27%25%757,689.00$ 19.7%71.7% Houston 28%24%658,862.00$ 22.6%74.6% ISG 25%25%647,330.00$ 23.0%73.0% Average between all reviewers Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score 35%35%30.0%100.0% Kimley-Horn 22%20%626,737.00$ 23.8%66.2% SEH 30%26%496,803.00$ 30.0%86.0% Bolton & Menk 28%27%830,267.00$ 18.0%73.2% WSB 30%31%757,689.00$ 19.7%80.1% Houston 29%28%658,862.00$ 22.6%80.2% ISG 28%25%647,330.00$ 23.0%76.2% Notes: Total cost for ISG was increased by $92,370 to compare all proposals fairly Stantec elected to not submit on this RFP 2027 City Pavement Rehabilitation Project (Project No. 27-01) Completeness and quality of the proposal including a demonstrated understanding of the scope as it relates to the stated goals of the project and conformance with the RFP. This includes separation from other proposals by identifying specific items important to this City project. (35%) Resources of firm and experience of key personnel identified to perform the scope of services and the firm's ability to meet the project schedule. This includes past performance on similar projects and experience on previous City of Chanhassen projects. (35%) Cost to perform all items identified to be completed within the RFP. (30%) Green = Received Proposal 373 Streets - 2027 Street Improvements Overview Request Owner Charlie Howley, PW Director/City Engineer Department Annual Pvmnt Mgmt Contracted Form Type Capital Improvement Request Type Street Construction/Reconstruction Project Number ST-012-2027 Description The 5-year Capital Pavement Management Plan identifies the planned streets for the next five years. The Plan is updated every fall to review priorities and needs, but generally intends to keep the overall condition index (OCI) average across all streets at 70 or higher. The City uses a Pavement Management System in Cartegraph to monitor the condition of City streets. While proper preventative maintenance extends the life of the street and is cost-effective, a street will eventually deteriorate to a point that major maintenance is required. Rehabilitation projects exited the life of the street. In cases when utilities or poor subgrade needs to be replaced or where streets have deteriorated to a point where rehabilitation will no longer be practical, reconstruction of the street is necessary. A feasibility study is written to consider the merits of the project, scope of work, costs, and assessments. The City has an Assessment Policy that identifies what and how much of the project is assessed to benefiting properties. Details Type of Project Resurface Current Road 374 Capital Cost Breakdown Capital Cost FY2027 Total Engineering $730,000 $730,000 Construction/Maintenance $6,625,000 $6,625,000 Total $7,355,000 $7,355,000 Capital Cost Total Budget (all years) $7.355M Project Total $7.355M Capital Cost by Year Construction/Maintenance Engineering 2027 $7,355,000.00 $0 $2M $4M $6M Capital Cost for Budgeted Years TOTAL $7,355,000.00 Construction/Maintenance (90%)$6,625,000. Engineering (10%)$730,000.00 375 Funding Sources Breakdown Funding Sources FY2027 Total Streets - PMP Funds $2,875,000 $2,875,000 Streets - PMP Assessments $1,920,000 $1,920,000 Utility Fund - Water $775,000 $775,000 Utility Fund - Sewer $475,000 $475,000 Utility Fund - SW Mgmt $1,310,000 $1,310,000 Total $7,355,000 $7,355,000 Funding Sources Total Budget (all years) $7.355M Project Total $7.355M Funding Sources by Year Streets - PMP Assessments Streets - PMP Funds Utility Fund - Sewer Utility Fund - SW Mgmt Utility Fund - Water 2027 $7,355,000.00 $0 $2M $4M $6M Funding Sources for Budgeted Years TOTAL $7,355,000.00 Streets - PMP Assessments (26%)$1,920,000.0 Streets - PMP Funds (39%)$2,875,000.00 Utility Fund - Sewer (6%)$475,000.00 Utility Fund - SW Mgmt (18%)$1,310,000.00 Utility Fund - Water (11%)$775,000.00 376 ## ## ########### ##### ### ### # # # ## ##### # ## # # ## ## # ###### # # ### # # #### # # ##### # # # # ## ## ## # # Lake Virginia Christmas Lake Lotus Lake Brendan Pond Lake Harrison Kerber Pond Lake Susan Rice Marsh Lake Lake Riley Rice Lake Lake St. Joe Lake Minnewashta Lake Ann Lake Lucy ST18 ST14 ST15 ST17 ST61 Minnewashta Regional Park North Lotus Lake Park Meadow Green Park Lake Ann Park Chanhassen Pond Park Chanhassen Nature Preserve Chanhassen Recreation Center Lake Susan Park Rice Marsh Lake Preserve Power Hill Park Fox Woods Preserve Bandimere Community Park Bluff Creek Golf Course Hesse Farm Park Preserve Lake Susan Preserve City Center Park Raguet Wildlife Management Are MN Valley National Wildlife Re MN Landscape Arboretum Seminary Fen Scientific & Nat* Bluff Creek Preserve Independent School District 11 Independent School District 112 Independent School District 276 Riley Ridge Park Lake Ann Park Preserve SA5 SA7 SA5 SA101 SA5 SA41 )212 P o w e r s Blvd Hw y 2 1 2 Au d u b o n R d Cha nha s s e n Rd Arboretum Blvd Pioneer Trl Galpin Bl v d Lyman Blvd Ha z e l t i n e B l v d M a r k e t Bl v d Po w e r s B l v d Hwy 7 F l y i n g C l o u d D r G reat Pl a insBlvd Arbo r e t u m B l v d C o R d 1 0 1 ST101 ST101 Date Created: 12/8/2025 Do c u m e n t P a t h : K: \ D e p a r t m e n t s \ E n g i n e e r i n g \ C I P \ 2 0 2 6 - 2 0 3 0 \ C I P _ 5 Y e a r _ 2 0 2 6 - 2 0 3 0 . a p r x Created By: City of Chanhassen - Engineering Department µ0 3,000 Feet 0 0.5 Mile 5-Year CIP Pavement Management Plan (PMP) - Streets (2026-2030) City of Chanhassen Legend Mill & Overlay Full Depth Reclamation ## ##Reconstruction 2026 2027 2028 2029 2030 377 | ||| | | | | || | |||| | | || | As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 58.41 Inspection Date: 08-01-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 24.52 Inspection Date: 08-02-2024 As-Built: 89-19 Installed: 06-01-1991 Inspection PCI: 25.47 Inspection Date: 08-02-2024 As-Built: 89-19 Installed: 06-01-1991 Inspection PCI: 30.16 Inspection Date: 08-02-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 20.21 Inspection Date: 08-02-2024 As-Built: 87-32 & 89-19 Installed: 06-01-1991 Inspection PCI: 22.79 Inspection Date: 08-02-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 54.57 Inspection Date: 08-01-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 56.57 Inspection Date: 08-01-2024 As-Built: 87-32 & 93-05 Installed: 06-01-1994 Inspection PCI: 36.35 Inspection Date: 08-01-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 20.78 Inspection Date: 08-02-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 58.41 Inspection Date: 08-01-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 24.52 Inspection Date: 08-02-2024 As-Built: 89-19 Installed: 06-01-1991 Inspection PCI: 25.47 Inspection Date: 08-02-2024 As-Built: 89-19 Installed: 06-01-1991 Inspection PCI: 30.16 Inspection Date: 08-02-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 20.21 Inspection Date: 08-02-2024 As-Built: 87-32 & 89-19 Installed: 06-01-1991 Inspection PCI: 22.79 Inspection Date: 08-02-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 54.57 Inspection Date: 08-01-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 56.57 Inspection Date: 08-01-2024 As-Built: 87-32 & 93-05 Installed: 06-01-1994 Inspection PCI: 36.35 Inspection Date: 08-01-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 20.78 Inspection Date: 08-02-2024 Lake Susan L a k e S u s a n D r R o s e w o od D r S u f f olk Dr Mergan s e r C t Tern Ct H e r o n D r Kingfis h e r C t E s sex R d Thrush C t L a k e S u s a n H i l l s D r C h a n h assen HillsDrN B a r bara Ct Dove Ct F l a m i n g o D r Egr et C t Pelic a n Ct La k e D r W P o w e r s Pl ST17 Lake Susan Park Power Hill Park Lake Susan Preserve Po w e r s B l v d 27-01 Street Details: Lake Susan Hills City of Chanhassen Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 378 || | | | | | | | | | ||| | ||| As-Built: 93-13 Installed: 06-01-1995 Inspection PCI: 50.47 Inspection Date: 07-03-2024 As-Built: 94-10 Installed: 06-01-1996 Inspection PCI: 60 Inspection Date: 07-03-2024 As-Built: 92-10 Installed: 06-01-1993 Inspection PCI: 75 Inspection Date: 07-03-2024 As-Built: 92-10 Installed: 06-01-1993 Inspection PCI: 74.1 Inspection Date: 07-03-2024As-Built: 93-22 Installed: 06-01-1994 Inspection PCI: 56.33 Inspection Date: 07-03-2024 As-Built: 93-22 & 94-10 Installed: 06-01-1997 Inspection PCI: 48 Inspection Date: 07-03-2024 As-Built: 93-13 Installed: 06-01-1995 Inspection PCI: 42.4 Inspection Date: 07-03-2024 As-Built: 93-13 & 94-10 Installed: 06-01-1997 Inspection PCI: 56.5 Inspection Date: 07-03-2024 As-Built: 92-10 & 93-22 Installed: 06-01-1994 Inspection PCI: 54.52 Inspection Date: 07-03-2024 Osprey L n Au d u b o n R d HeronDr V a l l e y R i d g e T r l S Al i s a L n Al i s a C t Lake Dr W S u n ri d g e C t Bluff Creek Preserve Independent School District 112 27-01 Street Details: Bluff Creek Estates City of Chanhassen Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 379 | | | | ||| | | | || | | | | As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 71.54 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 59.71 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1975 Inspection PCI: 59 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 46.85 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 63 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 60.14 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 60.07 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1990 Inspection PCI: 57 Inspection Date: 07-24-2024 Da k o t a L n Arb o r e t u m B l v d Hi d d e n Ct D a k o t a A v e Lake DrE Eri e S p u r E r i e A v e Ch e y e n n e A v e Rice Marsh Lake Preserve SA5 A r b o r e t u m B l v d 27-01 Street Details: Chanhassen Estates City of Chanhassen Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 380 | | | | As-Built: 80-06, 93-23, 93-32A & 03-05 Installed: 06-01-1980 Inspection PCI: 37.7 Inspection Date: 07-29-2024 As-Built: 93-23 & 93-32A Installed: 06-01-1996 Inspection PCI: 47.23 Inspection Date: 07-29-2024 As-Built: 80-06, 93-23, 93-32A & 03-05 Installed: 06-01-1980 Inspection PCI: 37.7 Inspection Date: 07-29-2024 As-Built: 93-23 & 93-32A Installed: 06-01-1996 Inspection PCI: 47.23 Inspection Date: 07-29-2024 Lake Susan M ission H ills D r Miss ion Hil l s Way E Frisco C t MissionHills W a y W Mission Hills Ct W 86th St R i c e Ct Missi o n Hills Ln M o n k C t Blac k bird Ct Heartland Ct M i s s i o n HillsCir Marshland Tr l T i g u a L n P r e s e r v e C t A l d r i c h D r W aters E d ge Dr Rice Marsh Lake Preserve )212 Mark e t Blvd Great Plain s Blv d Hwy 212 ST101 27-01 Street Details: W 86th St/Tigua Lane City of Chanhassen Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 381 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Storm Features: Lake Susan Hills City of Chanhassen " "" " " " " " " " " " " " " " " """" " "" "" " " " " " " " " " " " " " " " "" " " " " " " """" " " " """ " " " " " " "" " " "" " " " " "" " "" " " " "" " " " " " " " " """" " " " "" " " """ " " " " " "" " " " " " " "" " " """ " " " " " " " "" " " "" " " " " "" "" " " " " " "" "" " " " " " " " "" " " " "" " " " " " """" "" " " " " "" " " " " " " " """"" " """ " " " " "" " " " " " " " " "" " " " """" "" " " "" """ " L a k e S u sa n D r Rosewood Dr Lake Susan Hil l s D r SuffolkDr L a k e D r W Mergan s e r C t Tern Ct Kingfisher C t L a k e S u s a n C t Essex Rd Thrus h C t H e r o n D r C h a n hassen HillsDrN Barbara Ct Dove Ct F l a m i n g o D r E g ret C t Pelic a n C t Bu r l w o o d D r We s t L a k e D r Powers P l Drake C t West Lake Ct ST17 Po w e r s B l v d µ0 0.05 Mile 0 300 Feet Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 382 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Storm Features: Bluff Creek Estates City of Chanhassen " " " "" " " " " " " " " " " " " " """" " " " " " " " " " " " " " """" " "" "" " "" " " " " " " " "" " " " """ " " "" """ " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " """ "" " " " " " "" " " "" "" " " " " "" " " " " " " " " " " Valley Ridge Ct Osprey L n Au d u b o n R d V alle y V ie w C t HeronDr Valley Ridge Trl S Al i s a L n Valley Ridge Pl Valley Vie w P l Valley Ridge Trl N Al i s a C t Lake Dr W S u n ri d g e C t µ0 0.05 Mile 0 300 Feet Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 383 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Storm Features: Chanhassen Estates City of Chanhassen " " "" " " " " "" " " " " " """" " " " " " " " " " " " " " " " "" " " " " " " " " " " " " " " " " " " " "" " " " " " " " " " " " " " " " "" "" "" " " " " "" " " " " " " "" " "" " " " " " " " " " " " " " " " " "" " " "" " " "" " " " " " " " " """ " Hidden Ln Da k o t a L n A r b o retum Blvd Hidden Ct Da k o t a A v e Lake DrE Cheyenne Spur Eri e S p u r Dakota Cir Er i e A v e Ch e y e n n e A v e SA5 A r b o r e t u m B l v d µ0 0.05 Mile 0 300 Feet Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 384 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Storm Features: W 86th St/Tigua Lane City of Chanhassen " " " " " " " " " " " " " " " """ "" "" " " " " " " " " " "" " """ " " " "" " " " " " " " " " " " " " "" " " " " " " " " " " """ " " " " """ " " " " " " " " "" "" "" " " " " " " "" " " " " " """"" "" " " " " " " " "" " "" " " " "" " "" """" """""" "" " " "" " " "" " " " " " " " " " " " " "" " " " " " " "" "" " """" " " " "" " " " """" " " "" " " " " " " " " " """ " """ " " " " " " " " " " " " " " " " " " " " " M ission Hills D r Mission Hills Way E Mayfield C t F r isco Ct Re f l e c t i o n s R d MissionHills Wa y W Mission Hills Ct W 86th St Rice Ct Mission Hills Ln M o n k C t BlackbirdCt Heartland Ct M i s s i o n H i l l s C i r Marshland Trl T i g u a L n A l d r i c h D r P r e s e r v e C t W aters E d ge D r )212 Gre at Plain s Blv d Hwy 212 ST101 µ0 0.05 Mile 0 300 Feet Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 385 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Water Features: Lake Riley Blvd City of Chanhassen !( !( !( !( !( !(!(!(!( !(!(!( !( !( !( !( !( !(!( !( !( !(!( !( !(!( !( !( !( !( !( !(!( !( !( !( !( !( !( !( !( !( !(!( !( !( !( !( !(!( !( !( !( !( !(!( !( !( !( !( !( !( !(!( !( !( !(!(!( !( !( !( !(!( !( !(!( !(!( !( !( !( !(!( !(!( !( !( !(!( !( !(!(!(!(!(!( !( !( !( !(!( !( !( !( !( !( !( !( !( !( !(!( !( !( !( !( !( !( !( !( !(!(!( !(!( !( !(!(!( !( !( !( !(!( !(!( !(!(!(!( !( !( !( !( !( !( !( !( !( !( !(!( !(!( !( !( !( &( &( &( &( &( &( &(&(&(&( &( &( &( &( &( & & & & && & & & & & & & & & & & & & & & & && & & & L a k e S u s a n D r Rosewood Dr L a k e Susan Hills Dr SuffolkDr L a k e D r W Mergan s e r Ct Tern Ct Kingfis h e r Ct L a k e S u s a n C t Essex Rd Thrus h C t H e r o nDr C h a n hassen HillsDrN Barbara Ct Dove Ct F l a m i n g o D r E gr et C t Pelic a n C t Bu r l w o o d D r WestLake D r Powers P l Drak e Ct West Lake Ct ST17 Po w e r s B l v d Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Affected Valves &Hydrant Valve Affected Water Mains Affected Water Lateral Lines Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 386 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Water Features: Lake Riley Blvd City of Chanhassen !( !( !( !( !( !( !(!( !(!( !( !( !(!(!(!( !( !( !( !( !(!( !( !( !( !( !( !(!( !( !( !( !(!(!(!(!( !( !( !( !( !( !( !( !( !( !(!( !( !( !(!( !( !(!(!( !( !( !( !( !( !( &( &( &( &( &( &( &(&( &( &( &( &( &( &( &(&(&(& & && & && & & & & & & & & & & Valley Ridge Ct Heron Dr Osprey L n V alle y V ie w C t Valley Ri d g e T r l S Al i s a L n Valley Ridge Pl Valley View Pl Valley Ridge Trl N Au d u b o n R d Al i s a C t S u n ri d g e C t Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Butterfly &(Affected Valves &Hydrant Valve Affected Water Lateral Lines Affected Water Mains Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 387 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Water Features: Chanhassen Estates City of Chanhassen !( !(!( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !(!( !( !( !( !( !(!( !( !( !( !( !( !( !( !( !( !( !( !(!( !(!( !( !( !( !( !( !(!( !( !(!(!( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( &(&( &( &( &( &( &( &(&( &( & && & & & & & & & Da k o t a L n A r b o retum Blvd Hidden Ct D a k o ta A ve Lake Dr E Cheyenne Spur Eri e S p u r Dakota Cir Er i e A v e C h e y e n n e A v e SA5 A r b o r e t u m B l v d Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Affected Valves &Hydrant Valve Affected Water Mains Affected Water Lateral Lines Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 388 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Water Features: Lake Riley Blvd City of Chanhassen !( !( !( !( !( !( !( !(!( !( !( !( !( !(!( !( !( !( !(!( !( !( !(!(!( !( !(!(!( !( !( !( !( !(!( !( !( !( !( !(!(!(!( !(!( !( !(!( !( !( !( !( !( !( !( !( !(!( !( !(!( !( !( !( !( !(!( !(!( !( !(!( !( !( !( !( !( !(!( !( !( !( !( !(!(!(!( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !(!( &( &( &( &( &( &( &(&( &( & & & & & & & & M ission Hills Dr Mission Hills W a y E Mayfield C t Fr i s c o C t MissionHills Way W Mission Hills Ct W 86th St Rice Ct M issionHills L n M o n k C t BlackbirdCt Heartland Ct M i s s i o n H i l l s C i r M a r s h l a n d Trl T i g u a L n A l d r i c h D r P r e s e r v e C t W aters E d ge D r )212 Gre at Plain s Blv d Hwy 212 ST101 Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Butterfly &(Affected Valves &Hydrant Valve Service Valve Affected Water Mains Affected Water Lateral Lines Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 389 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Sanitary Structures: Lake Susan Hills City of Chanhassen " " " " " " " " " " " " " " " "" " " " """" " " " " " " "" "" "" " " " " " " " "" " " " " " " " "" " " " " """" " " " " " " " "" "" "" " " " " " " " " " " " " " " " " " "" " " " "" """ " " "" " """ " " " """" " " " " " " " " " "" "" " " "" " """""" " " " """" " " " " " " """ " " " """ " " " " " " " " " """" " " "" " """" "" " " " " " """" "" """" " " "" """ " " " " """ " " " """ " " " " " " " "" "" " " "" " " "" " " " " " " " " " " " "" """" "" L a k e S u s a n D r Rosewood Dr La k e S u s a n H i l l s D r SuffolkDr Tern Ct L a k e S u s a n C t H e r o n D r Kingfis h e r Ct E s s e x Rd Thrus h Ct C h a n h assen HillsDrN Barbara Ct Dove Ct Fl a m i n g o D r E g ret C t Pelic a n C t Bu r l w o o d Dr We s t L a k e D r La k e D r W P o w e rs Pl Dr a k e C t West Lake Ct ST17 Po w e r s B l v d Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 390 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Sanitary Structures: Bluff Creek Estates City of Chanhassen " "" " " " " " " """ "" " " "" "" " " " " " " " "" "" " " " " " " " "" " "" " " " " " " "" " " " " " " "" " " " " " " " " " " " """"" " " " " " " " " " " """ "" " " " " " " " " " " """" "" " " " "" " " " " " " " "" " " " " " " """" " "" " " " """" " " "" "" " " "" Valley Ridge Ct Osprey Ln Au d u b o n R d V alle y V ie w C t HeronDr Valley Ridge Trl S Al i s a L n Valley Ridge Pl Valley Vie w P l V a l l e y Ridge Trl N Al i s a C t Lake Dr W S u n ri d g e C t Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 391 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Sanitary Structures: Chanhassen Estates City of Chanhassen " " " " " " " " " " " " " " " " """ " " " " " " " " " " "" " " " " " """" " " " " " """ " "" " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " """ "" " " " " " " " " " " " " " " "" " " " " " " "" " " " " " " " " " " " " " " " """""" " " " " " " "" " " " " " " "" " " " " " " " " " " " " " "" " " " " " " " " " " Da k o t a L n A r b o r etum B l vd H i d d e n Ct LakeDrE Da k o t a A v e Cheyenne Spur Eri e Spu r Dakota Cir E r i e A v e Ch e y e n n e A v e SA5 A r b o r e t u m B l v d Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 392 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Sanitary Structures: W 86th St/Tigua Lane City of Chanhassen "" " " " "" " " " " "" " " " " " " " " " " " "" "" " " """ " " " " " " " "" " " " " " " "" " """ " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " "" " " " " " " " " " """ " " " " " " " "" " " " " " " " " " " " " " " " "" """" " " " " " " " " " " " " " " " " " " "" " " " " "" " " " "Missio n Hills Dr Mission Hills Way E M a yfield C t F r i s co Ct MissionHillsWayW Mission Hills Ct W 86th St R i c e C t M ission Hills Ln M o n k C t BlackbirdCt Heartland Ct M i s s i o n H i l l s C i r Marshland Trl T i g u a L n P r e s e r v e C t A l d r i c h D r W aters E d ge D r )212 Gre at Plain s Blv d Hwy 212 ST101 Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 393 3/20/2026 Request for Proposals 2027 City Pavement Rehabilitation Project City Project N. 27-01 Distribution Date: March 20, 2026 I. INTRODUCTION The City of Chanhassen is issuing this Request for Proposals (RFP) for design and construction phase professional services of approximately 3.4 miles of city street rehabilitation. In general, this project includes: public engagement, preliminary engineering, feasibility study preparation, surveying, streetview video creation, preliminary and final design, permitting, preparation of contract documents, right-of-way acquisition assistance (if needed), construction materials testing RFP preparation assistance, bid administration, construction administration, construction inspection and staking, warranty assistance, as-built drawings preparation, and project closeout. A. RFP Content. This RFP contains the following sections: I. Introduction II. Project Information III. Proposal Requirements B. Addenda/Clarifications. Any changes to this RFP will be made by written addendum. Verbal modification will not be binding. C. Pre-Contractual Expenses. The city will not be responsible for any pre-contractual expenses. Pre-contractual expenses are defined as expenses incurred by the Consultant in: 1. Preparing its proposal in response to this RFP; 2. Submitting that proposal to the City; 3. Negotiating with the City any matter related to this RFP; or 4. Any other expenses incurred by the Consultant prior to the date of execution of the Professional Services Agreement. D. Contract Award. 1. Consultant shall be required to enter into the City’s standard Professional Services Agreement (attached for reference). 2. Issuance of this RFP and receipt of proposals does not commit the City to award a contract. The City reserves the right to postpone opening for its own convenience, to accept or reject any or all proposals received in response to this RFP, to negotiate with other than the selected Consultant should negotiations with the selected consultant be 394 3/20/2026 put on hold or terminated, to negotiate with more than one Consultant simultaneously, or to cancel all or part of this RFP. E. Contact Person. The Consultant's contact for specific questions regarding information in this RFP is: George Bender, PE Assistant City Engineer City of Chanhassen 7700 Market Boulevard Chanhassen, MN 55317 (952) 227-1164 gbender@chanhassenmn.gov II. PROJECT INFORMATION A. Project Area and Identified Improvements. Approximately 3.4 miles of roadway is proposed to be rehabilitated within multiple residential areas within Chanhassen. The areas proposed for improvements are shown in the attached Figures. • The Lake Susan Hills development was originally constructed between 1987 and 1993. This neighborhood was last seal-coated in 2013 but it hasn’t received any other pavement rehabilitations. There is ~1.55 miles of total public street length within the neighborhood which has initially been programmed to be rehabilitated via full depth reclamation. This technique will need to be analyzed and verified by the consultant as the correct approach. • The Bluff Creek Estates development was originally constructed between 1992 and 1994. The neighborhood was previously seal-coated in 2013 but it hasn’t received any other pavement rehabilitations. It is currently programmed to be rehabilitated via a full depth reclamation. This technique will need to be analyzed and verified by the consultant as the correct approach. • The Chanhassen Estates development was originally constructed in 1966 and was rehabilitated in 1993. The rehabilitated pavement has not been previously seal- coated or received any other pavement rehabilitations. It is currently programmed to be rehabilitated via a mill and overlay. This technique will need to be analyzed and verified by the consultant as the correct approach. • W. 86th St was constructed in 1993 and Tigua Ln was constructed in 1980. Historical aerial imagery helps explain this as W. 86th is a re-alignment of how Tigua Ln originally connected to Great Plains/CSAH 101. Both streets were seal- coated in 2013. Mission Hills Lane is an adjacent and intersecting public street and it was rehabilitated in 2023. In general, the consultant shall investigate each street segment as part of the preliminary engineering scope prior to making a recommendation to the City. All project areas including individual street segments need to be evaluated with anticipated improvements to include: • mill and overlay or full depth reclamation (if recommended), 395 3/20/2026 • spot soil corrections (if needed along all individual segments), • spot curb and gutter replacement in rehabilitation areas, • new curb and gutter with drain tile plus aggregate layers in reconstruction areas, • trail and sidewalk improvements, • ADA improvements, • signage and pavement markings, • stormwater management spot repairs in rehabilitation areas, • sanitary sewer rehabilitation and spot repairs, and, • watermain rehabilitation and spot repairs. The design will need to be in conformance with the City’s most recently published or updated Standard Specifications and Detail Plates. The City will be conducting a geotechnical assessment to aid in the analysis of pavement and drainage improvements throughout the project areas and the consultant will be provided the geotechnical report to incorporate with the feasibility study and subsequent design. The draft geotechnical report is expected to be available prior to the 4th of July. The design consultant shall make rehabilitation recommendations from pavement specialists on their team. The $4,341,000 overall project budget will be funded by the city’s Pavement Management Program Fund ($3,197,000) and Utility Enterprise Funds (Sanitary $317,000, Water $517,000, and Surface Water $310,000). The PMP Fund receives revenue from the property tax levy, franchise fees and special assessments. Per the City’s current (revised in 2025) Assessment Policy, the City now assesses residential properties based on a flat rate set within the City’s annual Fee Schedule. The preliminary and final assessment rolls will be based on the current Assessment Policy. The consultant will also be required to calculate assessment amounts based on the previous assessment policy which indicated forty percent (40%) of the eligible street costs were proposed to be assessed to the benefiting property owners. This is for comparison purposes between the policy revisions. The City’s current Assessment Policy can be viewed on the City’s website. It was updated on May 5, 2025. The prior policy can be provided upon request. As part of the scope, the Consultant will understand the City’s assessment policy methodology, prepare draft and final assessment rolls, follow the MS 429 assessment process, and respond to concerns raised on an as-needed basis. All cost estimates, bid tabulations and contractor pay applications shall be broken down by source of funding (PMP, Sanitary, Water, and Surface Water). If any of the project areas or work affect adjacent municipality’s, County, or State rights- of-way; the consultant will include any necessary coordination and permitting in their scope. The City will reimburse the consultant for any permitting fees but the consultant should identify any expected fees in their proposal. There is typically a mix of watermain pipe sizes and materials within the project areas’ rights-of-way and public easements. The Consultant shall specify an approach in the proposal to determine if any watermain and/or components should be replaced or improved. The city would prefer not to use the open cut method for replacing any significant lengths of water main in a rehabilitation (i.e. M&O and FDR) area that would not dictate a spot repair. City staff will provide background to help determine if existing bolting, gate valves, curb stops or hydrants need to be replaced. City specification did not begin to require stainless steel bolting on gate valves until ~2003. Hence, it is anticipated the majority of the bolting associated with water valves will require replacement. 396 3/20/2026 Consultant staff is also expected to review the existing valving and hydrant locations and make recommendations for adding assets. Curb stops and hydrants will be replaced on an as needed basis. The design consultant shall make rehabilitation recommendations from utility specialists on their team and plan to visit the site to verify recommendations as necessary in conjunction with tree removals and other landscaping impacts. The City has a policy for replacing any existing cast iron pipe currently in use. Cast iron watermain is not expected to be identified within the scoped project areas. If it happens to be identified though then an analysis will need to be completed with respect to rehabilitating or replacing the watermain as an additional service. The sanitary sewer within this area is minimal and consists of eight-inch (8”) PVC pipe. The City will have the sanitary sewers televised. This information is expected to be available prior to the 4th of July. Generally speaking, the existing sanitary sewer is anticipated to be in adequate condition, however the mains and structures within the project area are to be assessed by the consultant for rehabilitation as needed. The consultant will be provided the videos and inspection reports. The consultant will be expected to review the televising information in detail and subsequently make recommendations by utility specialists on their team to be incorporated in the feasibly study and subsequent design. Additionally, consulting staff with the assistance of city staff will evaluate the sanitary sewer structures for any necessary updates and repairs. Any identified improvements shall be incorporated in the feasibility study and subsequent design. The consultant will be required to prepare utility design in plan and profile views if needed. Upon request, the City can provide access to our GIS system and as-builts to help with comprehension and proposal scoping. The City will televise the storm sewer infrastructure within the project areas. Based on preliminary information, the storm sewer system is generally expected to be in adequate condition. The City will provide the selected consultant with video footage and inspection reports for review. This information is expected to be available prior to July 4, 2026. Using this information, the consultant’s utility specialists shall evaluate the condition of the storm sewer system and provide recommendations to be incorporated into the feasibility study and subsequent design. City staff will also assess storm sewer structures within the project area to identify any repairs or upgrades that may be required, such as the installation of sump manholes. Any improvements identified by City staff will be communicated to the consultant and must be incorporated into the feasibility study and design. The consultant shall also evaluate the existing storm sewer network and related best management practices (BMPs) within the project area to assess current performance and identify potential improvements. The City will provide any available reports, inspection records, and HydroCAD models. These models represent pond systems only and do not include storm sewer piping. The City does not guarantee the completeness or accuracy of these models. The consultant will be expected to identify and address existing stormwater management issues in areas adjacent to or affected by the project streets. Site visits and coordination 397 3/20/2026 meetings with both engineering and public works staff will be necessary to verify existing conditions and support the development of appropriate recommendations. The project may trigger regulatory requirements under the NPDES permit and the rules of the Riley Purgatory Bluff Creek Watershed District (RPBCWD). The consultant will be responsible for understanding and navigating the applicable requirements. As necessary, the consultant shall develop strategies to meet permit requirements and incorporate them into the feasibility study and design. The consultant shall review the current NPDES permit and Watershed District rules and: • Determine whether the project exceeds regulatory thresholds for either agency and identify required improvements. • Prepare a Stormwater Pollution Prevention Plan (SWPPP), if required. Close coordination with the RPBCWD will be required. The consultant should anticipate at least two meetings with watershed district staff during the planning and design process. A preliminary permit application to the watershed district will be required at the 60 percent design submittal stage. B. Required Project Scope. The objective is to provide a project that is both technically and economically feasible. This project scope in general shall provide the following but also include any effort deemed necessary to produce a completed project: 1. Project Management. 2. Design. a) Coordinate and perform initial site visits of each project area with City Public Works staff. Go through the entire project in the field with the city to obtain information staff is aware of up front. Consultant shall document each concern raised throughout the visits and submit a summary within one week of the field visit. A spreadsheet of these items shall be created for tracking purposes to assure the design addresses each concern. The Consultant is required to bring along and locate via a GPS survey device all curb and gutter and other removals identified in the initial field visit to utilize as a starting point for the necessary design work. The consultant will also detail additional curb removals as needed during the design process to provide a logical end product. b) Preparation of a feasibility report to meet Minnesota State Statutes Chapter 429 requirements. c) Provide a 360-degree video along each street in all project areas. The timing of the data acquisition shall either be prior to design or immediately prior to construction and it shall be on a bright day with the sun near mid-day as to avoid unnecessary shadowing. Notice shall be given to the city ahead of the gathering the data to facilitate communications and street sweeping if necessary. The overall quality of the video delivered shall be detailed enough to help avert construction claims that are brought forth. For example, the imagery shall pick up the cracking within existing curbing and driveways. The information shall be gathered close enough to the curb line and at a slow enough rate to gather high quality, useable data. The ability to pause, rotate, and easily zoom into the imagery shall be a component of the delivered 398 3/20/2026 product. The overall functionality and quality shall be equal to or better than ‘Google Streetview’. d) Other site visits shall occur as needed during design to review and identify improvements such as utility repair recommendations, stormwater treatment options, curb replacement, tree and landscaping impacts, private utility conflicts, sidewalk and trail improvements, and other specific restoration needs (driveway pavements, type of turf, irrigation, etc.). The consultant shall plan to coordinate directly with properties impacted by tree removals towards the end of the design process and at the second open house in addition to ahead of physical removal. No tree removal shall come as a surprise to a property owner and the consultant shall strive for this to be a prioritized communication task. The consultant shall track all tree replacement needs via an up-to-date and on- line spreadsheet that can be accessed by the construction team and City staff. e) Meetings as needed with property owners to discuss property impacts such as tree removals, landscaping impacts, or stormwater BMP installations. f) Meetings and coordination with the RPBCWD team as needed to facilitate the stormwater design and secure applicable permits. The consultant shall include in their scope as many meetings as necessary to secure permitting from the watershed district in a timing manner ahead of construction. The consultant shall plan to meet with the watershed district regularly during design to facilitate this task. g) Preparation of preliminary and final construction plans and documents in conformance with the City’s most recent standard specifications and detail plates as well as the City’s Crosswalk Policy and other communicated design standards. 1. Review and incorporate available information from the existing as- builts into the plans in lieu of solely relying upon GIS. 2. Subsurface utility quality level C shall be required as well as specific private utility relocation plan sheets. City staff can not stress the importance enough in relation to private utility coordination and getting ahead of relocation requests. The consultant shall strive to get ahead of all communication and design needs to facilitate early coordinate with private utility companies and relocation efforts ahead of the Contractor being on-site. 3. Factor scheduling associated with tree removals for requirements associated with Northern Long-Eared Bats and other protected species. 4. Provide draft construction plans at approximately 30%, 60%, 90% and 100% and other review items such as SEQs, OPCC, preliminary and final assessment rolls, etc., to the city utilizing Bluebeam Studio. Responses to all City staff comments provided with review sets shall be addressed with the subsequent update. Consultant shall document and provide their internal QA/QC process prior to each review submission. The plan sheet scale shall be set for all sheets within each Bluebeam session. 399 3/20/2026 5. Construction plan sheets shall have logical match lines within project areas and be grouped by assessable area to facilitate ease of use for Contractors and field personnel. h) Prepare, submit, and obtain all necessary permits in association with the project. The City will be responsible for any costs associated with submission of permits. These costs should be identified and estimated in the proposal but do not need to be included in the Consultant’s final cost. i) Identify areas where right-of-way or easements are required and provide acquisition services, including; parcel exhibits and legal descriptions, obtaining title commitments, right-of-way/easement staking, and property appraisals and reviews. The City Attorney will provide legal documents such as deeds, easements, consents, disclaimers, etc., as required and will also review title work and ensure that all interested parties are defined and listed prior to the consultant meeting with the landowner. City staff will help facilitate and participate in discussions with the landowner. The City will ultimately process all documents that require recording through the City Attorney’s office. Any eminent domain tasks will be provided by the City Attorney, as needed. j) Preparation of preliminary and final assessment rolls. k) Public engagement support. The level of public engagement during design is to be outlined by the consultant in the work plan of their proposal with any value-added costs identified in the fee spreadsheet. At a minimum, plan for two (2) public open houses and exhibit preparation, routine project webpage updates during design (hosted on the city’s website), and preparation of a mailed resident survey(s) that asks for input around both project wide improvements and property specific impacts. A summarization of all resident input submitted via email, comment cards, resident survey, and other means shall be prepared by the consultant and used as a tracking mechanism during design. The consultant shall follow-up on all individual survey responses as needed. A communication summary shall be coordinated and drafted by the consultant after each open house to add to the City Council agenda item. 3. Bidding. a) Bidding services shall include coordination regarding the advertisement for bid, posting electronic bid documents, answering bidder’s questions, maintaining a bid holder’s list, attending a bid opening at City Hall, tabulating bids and breaking bids down by funding source, analysis, and providing a recommendation. Online bidding will be acceptable, however it is expected that the consultant host the virtual bid opening from City Hall. 4. Design Surveying. a) GIS data will be provided to the Consultant to use as a starting point for a basemap for the design in any proposed rehabilitation (M&O or FDR) areas. Available as-built information will also be provided to the consultant by the City. The Consultant shall obtain supplemental field surveying at select areas of the project as needed in a rehabilitation area and as determined to be 400 3/20/2026 necessary during the design phase. Specific data may include tree locations and size for impacted trees, ADA compliance, private utility locations (consultant shall obtain small utility mapping), structure rim and invert elevations, drainage and grade refinements, EOF’s, finished floor elevations, and locating existing right of way and/or easements within the project area. An accurate basemap in CAD format (.dwg) is required to be developed by the consultant that includes updates based on as-built review and field survey information. The Consultant is cautioned not to expect to strictly rely upon GIS information as it is deemed conceptual by City staff and known to have errors. The Consultant shall include an allowance of $50,000 for the cost of field design surveying as needed per the level of effort associated with the rehabilitation design. 5. Meetings. It is anticipated the Consultant shall include time to prepare agenda and minutes, handouts, exhibits, and have key staff attend in person for: a) Three (3) City Council meetings at City Hall. Consultant shall provide information as needed to facilitate preparation of staff reports and Powerpoint presentations for the City Council agenda. b) Two (2) neighborhood informational meetings for the entire project area. c) Two (2) coordination meetings with the watershed districts to confirm design requirements and resolve comments to secure construction permits. d) Staff meetings for design coordination as necessary and as desired by the consultant to facilitate a quality and complete design. These meetings shall typically be held at City Hall but can be held virtually if needed. Routine design meetings should be assumed to take 2+ hours per meeting to coordinate various design details. The consultant shall describe in detail their plan for design and coordination meetings to facilitate a quality product. e) Individual property owner meetings held on-site as needed during design for ROW and easement acquisition, tree removals, BMP placements, and other coordination items to communicate effectively with the residents. Assume ten (10) meetings for this proposal. Note: Individual property owner meetings during construction are expected to be incorporated into the Construction Administration time. f) Preconstruction meeting to be held at Public Works. g) Weekly meetings during construction. Assume twenty-six (26) meetings for this proposal. Note: The construction administrator and the inspector shall both attend these meetings. 6. Construction Surveying. a) Consultant shall include an allowance of $60,000 to cover the cost of construction staking as the level of effort cannot be determined at this time. If the consultant does not feel this amount will be sufficient to cover construction staking it should be noted in the proposal and the estimated amount can be discussed and the agreed upon amount can be included in the contract. 7. Construction Administration and Inspection. 401 3/20/2026 a) Construction administration services will be required including owner and contractor coordination, submittal review, answering design questions and responding to RFI’s, preparation and review of pay requests by funding category, construction coordination with residents, preparation of weekly project updates, attending weekly meetings including preparation of meeting minutes, monitoring and review of NPDES permit documentation, other permit coordination, negotiating and processing change orders, Spring work the following season, final closeout, and warranty coordination. The consultant shall request submittal review assistance as needed and distribute all approved submittals to the City during construction. The consultant shall maintain and distribute conformed contract documents after the bidding process and throughout construction as major plan updates occur. If the project is utilizing any Municipal State-Aid funding, the Consultant shall prepare and submit State-aid payment requests periodically on behalf of the city. The construction administration time including is task 7a shall be in addition to time allocated in tasks 7b (construction inspection) and 8 (project close-out) in this RFP. b) Construction inspection services shall include time on-site to monitor the construction, perform utility coordination, coordinate with residents as necessary, track quantities, attend weekly coordination meetings, coordinate with the City’s staff as needed, prepare daily reports, monitor all BMPs associated with the SWPPP and document compliance, and generally work with the Contractor. The inspector shall document and track all private utility interruptions and hits caused by the project via an up-to-date spreadsheet that can be accessed by City staff. The Consultant should include an allowance of 1600 hours of inspection time in 2027 in their proposal for the primary inspector. Approximately 100 hours of this allotment is assumed to be for a second inspector. An allowance of an additional 150 inspection hours shall be reserved for the following Spring to follow-up on punch list items, wear course paving (if necessary), restoration, and closing-out the project. The consultant shall also perform inspections as needed through the warranty period in addition to coordinating with the contractor to ensure items are adequately communicated and repairs are completed. An allowance of an additional 50 hours shall be reserved for warranty period efforts. The Consultant shall have the capacity to provide a second inspector on-site when construction activity dictates additional assistance is necessary. The primary inspector shall be certified through MnDOT certification classes including ADA certification in addition to the Erosion and Stormwater Management program through the University of Minnesota. This certification information should be indicated on the proposed inspector’s resume included within the proposal as part of the key personnel. The primary project inspector shall have a minimum of five (5) full years of construction experience. Completed daily reports for the past month shall be submitted with each contractor pay application or consultant monthly invoice. c) The consultant shall factor adjusted billing rates into the proposal for any necessary rate increases for construction time expended throughout the contract. The billing rates for all construction staff will not be allowed to be adjusted during the project because it would reduce the allotted amount of hours 402 3/20/2026 planned to complete the work. This is not intended to apply to design staff for work between Fall 2026 and Winter 2027 prior to the project being awarded by the City Council to a contractor. d) The city will contract separately for geotechnical support and materials testing during construction, however the consultant will coordinate and review all testing with the selected geotechnical firm during construction. The Consultant will provide testing quantity information based to the city based on the design as part of their scope for inclusion in the material testing RFP. 8. Preparation of as-built drawings and project closeout. a) Draft as-builts shall be completed and submitted to the city after the project is substantially complete and within the winter season following construction. The as-built requirements shall comply with section 9.19 of the City’s General Conditions. b) Provide completed MnDOT ADA Compliance Checklists with the final as- builts. c) The consultant shall coordinate all final documentation required to close out the construction contract. d) Final as-built information and all other final documentation shall be provided no later than 45 days after the final construction pay request has been approved. e) Time within task 8 shall be calculated separate from time included within Task 7b. C. Project Goals. The goals of the project are as follows, in no particular order of importance. These goals support the City’s Strategic Priorities. 1. Develop an appropriate pavement rehabilitation technique that meets design budget. (Financial Sustainability and Asset Management) 2. Incorporate appropriate improvements to public utilities and systems in the vicinity of the project by leveraging the opportunity of the street rehabilitation. (Asset Management) 3. Implement a project schedule that leverages an advantageous bidding climate. (Financial Sustainability) 4. Preparation of contract documents to a level of detail that meets City standards, minimizes cost and schedule risk exposure to the City, and clearly addresses impacts to private property. (Financial Sustainability, Asset Management and Operational Excellence) 5. Proactive communication with impacted residents and property owners. (Communication and Operational Excellence) 403 3/20/2026 6. Develop trust between City and Consultant; and between City and Residents. (Communication and Operational Excellence) D. Project Schedule. The following is the estimated project schedule: Distribute RFP Proposal Submissions Award Consultant Contract at City Council Accept Feasibility Report; Call Public Hearing Neighborhood Project Open House Public Hearing on Feasibility; Order Project Approve Plans & Specifications, Authorize Ad Bid Opening Call Assessment Hearing Neighborhood Meeting Assessment Hearing; Award Contract Start Construction Substantial Construction Complete Final Completion March 20, 2026 April 10, 2026 April 27, 2026 September 14, 2026 September 16, 2026 September 28, 2026 January 25, 2027 February 18, 2027 March 8, 2027 March 10, 2027 March 22, 2027 May 3, 2027 October 30, 2027 June 9, 2028 III. PROPOSAL A. Delivery of Proposals All proposals must be emailed to Assistant City Engineer George Bender at: gbender@chanhassenmn.gov All proposals must be received no later than 4:00 p.m. (central time) on Friday, April 10, 2026. Late proposals will not be considered. B. Proposal shall include at a minimum, the following: 1. Identification of the offering firm, including name, address and telephone number. 2. Acknowledgement of receipt of RFP addenda, if any. 3. Name, title, address, email address and telephone numbers of contact person during period of proposal evaluation. 4. Identify key team members and areas of responsibility, include resumes. 5. A brief, concise work plan that demonstrates the Consultant's understanding of the project and what needs to be done to successfully complete the scope of work, including overall project schedule. Special consideration will be giving for innovative public engagement during both design and construction phases. 6. A detailed not-to-exceed cost breakdown, in spreadsheet format, for performing the work including time and hourly rates for each named team member, permit fees, materials, equipment, and subcontractors required, if any. Costs shall be broken out into areas as indicated in Section II, Paragraph B. The estimate shall clearly identify 404 3/20/2026 any proposed alternates and reimbursable expenses as well as any deviations from the requirements of this RFP. 7. Other services outside the scope of this proposal that the firm feels may be needed, if any. The Consultant may also may propose cost-savings items or deviations from the requirements of the RFP which may be considered an advantage to the City. Any modifications or deviations shall be noted separately in the proposal and not part of the overall not-to-exceed fee. 8. Any exceptions to the requirements in this RFP, including the language in the contractual terms, must be included in the proposal. If the Consultant proposes any changes to the scope of work or requirements detailed within the RFP, include a description, reason for the change and added/deducted engineering costs. Segregate all exceptions as a separate element of the proposal under the heading "Exceptions and Deviations". C. Proposal Evaluation Proposals will be evaluated based on the following criteria: 1. Completeness and quality of the proposal including a demonstrated understanding of the scope as it relates to the stated goals of the project and conformance with the RFP. (35%) 2. Resources of firm and experience of key personnel identified in the proposal to perform the complete scope of services and the firm’s ability to meet the project schedule. Proposed personnel and their availability shall be clear within the proposal. Experience includes past performance on similar projects and experience on previous City of Chanhassen projects. (35%) Please note when the City evaluates the personnel proposed to be utilized on the project it becomes assumed these personnel will be available to work on the project based on the availability identified in the proposal. If project personnel needs to be modified by the selected consultant – the City reserves the right to approve the proposed changes. The consultant shall communicate the need for the requested modification and explain any effects on the project for City consideration and approval. 3. Fee. (30%) Interviews are not anticipated to be utilized as part of proposal evaluation process but the City reserves the right to interview firms to make a determination regarding the final selection. 405 | ||| | | | | || | |||| | | || | As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 58.41 Inspection Date: 08-01-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 24.52 Inspection Date: 08-02-2024 As-Built: 89-19 Installed: 06-01-1991 Inspection PCI: 25.47 Inspection Date: 08-02-2024 As-Built: 89-19 Installed: 06-01-1991 Inspection PCI: 30.16 Inspection Date: 08-02-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 20.21 Inspection Date: 08-02-2024 As-Built: 87-32 & 89-19 Installed: 06-01-1991 Inspection PCI: 22.79 Inspection Date: 08-02-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 54.57 Inspection Date: 08-01-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 56.57 Inspection Date: 08-01-2024 As-Built: 87-32 & 93-05 Installed: 06-01-1994 Inspection PCI: 36.35 Inspection Date: 08-01-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 20.78 Inspection Date: 08-02-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 58.41 Inspection Date: 08-01-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 24.52 Inspection Date: 08-02-2024 As-Built: 89-19 Installed: 06-01-1991 Inspection PCI: 25.47 Inspection Date: 08-02-2024 As-Built: 89-19 Installed: 06-01-1991 Inspection PCI: 30.16 Inspection Date: 08-02-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 20.21 Inspection Date: 08-02-2024 As-Built: 87-32 & 89-19 Installed: 06-01-1991 Inspection PCI: 22.79 Inspection Date: 08-02-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 54.57 Inspection Date: 08-01-2024 As-Built: 87-32 Installed: 06-01-1989 Inspection PCI: 56.57 Inspection Date: 08-01-2024 As-Built: 87-32 & 93-05 Installed: 06-01-1994 Inspection PCI: 36.35 Inspection Date: 08-01-2024 As-Built: 93-05 Installed: 06-01-1994 Inspection PCI: 20.78 Inspection Date: 08-02-2024 Lake Susan L a k e S u s a n D r R o s e w o od D r S u f f olk Dr Mergan s e r C t Tern Ct H e r o n D r Kingfis h e r C t E s sex R d Thrush C t L a k e S u s a n H i l l s D r C h a n h assen HillsDrN B a r bara Ct Dove Ct F l a m i n g o D r Egr et C t Pelic a n Ct La k e D r W P o w e r s Pl ST17 Lake Susan Park Power Hill Park Lake Susan Preserve Po w e r s B l v d 27-01 Street Details: Lake Susan Hills City of Chanhassen Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 406 || | | | | | | | | | ||| | ||| As-Built: 93-13 Installed: 06-01-1995 Inspection PCI: 50.47 Inspection Date: 07-03-2024 As-Built: 94-10 Installed: 06-01-1996 Inspection PCI: 60 Inspection Date: 07-03-2024 As-Built: 92-10 Installed: 06-01-1993 Inspection PCI: 75 Inspection Date: 07-03-2024 As-Built: 92-10 Installed: 06-01-1993 Inspection PCI: 74.1 Inspection Date: 07-03-2024As-Built: 93-22 Installed: 06-01-1994 Inspection PCI: 56.33 Inspection Date: 07-03-2024 As-Built: 93-22 & 94-10 Installed: 06-01-1997 Inspection PCI: 48 Inspection Date: 07-03-2024 As-Built: 93-13 Installed: 06-01-1995 Inspection PCI: 42.4 Inspection Date: 07-03-2024 As-Built: 93-13 & 94-10 Installed: 06-01-1997 Inspection PCI: 56.5 Inspection Date: 07-03-2024 As-Built: 92-10 & 93-22 Installed: 06-01-1994 Inspection PCI: 54.52 Inspection Date: 07-03-2024 Osprey L n Au d u b o n R d HeronDr V a l l e y R i d g e T r l S Al i s a L n Al i s a C t Lake Dr W S u n ri d g e C t Bluff Creek Preserve Independent School District 112 27-01 Street Details: Bluff Creek Estates City of Chanhassen Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 407 | | | | ||| | | | || | | | | As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 71.54 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 59.71 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1975 Inspection PCI: 59 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 46.85 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 63 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 60.14 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1995 Inspection PCI: 60.07 Inspection Date: 07-24-2024 As-Built: 66-02 & 93-10 Installed: 06-01-1990 Inspection PCI: 57 Inspection Date: 07-24-2024 Da k o t a L n Arb o r e t u m B l v d Hi d d e n Ct D a k o t a A v e Lake DrE Eri e S p u r E r i e A v e Ch e y e n n e A v e Rice Marsh Lake Preserve SA5 A r b o r e t u m B l v d 27-01 Street Details: Chanhassen Estates City of Chanhassen Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 408 | | | | As-Built: 80-06, 93-23, 93-32A & 03-05 Installed: 06-01-1980 Inspection PCI: 37.7 Inspection Date: 07-29-2024 As-Built: 93-23 & 93-32A Installed: 06-01-1996 Inspection PCI: 47.23 Inspection Date: 07-29-2024 As-Built: 80-06, 93-23, 93-32A & 03-05 Installed: 06-01-1980 Inspection PCI: 37.7 Inspection Date: 07-29-2024 As-Built: 93-23 & 93-32A Installed: 06-01-1996 Inspection PCI: 47.23 Inspection Date: 07-29-2024 Lake Susan M ission H ills D r Miss ion Hil l s Way E Frisco C t MissionHills W a y W Mission Hills Ct W 86th St R i c e Ct Missi o n Hills Ln M o n k C t Blac k bird Ct Heartland Ct M i s s i o n HillsCir Marshland Tr l T i g u a L n P r e s e r v e C t A l d r i c h D r W aters E d ge Dr Rice Marsh Lake Preserve )212 Mark e t Blvd Great Plain s Blv d Hwy 212 ST101 27-01 Street Details: W 86th St/Tigua Lane City of Chanhassen Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 409 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Storm Features: Lake Susan Hills City of Chanhassen " "" " " " " " " " " " " " " " " """" " "" "" " " " " " " " " " " " " " " " "" " " " " " " """" " " " """ " " " " " " "" " " "" " " " " "" " "" " " " "" " " " " " " " " """" " " " "" " " """ " " " " " "" " " " " " " "" " " """ " " " " " " " "" " " "" " " " " "" "" " " " " " "" "" " " " " " " " "" " " " "" " " " " " """" "" " " " " "" " " " " " " " """"" " """ " " " " "" " " " " " " " " "" " " " """" "" " " "" """ " L a k e S u sa n D r Rosewood Dr Lake Susan Hil l s D r SuffolkDr L a k e D r W Mergan s e r C t Tern Ct Kingfisher C t L a k e S u s a n C t Essex Rd Thrus h C t H e r o n D r C h a n hassen HillsDrN Barbara Ct Dove Ct F l a m i n g o D r E g ret C t Pelic a n C t Bu r l w o o d D r We s t L a k e D r Powers P l Drake C t West Lake Ct ST17 Po w e r s B l v d µ0 0.05 Mile 0 300 Feet Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 410 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Storm Features: Bluff Creek Estates City of Chanhassen " " " "" " " " " " " " " " " " " " """" " " " " " " " " " " " " " """" " "" "" " "" " " " " " " " "" " " " """ " " "" """ " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " """ "" " " " " " "" " " "" "" " " " " "" " " " " " " " " " " Valley Ridge Ct Osprey L n Au d u b o n R d V alle y V ie w C t HeronDr Valley Ridge Trl S Al i s a L n Valley Ridge Pl Valley Vie w P l Valley Ridge Trl N Al i s a C t Lake Dr W S u n ri d g e C t µ0 0.05 Mile 0 300 Feet Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 411 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Storm Features: Chanhassen Estates City of Chanhassen " " "" " " " " "" " " " " " """" " " " " " " " " " " " " " " " "" " " " " " " " " " " " " " " " " " " " "" " " " " " " " " " " " " " " " "" "" "" " " " " "" " " " " " " "" " "" " " " " " " " " " " " " " " " " "" " " "" " " "" " " " " " " " " """ " Hidden Ln Da k o t a L n A r b o retum Blvd Hidden Ct Da k o t a A v e Lake DrE Cheyenne Spur Eri e S p u r Dakota Cir Er i e A v e Ch e y e n n e A v e SA5 A r b o r e t u m B l v d µ0 0.05 Mile 0 300 Feet Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 412 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Storm Features: W 86th St/Tigua Lane City of Chanhassen " " " " " " " " " " " " " " " """ "" "" " " " " " " " " " "" " """ " " " "" " " " " " " " " " " " " " "" " " " " " " " " " " """ " " " " """ " " " " " " " " "" "" "" " " " " " " "" " " " " " """"" "" " " " " " " " "" " "" " " " "" " "" """" """""" "" " " "" " " "" " " " " " " " " " " " " "" " " " " " " "" "" " """" " " " "" " " " """" " " "" " " " " " " " " " """ " """ " " " " " " " " " " " " " " " " " " " " " M ission Hills D r Mission Hills Way E Mayfield C t F r isco Ct Re f l e c t i o n s R d MissionHills Wa y W Mission Hills Ct W 86th St Rice Ct Mission Hills Ln M o n k C t BlackbirdCt Heartland Ct M i s s i o n H i l l s C i r Marshland Trl T i g u a L n A l d r i c h D r P r e s e r v e C t W aters E d ge D r )212 Gre at Plain s Blv d Hwy 212 ST101 µ0 0.05 Mile 0 300 Feet Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 413 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Water Features: Lake Riley Blvd City of Chanhassen !( !( !( !( !( !(!(!(!( !(!(!( !( !( !( !( !( !(!( !( !( !(!( !( !(!( !( !( !( !( !( !(!( !( !( !( !( !( !( !( !( !( !(!( !( !( !( !( !(!( !( !( !( !( !(!( !( !( !( !( !( !( !(!( !( !( !(!(!( !( !( !( !(!( !( !(!( !(!( !( !( !( !(!( !(!( !( !( !(!( !( !(!(!(!(!(!( !( !( !( !(!( !( !( !( !( !( !( !( !( !( !(!( !( !( !( !( !( !( !( !( !(!(!( !(!( !( !(!(!( !( !( !( !(!( !(!( !(!(!(!( !( !( !( !( !( !( !( !( !( !( !(!( !(!( !( !( !( &( &( &( &( &( &( &(&(&(&( &( &( &( &( &( & & & & && & & & & & & & & & & & & & & & & && & & & L a k e S u s a n D r Rosewood Dr L a k e Susan Hills Dr SuffolkDr L a k e D r W Mergan s e r Ct Tern Ct Kingfis h e r Ct L a k e S u s a n C t Essex Rd Thrus h C t H e r o nDr C h a n hassen HillsDrN Barbara Ct Dove Ct F l a m i n g o D r E gr et C t Pelic a n C t Bu r l w o o d D r WestLake D r Powers P l Drak e Ct West Lake Ct ST17 Po w e r s B l v d Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Affected Valves &Hydrant Valve Affected Water Mains Affected Water Lateral Lines Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 414 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Water Features: Lake Riley Blvd City of Chanhassen !( !( !( !( !( !( !(!( !(!( !( !( !(!(!(!( !( !( !( !( !(!( !( !( !( !( !( !(!( !( !( !( !(!(!(!(!( !( !( !( !( !( !( !( !( !( !(!( !( !( !(!( !( !(!(!( !( !( !( !( !( !( &( &( &( &( &( &( &(&( &( &( &( &( &( &( &(&(&(& & && & && & & & & & & & & & & Valley Ridge Ct Heron Dr Osprey L n V alle y V ie w C t Valley Ri d g e T r l S Al i s a L n Valley Ridge Pl Valley View Pl Valley Ridge Trl N Au d u b o n R d Al i s a C t S u n ri d g e C t Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Butterfly &(Affected Valves &Hydrant Valve Affected Water Lateral Lines Affected Water Mains Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 415 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Water Features: Chanhassen Estates City of Chanhassen !( !(!( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !(!( !( !( !( !( !(!( !( !( !( !( !( !( !( !( !( !( !( !(!( !(!( !( !( !( !( !( !(!( !( !(!(!( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( &(&( &( &( &( &( &( &(&( &( & && & & & & & & & Da k o t a L n A r b o retum Blvd Hidden Ct D a k o ta A ve Lake Dr E Cheyenne Spur Eri e S p u r Dakota Cir Er i e A v e C h e y e n n e A v e SA5 A r b o r e t u m B l v d Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Affected Valves &Hydrant Valve Affected Water Mains Affected Water Lateral Lines Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 416 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Water Features: Lake Riley Blvd City of Chanhassen !( !( !( !( !( !( !( !(!( !( !( !( !( !(!( !( !( !( !(!( !( !( !(!(!( !( !(!(!( !( !( !( !( !(!( !( !( !( !( !(!(!(!( !(!( !( !(!( !( !( !( !( !( !( !( !( !(!( !( !(!( !( !( !( !( !(!( !(!( !( !(!( !( !( !( !( !( !(!( !( !( !( !( !(!(!(!( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !( !(!( &( &( &( &( &( &( &(&( &( & & & & & & & & M ission Hills Dr Mission Hills W a y E Mayfield C t Fr i s c o C t MissionHills Way W Mission Hills Ct W 86th St Rice Ct M issionHills L n M o n k C t BlackbirdCt Heartland Ct M i s s i o n H i l l s C i r M a r s h l a n d Trl T i g u a L n A l d r i c h D r P r e s e r v e C t W aters E d ge D r )212 Gre at Plain s Blv d Hwy 212 ST101 Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Butterfly &(Affected Valves &Hydrant Valve Service Valve Affected Water Mains Affected Water Lateral Lines Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 417 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Sanitary Structures: Lake Susan Hills City of Chanhassen " " " " " " " " " " " " " " " "" " " " """" " " " " " " "" "" "" " " " " " " " "" " " " " " " " "" " " " " """" " " " " " " " "" "" "" " " " " " " " " " " " " " " " " " "" " " " "" """ " " "" " """ " " " """" " " " " " " " " " "" "" " " "" " """""" " " " """" " " " " " " """ " " " """ " " " " " " " " " """" " " "" " """" "" " " " " " """" "" """" " " "" """ " " " " """ " " " """ " " " " " " " "" "" " " "" " " "" " " " " " " " " " " " "" """" "" L a k e S u s a n D r Rosewood Dr La k e S u s a n H i l l s D r SuffolkDr Tern Ct L a k e S u s a n C t H e r o n D r Kingfis h e r Ct E s s e x Rd Thrus h Ct C h a n h assen HillsDrN Barbara Ct Dove Ct Fl a m i n g o D r E g ret C t Pelic a n C t Bu r l w o o d Dr We s t L a k e D r La k e D r W P o w e rs Pl Dr a k e C t West Lake Ct ST17 Po w e r s B l v d Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 418 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Sanitary Structures: Bluff Creek Estates City of Chanhassen " "" " " " " " " """ "" " " "" "" " " " " " " " "" "" " " " " " " " "" " "" " " " " " " "" " " " " " " "" " " " " " " " " " " " """"" " " " " " " " " " " """ "" " " " " " " " " " " """" "" " " " "" " " " " " " " "" " " " " " " """" " "" " " " """" " " "" "" " " "" Valley Ridge Ct Osprey Ln Au d u b o n R d V alle y V ie w C t HeronDr Valley Ridge Trl S Al i s a L n Valley Ridge Pl Valley Vie w P l V a l l e y Ridge Trl N Al i s a C t Lake Dr W S u n ri d g e C t Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 419 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Sanitary Structures: Chanhassen Estates City of Chanhassen " " " " " " " " " " " " " " " " """ " " " " " " " " " " "" " " " " " """" " " " " " """ " "" " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " """ "" " " " " " " " " " " " " " " "" " " " " " " "" " " " " " " " " " " " " " " " """""" " " " " " " "" " " " " " " "" " " " " " " " " " " " " " "" " " " " " " " " " " Da k o t a L n A r b o r etum B l vd H i d d e n Ct LakeDrE Da k o t a A v e Cheyenne Spur Eri e Spu r Dakota Cir E r i e A v e Ch e y e n n e A v e SA5 A r b o r e t u m B l v d Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 420 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-01 Affected Sanitary Structures: W 86th St/Tigua Lane City of Chanhassen "" " " " "" " " " " "" " " " " " " " " " " " "" "" " " """ " " " " " " " "" " " " " " " "" " """ " " " " " " " " " " " " " " " " " " " " " " " " " " " " " " "" " " " " " " " " " """ " " " " " " " "" " " " " " " " " " " " " " " " "" """" " " " " " " " " " " " " " " " " " " "" " " " " "" " " " "Missio n Hills Dr Mission Hills Way E M a yfield C t F r i s co Ct MissionHillsWayW Mission Hills Ct W 86th St R i c e C t M ission Hills Ln M o n k C t BlackbirdCt Heartland Ct M i s s i o n H i l l s C i r Marshland Trl T i g u a L n P r e s e r v e C t A l d r i c h D r W aters E d ge D r )212 Gre at Plain s Blv d Hwy 212 ST101 Date Created: 1/16/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 421 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this ________ day of ___________________, 20__, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and __________________________________________ "Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for_____________________. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for quote – __________________ dated ______, 20___; C. Insurance Certificate; D. Consultant’s ______, 20___ proposal for___________________ (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of __________________ Dollars ($_____, inclusive of expenses. Services performed directly by Consultant shall be paid at an hourly rate in accordance with the Proposal, subject to the not to exceed fee. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 422 2 201749v1 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficien cies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each occurrence/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 423 3 201749v1 11. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 13. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 14. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 15. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 424 4 201749v1 16. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 17. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 18. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 19. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 20. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including pa yment for services performed or furnished to the date and time of termination. Dated: _______________, 20__. CITY OF CHANHASSEN BY: _____________________________________________ Elise Ryan, Mayor BY: _____________________________________________ Laurie Hokkanen, City Manager Dated: _______________, 20__. _______________________ BY: _____________________________________________ Its 425 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this 27th day of April, 2026, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and SHORT ELLIOT HENDRICKSON (SEH) Inc. "Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for engineering design and construction phase professional services for the 2027 City Pavement Rehabilitation Project, City Project No. 27-01. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for Proposal – 2027 City Pavement Rehabilitation Project dated March 20, 2026; C. Insurance Certificate; D. Consultant’s April 10, 2026 proposal for 2027 City Pavement Rehabilitation Project, City Project N. 27-01 (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of four hundred ninety-six thousand eight hundred three Dollars ($496,803.00), inclusive of expenses. Services performed directly by Consultant shall be paid at an hourly rate in accordance with the Proposal, subject to the not to exceed fee. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 426 2 201749v1 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each occurrence/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, 427 3 201749v1 withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 11. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 13. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 14. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 15.PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and 428 4 201749v1 defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 16. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 17. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 18. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 19. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 20. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including payment for services performed or furnished to the date and time of termination. Dated: _______________ CITY OF CHANHASSEN BY: _____________________________________________ Elise Ryan, Mayor BY: _____________________________________________ Laurie Hokkanen, City Manager Dated: _______________ _______________________ BY: _____________________________________________ Its 429 City Council Item April 27, 2026 Item Resolution 2026-XX: Authorize Contract for Engineering Design and Construction Services for the 2027 Lake Riley Blvd Reconstruction Project (27- 02) File No.ENG Project No. 27-02 CIP Project No. ST-012 Item No: D.19 Agenda Section CONSENT AGENDA Prepared By George Bender, Assistant City Engineer Reviewed By Charlie Howley SUGGESTED ACTION "The Chanhassen City Council adopts a resolution authorizing a Professional Services Agreement with Bolton & Menk for engineering design and construction services related to the 2027 Lake Riley Blvd Reconstruction Project." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY Consider authorizing a professional services agreement with Bolton & Menk for engineering design and construction administration services for the 2027 Lake Riley Blvd Reconstruction Project. BACKGROUND As part of the overall Pavement Management Program (PMP), the city annually plans to rehabilitate a section or sections of public streets across the city. The 5-year Capital Improvement Plan (CIP) identifies the near-term streets to be rehabilitated. This 2027 project includes approximately 0.5 miles of city street for reconstruction. 430 Key dates and items relative to this project: On March 11, 2026, the Engineering Department released a Request for Proposals (RFP) for geotechnical services for the 27-01, 27-02, and 27-03 projects. On March 20, 2026, the Engineering Department released a Request for Proposals (RFP) for engineering design and construction services for the 27-02 project. On April 2, 2026, the Engineering Department received 2 proposals for geotechnical professional services related to the 27-01, 27-02, and 27-03 projects. On April 10, 2026, the Engineering Department received 5 proposals for engineering professional services related to the 27-02 project. On April 13, 2026, the City Council approved a Professional Services Agreement with Braun Intertec for geotechnical exploration and engineering services in association with the 27-01, 27- 02, and 27-03 design contracts. DISCUSSION One of the early steps in the overall project development process for our street projects is to engage design consultants regarding the project and establish an agreement with a consultant to support city staff from a workload management perspective. Staff developed a Request for Proposals (RFP) and distributed it to seven (7) qualified consulting firms. Five (5) firms submitted proposals. Staff evaluated the proposals based on the requirements of the RFP, which established the following criteria: Completeness and overall quality of the Proposal, including demonstrating an understanding of the scope and process (35%) Experience and resources of the firm and personnel, including the ability to meet the project schedule (35%) Fee (30%) Comprehensive scores were developed through the review process for each proposal, and a summary of the results of the evaluation are shown in the table below. The overall scoring spreadsheet has also been attached for reference. Firm Fee Overall Score Bolton & Menk $557,417.00 83.2% SEH $498,600.00 82.8% Houston Engineering $617,676.00 80.7% WSB $552,320.00 78.6% ISG $412,860.00 75.0% A cost of $557,417 represents 18.5% of the $3,014,000 project budget. The city will still need to issue a contract for construction materials testing but in conjunction with the $68,000 contract for geotechnical services (20.8% total) this is a reasonable percentage for engineering design and construction professional services for this project. This project is considerably more complex in comparison to the 27-01 project. 431 The overall schedule for the project is as follows: Milestone Task Date Award Consultant Contract April 27, 2026 Accept Feasibility Report; Call Public Hearing September 14, 2026 Neighborhood Project Open House #1 September 16, 2026 Public Hearing regarding Feasibility; Order Project September 28, 2026 Approve Plans and Specifications; Authorize Ad for Bid January 25, 2027 Bid Opening February 18, 2027 Call Assessment Hearing March 8, 2027 Neighborhood Project Open House #2 March 10, 2027 Public Hearing regarding Assessments; Award Construction Contract March 22, 2027 Start Construction May 3, 2027 Substantial Completion October 30, 2027 Final Completion & Begin 2-year warranty period June 9, 2028 BUDGET The overall project budget approved with the 2026-30 Capital Improvement Plan is shown in the table below, and the CIP budgetary sheet from FY 2026 has been attached for reference. The CIP sheet represents both the 27-01 and 27-02. The 27-02 project area (Lake Riley Blvd reconstruction) was split from the 27-01 project areas to insure all of the project areas can be constructed in 2028. Mapping has been attached that identifies the streets proposed to be rehabilitated and/or reconstructed with the 27-01 project. Fund Budget PMP (Street)$1,598,000 Surface Water $1,000,000 Sanitary Sewer $158,000 Watermain $258,000 Total $3,014,000 RECOMMENDATION Staff recommends authorizing a contract with Bolton & Menk in a not-to-exceed amount of $557,417 for engineering design and construction administration services for the 2027 Lake Riley Blvd Reconstruction Project. ATTACHMENTS Resolution Proposal Evaluation Summary for 27-02 27-01 and 27-02 Combined CIP Budget 432 5-Year CIP Map for Streets - 2026-2030 All Maps for 27-02 RFP 27-02 RFP with Exhibits PROFESSIONAL SERVICES AGREEMENT for 27-02 433 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 27, 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION AUTHORIZING ENTERING INTO A PROFESSIONAL SERVICES AGREEMENT WITH BOLTON & MENK FOR ENGINEERING DESIGN AND CONSTRUCTION SERVICES RELATED TO THE 2027 LAKE RILEY BLVD RECONSTRUCTION PROJECT NO. 27-02 WHEREAS, the City has a Pavement Management Program (PMP) that is supported by the 5-yr Capital Improvement Plan (CIP); and WHEREAS, part of the PMP and CIP is to perform annual rehabilitation of various public streets and related infrastructure; and WHEREAS, this pavement reconstruction project requires professional design services; and WHEREAS, the City solicited proposals from multiple qualified design consulting firms; and WHEREAS, multiple responsive proposals were received and evaluated by City Staff; and WHEREAS, the fee proposed by the highest ranked proposal fits within the established project budget. NOW, THEREFORE, BE IT RESOLVED that the Chanhassen City Council hereby authorizes entering into a Professional Services Agreement with Bolton & Menk for engineering design and construction services related to the 2027 Lake Riley Blvd Reconstruction Project No. 27-02. Passed and adopted by the Chanhassen City Council this 27th day of April, 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 434 Completeness Resources Fee Reviewer #1 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score 35%35%30.0%100.0% SEH 29%27%498,600.00$ 24.8%80.8% Bolton & Menk 31%33%557,417.00$ 22.2%86.2% WSB 27%29%552,320.00$ 22.4%78.4% Houston 33%31%617,676.00$ 20.1%84.1% ISG 25%25%412,860.00$ 30.0%80.0% Reviewer #2 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score SEH 32%32%498,600.00$ 24.8%88.8% Bolton & Menk 35%33%557,417.00$ 22.2%90.2% WSB 32%32%552,320.00$ 22.4%86.4% Houston 32%32%617,676.00$ 20.1%84.1% ISG 32%32%412,860.00$ 30.0%94.0% Reviewer #3 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score SEH 30%29%498,600.00$ 24.8%83.8% Bolton & Menk 32%31%557,417.00$ 22.2%85.2% WSB 29%30%552,320.00$ 22.4%81.4% Houston 32%28%617,676.00$ 20.1%80.1% ISG 22%23%412,860.00$ 30.0%75.0% Reviewer #4 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score SEH 27%27%498,600.00$ 24.8%78.8% Bolton & Menk 30%25%557,417.00$ 22.2%77.2% WSB 27%30%552,320.00$ 22.4%79.4% Houston 33%30%617,676.00$ 20.1%83.1% ISG 25%25%412,860.00$ 30.0%80.0% Reviewer #5 Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score SEH 32%25%498,600.00$ 24.8%81.8% Bolton & Menk 33%22%557,417.00$ 22.2%77.2% WSB 25%20%552,320.00$ 22.4%67.4% Houston 29%23%617,676.00$ 20.1%72.1% ISG 28%20%412,860.00$ 30.0%78.0% Average between all reviewers Completeness & Quality of Proposal Resources & Personnel Total Cost Fees Overall Score 35%35%30.0%100.0% SEH 30%28%498,600.00$ 24.8%82.8% Bolton & Menk 32%29%557,417.00$ 22.2%83.2% WSB 28%28%552,320.00$ 22.4%78.6% Houston 32%29%617,676.00$ 20.1%80.7% ISG 23%22%412,860.00$ 30.0%75.0% Notes: 2027 Lake Riley Blvd Reconstruction Project (Project No. 27-02) Completeness and quality of the proposal including a demonstrated understanding of the scope as it relates to the stated goals of the project and conformance with the RFP. This includes separation from other proposals by identifying specific items important to this City project. (35%) Resources of firm and experience of key personnel identified to perform the scope of services and the firm's ability to meet the project schedule. This includes past performance on similar projects and experience on previous City of Chanhassen projects. (35%) Cost to perform all items identified to be completed within the RFP. (30%) Green = Received Proposal Total cost for ISG was increased by $70,270 to compare all proposals fairly Total cost for B&M was increased by $13,527 to compare all proposals fairly Kimley-Horn and Stantec elected to not submit on this RFP 435 Streets - 2027 Street Improvements Overview Request Owner Charlie Howley, PW Director/City Engineer Department Annual Pvmnt Mgmt Contracted Form Type Capital Improvement Request Type Street Construction/Reconstruction Project Number ST-012-2027 Description The 5-year Capital Pavement Management Plan identifies the planned streets for the next five years. The Plan is updated every fall to review priorities and needs, but generally intends to keep the overall condition index (OCI) average across all streets at 70 or higher. The City uses a Pavement Management System in Cartegraph to monitor the condition of City streets. While proper preventative maintenance extends the life of the street and is cost-effective, a street will eventually deteriorate to a point that major maintenance is required. Rehabilitation projects exited the life of the street. In cases when utilities or poor subgrade needs to be replaced or where streets have deteriorated to a point where rehabilitation will no longer be practical, reconstruction of the street is necessary. A feasibility study is written to consider the merits of the project, scope of work, costs, and assessments. The City has an Assessment Policy that identifies what and how much of the project is assessed to benefiting properties. Details Type of Project Resurface Current Road 436 Capital Cost Breakdown Capital Cost FY2027 Total Engineering $730,000 $730,000 Construction/Maintenance $6,625,000 $6,625,000 Total $7,355,000 $7,355,000 Capital Cost Total Budget (all years) $7.355M Project Total $7.355M Capital Cost by Year Construction/Maintenance Engineering 2027 $7,355,000.00 $0 $2M $4M $6M Capital Cost for Budgeted Years TOTAL $7,355,000.00 Construction/Maintenance (90%)$6,625,000. Engineering (10%)$730,000.00 437 Funding Sources Breakdown Funding Sources FY2027 Total Streets - PMP Funds $2,875,000 $2,875,000 Streets - PMP Assessments $1,920,000 $1,920,000 Utility Fund - Water $775,000 $775,000 Utility Fund - Sewer $475,000 $475,000 Utility Fund - SW Mgmt $1,310,000 $1,310,000 Total $7,355,000 $7,355,000 Funding Sources Total Budget (all years) $7.355M Project Total $7.355M Funding Sources by Year Streets - PMP Assessments Streets - PMP Funds Utility Fund - Sewer Utility Fund - SW Mgmt Utility Fund - Water 2027 $7,355,000.00 $0 $2M $4M $6M Funding Sources for Budgeted Years TOTAL $7,355,000.00 Streets - PMP Assessments (26%)$1,920,000.0 Streets - PMP Funds (39%)$2,875,000.00 Utility Fund - Sewer (6%)$475,000.00 Utility Fund - SW Mgmt (18%)$1,310,000.00 Utility Fund - Water (11%)$775,000.00 438 ## ## ########### ##### ### ### # # # ## ##### # ## # # ## ## # ###### # # ### # # #### # # ##### # # # # ## ## ## # # Lake Virginia Christmas Lake Lotus Lake Brendan Pond Lake Harrison Kerber Pond Lake Susan Rice Marsh Lake Lake Riley Rice Lake Lake St. Joe Lake Minnewashta Lake Ann Lake Lucy ST18 ST14 ST15 ST17 ST61 Minnewashta Regional Park North Lotus Lake Park Meadow Green Park Lake Ann Park Chanhassen Pond Park Chanhassen Nature Preserve Chanhassen Recreation Center Lake Susan Park Rice Marsh Lake Preserve Power Hill Park Fox Woods Preserve Bandimere Community Park Bluff Creek Golf Course Hesse Farm Park Preserve Lake Susan Preserve City Center Park Raguet Wildlife Management Are MN Valley National Wildlife Re MN Landscape Arboretum Seminary Fen Scientific & Nat* Bluff Creek Preserve Independent School District 11 Independent School District 112 Independent School District 276 Riley Ridge Park Lake Ann Park Preserve SA5 SA7 SA5 SA101 SA5 SA41 )212 P o w e r s Blvd Hw y 2 1 2 Au d u b o n R d Cha nha s s e n Rd Arboretum Blvd Pioneer Trl Galpin Bl v d Lyman Blvd Ha z e l t i n e B l v d M a r k e t Bl v d Po w e r s B l v d Hwy 7 F l y i n g C l o u d D r G reat Pl a insBlvd Arbo r e t u m B l v d C o R d 1 0 1 ST101 ST101 Date Created: 12/8/2025 Do c u m e n t P a t h : K: \ D e p a r t m e n t s \ E n g i n e e r i n g \ C I P \ 2 0 2 6 - 2 0 3 0 \ C I P _ 5 Y e a r _ 2 0 2 6 - 2 0 3 0 . a p r x Created By: City of Chanhassen - Engineering Department µ0 3,000 Feet 0 0.5 Mile 5-Year CIP Pavement Management Plan (PMP) - Streets (2026-2030) City of Chanhassen Legend Mill & Overlay Full Depth Reclamation ## ##Reconstruction 2026 2027 2028 2029 2030 439 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Street Details: Lake Riley Blvd City of Chanhassen | | | | Lake Riley S h o r e v i e w C t Parkland Way S pr i n g f i e l d D r G re e nleaf Ct ReflectionsRd Greenview Dr Chesterfield L n S u n n y v ale Dr Kiow a T r l Lyman Blvd La k e R i l e y B l v d Sum merfield D r DeerfootTrl Riley Ridge Park As-Built: 77-02 & 93-32B Installed: 10-03-1977 Inspection PCI: 18.8 Inspection Date: 06-26-2024 As-Built: 77-02 & 93-32B Installed: 06-01-1977 Inspection PCI: 17.87 Inspection Date: 06-26-2024 Date Created: 1/15/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 440 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Water Features: Lake Riley Blvd City of Chanhassen !( !( !( !( !( !( !( !( !( !(!( !( !( !( !( !( !( !(!( !(!( !(!( !(!( !( !( !( !( !( !( !( !( !( !( !( !(!(!( !( !(!(!( !(!( !( !( !( !(!( !( !( !(!( !( !( !( !(!( !( !(!(!(!( !( !(!( !( !( !( !( &( &( &( &( &(& & & & & & & S h o r e v i e w C t Overlook Ct Parkland Way Sprin g f i e l d D r G reenleaf Ct ReflectionsR d G r e e n v i ew Dr Chesterfield Ln S u n n y v a l e D r Lyman Blvd LakeRileyBlvd Kiow a T r l Su m m erfield Dr Deerfoot Trl Date Created: 12/11/2025 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Affected Valves &Hydrant Valve Affected Water Mains Affected Water Lateral Lines Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 441 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Sanitary Structures: Lake Riley Blvd City of Chanhassen "" " " " " "" "" " """ """" " " " " """ """ " " " " " " """ "" " "" " """ " " "" " """" " """" " " """"" "" " " " "" "" " "" " " " " " " " " """""""""""""""" "" " " " " " " " " " " " " " " " " " " " " " " " " " " """ " " " " " " " " " " " """ " " " " " " " " " " " " "" " " S h o r e v i e w C t Parkland Way S p r i n g f i e l d D r G re e nleaf C t ReflectionsRd Greenvie wDr Chesterfield L n S u n n y v a l e Dr Kiowa Trl L y ma n B l v d La k e R i l e y B l v d Su m m erfield Dr Deerfoot Trl Date Created: 12/11/2025 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 442 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Storm Features: Lake Riley Blvd City of Chanhassen " " " " " " "" " " " " " " "" " " " " " " " " " " " " " " " " " " " " " " " " " " " "" "" "" " "" " " " " " " " """"""" " " " " " " " " " "" "" "" " " """ " " " " " " " """ " " " " """ "" " " S h o r e v i e w C t Parkland Way S p r i n g f i e l d D r G r e e nleaf Ct ReflectionsR d Greenview Dr Chesterfield Ln S u n n y v a l e D r K i o w aTrl Lyman Blvd La k e R i l e y B l v d Su m merfieldDr Deerfoot Trl µ0 0.05 Mile 0 300 Feet Date Created: 12/11/2025 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 443 3/20/2026 Request for Proposals 2027 Lake Riley Blvd Reconstruction Project City Project N. 27-02 Distribution Date: March 20, 2026 I. INTRODUCTION The City of Chanhassen is issuing this Request for Proposals (RFP) for design and construction phase professional services of approximately 0.5 miles of city street reconstruction. In general, this project includes: public engagement, preliminary engineering, feasibility study preparation, surveying, streetview video creation, preliminary and final design, permitting, preparation of contract documents, right-of-way acquisition assistance (if needed), construction materials testing RFP preparation assistance, bid administration, construction administration, construction inspection and staking, warranty assistance, as-built drawings preparation, and project closeout. A. RFP Content. This RFP contains the following sections: I. Introduction II. Project Information III. Proposal Requirements B. Addenda/Clarifications. Any changes to this RFP will be made by written addendum. Verbal modification will not be binding. C. Pre-Contractual Expenses. The city will not be responsible for any pre-contractual expenses. Pre-contractual expenses are defined as expenses incurred by the Consultant in: 1. Preparing its proposal in response to this RFP; 2. Submitting that proposal to the City; 3. Negotiating with the City any matter related to this RFP; or 4. Any other expenses incurred by the Consultant prior to the date of execution of the Professional Services Agreement. D. Contract Award. 1. Consultant shall be required to enter into the City’s standard Professional Services Agreement (attached for reference). 2. Issuance of this RFP and receipt of proposals does not commit the City to award a contract. The City reserves the right to postpone opening for its own convenience, to accept or reject any or all proposals received in response to this RFP, to negotiate with other than the selected Consultant should negotiations with the selected consultant be 444 3/20/2026 put on hold or terminated, to negotiate with more than one Consultant simultaneously, or to cancel all or part of this RFP. E. Contact Person. The Consultant's contact for specific questions regarding information in this RFP is: George Bender, PE Assistant City Engineer City of Chanhassen 7700 Market Boulevard Chanhassen, MN 55317 (952) 227-1164 gbender@chanhassenmn.gov II. PROJECT INFORMATION A. Project Area and Identified Improvements. Approximately 0.5 miles of roadway is proposed to be reconstructed within this residential area within Chanhassen. The area proposed for improvements is shown in the attached Figures. • There are existing lake homes along Lake Riley Blvd that County records indicate were constructed in 1950. Historical aerial imagery indicates the original gravel road was constructed between 1945 and 1957. County records also indicate each property was created via a Torres survey. The earliest record drawings the city has regarding Lake Riley Blvd are from 1977. The sanitary sewer system and lift stations were originally constructed at this time. The watermain utility was added in 1993 and this project included the last major street rehabilitation. The street was seal-coated in 2005. There are ~0.47 miles of total public street length within the neighborhood which has initially been programmed to be fully reconstructed. This technique will need to be analyzed and verified by the consultant as the correct approach. • Deerfoot Trail is a private street although the utilities are publicly owned. In general, the consultant shall investigate the street segments as part of the preliminary engineering scope prior to making a recommendation to the City. All project areas including individual street segments need to be evaluated with anticipated improvements to include: • mill and overlay or full depth reclamation (if alternately recommended), • spot soil corrections (if needed along all individual segments), • spot curb and gutter replacement in rehabilitation areas, • full reconstruction if needed due to soil correction or drainage needs, • new curb and gutter with drain tile plus aggregate layers in reconstruction areas, • trail and sidewalk improvements, • ADA improvements, • signage and pavement markings, • stormwater management spot repairs in rehabilitation areas, 445 3/20/2026 • complete stormwater and drainage design to current standards and permit requirements • sanitary sewer reconstruction and spot repairs, and, • watermain reconstruction and spot repairs. The design will need to be in conformance with the City’s most recently published or updated Standard Specifications and Detail Plates. The City will be conducting a geotechnical assessment to aid in the analysis of pavement and drainage improvements throughout the project areas and the consultant will be provided the geotechnical report to incorporate with the feasibility study and subsequent design. The draft geotechnical report is expected to be available prior to the 4th of July. The design consultant shall make rehabilitation recommendations from pavement specialists on their team. The $3,014,000 overall project budget will be funded by the city’s Pavement Management Program Fund ($1,598,000) and Utility Enterprise Funds (Sanitary $158,000, Water $258,000, and Surface Water $1,000,000). The PMP Fund receives revenue from the property tax levy, franchise fees and special assessments. Per the City’s current (revised in 2025) Assessment Policy, the City now assesses residential properties based on a flat rate set within the City’s annual Fee Schedule. The preliminary and final assessment rolls will be based on the current Assessment Policy. The consultant will also be required to calculate assessment amounts based on the previous assessment policy which indicated forty percent (40%) of the eligible street costs were proposed to be assessed to the benefiting property owners. This is for comparison purposes between the policy revisions. The City’s current Assessment Policy can be viewed on the City’s website. It was updated on May 5, 2025. The prior policy can be provided upon request. As part of the scope, the Consultant will understand the City’s assessment policy methodology, prepare draft and final assessment rolls, follow the MS 429 assessment process, and respond to concerns raised on an as-needed basis. All cost estimates, bid tabulations and contractor pay applications shall be broken down by source of funding (PMP, Sanitary, Water, and Surface Water). If any of the project areas or work affect adjacent municipality’s, County, or State rights- of-way; the consultant will include any necessary coordination and permitting in their scope. The City will reimburse the consultant for any permitting fees but the consultant should identify any expected fees in their proposal. There is typically a mix of watermain pipe sizes and materials within the project areas’ rights-of-way and public easements. The Consultant shall specify an approach in the proposal to determine if any watermain and/or components should be replaced or improved. The city would prefer not to use the open cut method for replacing any significant lengths of water main in a rehabilitation (i.e. M&O and FDR) area that would not dictate a spot repair. City staff will provide background to help determine if existing bolting, gate valves, curb stops or hydrants need to be replaced. City specification did not begin to require stainless steel bolting on gate valves until ~2003. Hence, it is anticipated the majority of the bolting associated with water valves will require replacement. Consultant staff is also expected to review the existing valving and hydrant locations and make recommendations for adding assets. Curb stops and hydrants will be replaced on an as needed basis. The design consultant shall make rehabilitation recommendations from utility specialists on their team and plan to visit the site to verify recommendations as necessary in conjunction with tree removals and other landscaping impacts. 446 3/20/2026 The City has a policy for replacing any existing cast iron pipe currently in use. The consultant will be required to prepare a complete utility design in any project area being reconstructed including plan and profile views. Cast iron watermain is not expected to be identified within the scoped project areas. If it happens to be identified though then an analysis will need to be completed with respect to rehabilitating or replacing the watermain. The sanitary sewer within this area is minimal and consists of eight-inch (8”) PVC pipe. The City will have the sanitary sewers televised. This information is expected to be available prior to the 4th of July. Generally speaking, the existing sanitary sewer is anticipated to be in adequate condition, however the mains and structures within the project area are to be assessed by the consultant for rehabilitation as needed. The consultant will be provided the videos and inspection reports. The consultant will be expected to review the televising information in detail and subsequently make recommendations by utility specialists on their team to be incorporated in the feasibly study and subsequent design. Additionally, consulting staff with the assistance of city staff will evaluate the sanitary sewer structures for any necessary updates and repairs. Any identified improvements shall be incorporated in the feasibility study and subsequent design. The consultant will be required to prepare utility design in plan and profile views if needed. Upon request, the City can provide access to our GIS system and as-builts to help with comprehension and proposal scoping. The City will televise the storm sewer infrastructure within the project areas. Based on preliminary information, the storm sewer system is generally not expected to be in adequate condition. The City will provide the selected consultant with video footage and inspection reports for review. This information is expected to be available prior to July 4, 2026. Using this information, the consultant’s utility specialists shall evaluate the condition of the existing storm sewer system and provide recommendations to be incorporated into the feasibility study and subsequent design. City staff will also assess storm sewer structures within the project area to identify any repairs or upgrades that may be required, such as the installation of sump manholes. Any improvements identified by City staff will be communicated to the consultant and must be incorporated into the feasibility study and design. The Lake Riley Boulevard neighborhood currently contains very limited stormwater infrastructure. As part of the roadway reconstruction project, a comprehensive reconstruction of the stormwater utility system is anticipated to bring the area into compliance with current City standards. The project area is bordered on the southwest by private streets in the Deerfoot Trail neighborhood and associated private stormwater infrastructure. As a result, the consultant will be expected to review and assess connections between the private systems and the public stormwater network. The design must clearly define the point of connection and establish a clear division of ownership and maintenance responsibility between the private infrastructure and the public stormwater system. 447 3/20/2026 Right-of-way constraints and limited space for stormwater management practices exist throughout the project corridor. Because of these limitations, the consultant may need to evaluate and incorporate a variety of approaches to meet water quality and abstraction requirements. Any proposed stormwater management features must ultimately be designed in a manner that allows the City to own, operate, and maintain them. There may also be an opportunity to rehabilitate an existing stormwater pond within the project area to provide additional water quality treatment, and the consultant should evaluate this option as part of the overall stormwater strategy. Within the Lake Riley Boulevard reconstruction area, the existing storm sewer network and surface water best management practices (BMPs) are minimal and known drainage issues exist within the neighborhood. Addressing these drainage concerns will be a critical component of the project design as well as solving for the existing driveways abutting the street and managing public stormwater. The consultant will be responsible for developing storm sewer, drainage, and erosion control designs that comply with City Code and applicable watershed district regulations. The project will likely trigger stormwater management requirements from the Riley Purgatory Bluff Creek Watershed District, particularly if reconstruction of the intersection of Great Plains Boulevard and Lake Drive East is included in the project scope. These requirements may include, but are not limited to, volume abstraction, Total Suspended Solids (TSS) removal, Total Phosphorus (TP) removal, and discharge rate analysis. As necessary, the consultant will be responsible for developing stormwater treatment strategies and incorporating them into the feasibility study and final design. Close coordination with the watershed district will be essential throughout the project. The consultant should anticipate attending at least two meetings with the watershed district to support stormwater planning through the final design phase. In addition, a preliminary permit application to the watershed district will be required by the 60 percent design submittal stage. The consultant will also be expected to evaluate and address existing stormwater management concerns in areas adjacent to or impacted by the project corridor. Site visits will be necessary to verify existing conditions and to support the development of accurate and practical design recommendations. The City will provide any available HydroCAD models; however, these models only include pond routing and do not incorporate storm sewer piping. The City does not guarantee the completeness or accuracy of the provided models. The consultant shall review current requirements under the National Pollutant Discharge Elimination System (NPDES) Construction Stormwater Permit and applicable watershed district rules. The consultant will determine whether the project exceeds regulatory thresholds and incorporate the required stormwater management improvements into the project design. The consultant shall also prepare a Stormwater Pollution Prevention Plan (SWPPP) if required for the project. 448 3/20/2026 B. Required Project Scope. The objective is to provide a project that is both technically and economically feasible. This project scope in general shall provide the following but also include any effort deemed necessary to produce a completed project: 1. Project Management. 2. Design. a) Coordinate and perform initial site visits of each project area with City Public Works staff. Go through the entire project in the field with the city to obtain information staff is aware of up front. Consultant shall document each concern raised throughout the visits and submit a summary within one week of the field visit. A spreadsheet of these items shall be created for tracking purposes to assure the design addresses each concern. The Consultant is required to bring along and locate via a GPS survey device all curb and gutter and other removals identified in the initial field visit to utilize as a starting point for the necessary design work. The consultant will also detail additional curb removals as needed during the design process to provide a logical end product. b) Preparation of a feasibility report to meet Minnesota State Statutes Chapter 429 requirements. c) Provide a 360-degree video along each street in all project areas. The timing of the data acquisition shall either be prior to design or immediately prior to construction and it shall be on a bright day with the sun near mid-day as to avoid unnecessary shadowing. Notice shall be given to the city ahead of the gathering the data to facilitate communications and street sweeping if necessary. The overall quality of the video delivered shall be detailed enough to help avert construction claims that are brought forth. For example, the imagery shall pick up the cracking within existing curbing and driveways. The information shall be gathered close enough to the curb line and at a slow enough rate to gather high quality, useable data. The ability to pause, rotate, and easily zoom into the imagery shall be a component of the delivered product. The overall functionality and quality shall be equal to or better than ‘Google Streetview’. d) Other site visits shall occur as needed during design to review and identify improvements such as utility repair recommendations, stormwater treatment options, curb replacement, tree and landscaping impacts, private utility conflicts, sidewalk and trail improvements, and other specific restoration needs (driveway pavements, type of turf, irrigation, etc.). The consultant shall plan to coordinate directly with properties impacted by tree removals towards the end of the design process and at the second open house in addition to ahead of physical removal. No tree removal shall come as a surprise to a property owner and the consultant shall strive for this to be a prioritized communication task. The consultant shall track all tree replacement needs via an up-to-date and on- line spreadsheet that can be accessed by the construction team and City staff. e) Meetings as needed with property owners to discuss property impacts such as tree removals, landscaping impacts, or stormwater BMP installations. f) Meetings and coordination with the RPBCWD team as needed to facilitate the stormwater design and secure applicable permits. The consultant shall include in their scope as many meetings as necessary to secure permitting from the 449 3/20/2026 watershed district in a timing manner ahead of construction. The consultant shall plan to meet with the watershed district regularly during design to facilitate this task. g) Preparation of preliminary and final construction plans and documents in conformance with the City’s most recent standard specifications and detail plates as well as the City’s Crosswalk Policy and other communicated design standards. 1. Review and incorporate available information from the existing as- builts into the plans in lieu of solely relying upon GIS. 2. Subsurface utility quality level C shall be required as well as specific private utility relocation plan sheets. City staff can not stress the importance enough in relation to private utility coordination and getting ahead of relocation requests. The consultant shall strive to get ahead of all communication and design needs to facilitate early coordinate with private utility companies and relocation efforts ahead of the Contractor being on-site. 3. Factor scheduling associated with tree removals for requirements associated with Northern Long-Eared Bats and other protected species. 4. Provide draft construction plans at approximately 30%, 60%, 90% and 100% and other review items such as SEQs, OPCC, preliminary and final assessment rolls, etc., to the city utilizing Bluebeam Studio. Responses to all City staff comments provided with review sets shall be addressed with the subsequent update. Consultant shall document their internal QA/QC process prior to review submissions. The plan sheet scale shall be set for all sheets within each Bluebeam session. 5. Construction plan sheets shall have logical match lines within project areas and be grouped by assessable area to facilitate ease of use for Contractors and field personnel. h) Prepare, submit, and obtain all necessary permits in association with the project. The City will be responsible for any costs associated with submission of permits. These costs should be identified and estimated in the proposal but do not need to be included in the Consultant’s final cost. i) Identify areas where right-of-way or easements are required and provide acquisition services, including; parcel exhibits and legal descriptions, obtaining title commitments, right-of-way/easement staking, and property appraisals and reviews. The City Attorney will provide legal documents such as deeds, easements, consents, disclaimers, etc., as required and will also review title work and ensure that all interested parties are defined and listed prior to the consultant meeting with the landowner. City staff will help facilitate and participate in discussions with the landowner. The City will ultimately process all documents that require recording through the City Attorney’s office. Any eminent domain tasks will be provided by the City Attorney, as needed. j) Preparation of preliminary and final assessment rolls. 450 3/20/2026 k) Public engagement support. The level of public engagement during design is to be outlined by the consultant in the work plan of their proposal with any value-added costs identified in the fee spreadsheet. At a minimum, plan for two (2) public open houses and exhibit preparation, routine project webpage updates during design (hosted on the city’s website), and preparation of a mailed resident survey(s) that asks for input around both project wide improvements and property specific impacts. A summarization of all resident input submitted via email, comment cards, resident survey, and other means shall be prepared by the consultant and used as a tracking mechanism during design. The consultant shall follow-up on all individual survey responses as needed. A communication summary shall be coordinated and drafted by the consultant after each open house to add to the City Council agenda item. 3. Bidding. a) Bidding services shall include coordination regarding the advertisement for bid, posting electronic bid documents, answering bidder’s questions, maintaining a bid holder’s list, attending a bid opening at City Hall, tabulating bids and breaking bids down by funding source, analysis, and providing a recommendation. Online bidding will be acceptable, however it is expected that the consultant host the virtual bid opening from City Hall. 4. Design Surveying. a) GIS data will be provided to the Consultant to use as a starting point for a basemap for the design in any proposed rehabilitation (M&O or FDR) areas. Available as-built information will also be provided to the consultant by the City. The Consultant shall obtain supplemental field surveying at select areas of the project as needed in a rehabilitation area and as determined to be necessary during the design phase. Specific data may include tree locations and size for impacted trees, ADA compliance, private utility locations (consultant shall obtain small utility mapping), structure rim and invert elevations, drainage and grade refinements, EOF’s, finished floor elevations, and locating existing right of way and/or easements within the project area. An accurate basemap in CAD format (.dwg) is required to be developed by the consultant that includes updates based on as-built review and field survey information. The Consultant is cautioned not to expect to strictly rely upon GIS information as it is deemed conceptual by City staff and known to have errors. The Consultant shall include an allowance of $50,000 for the cost of field design surveying as needed per the level of effort associated with the rehabilitation design. b) The Consultant shall provide a cost in their proposal for a complete design survey in any reconstruction area. All of the necessary information within the existing right-of-way and easements for the subsequent design shall be gathered. This shall include property corners, topographic data, tree locations and sizes, landscaping, all existing public and private utilities, retaining walls, and other property features as needed. Coordination with the County Surveyor as necessary shall be included in the scope. 451 3/20/2026 5. Meetings. It is anticipated the Consultant shall include time to prepare agenda and minutes, handouts, exhibits, and have key staff attend in person for: a) Three (3) City Council meetings at City Hall. Consultant shall provide information as needed to facilitate preparation of staff reports and Powerpoint presentations for the City Council agenda. b) Two (2) neighborhood informational meetings for the entire project area. c) Two (2) coordination meetings with the watershed districts to confirm design requirements and resolve comments to secure construction permits. d) Staff meetings for design coordination as necessary and as desired by the consultant to facilitate a quality and complete design. These meetings shall typically be held at City Hall but can be held virtually if needed. Routine design meetings should be assumed to take 2+ hours per meeting to coordinate various design details. The consultant shall describe in detail their plan for design and coordination meetings to facilitate a quality product. e) Individual property owner meetings held on-site as needed during design for ROW and easement acquisition, tree removals, BMP placements, and other coordination items to communicate effectively with the residents. Assume ten (10) meetings for this proposal. Note: Individual property owner meetings during construction are expected to be incorporated into the Construction Administration time. f) Preconstruction meeting to be held at Public Works. g) Weekly meetings during construction. Assume eighteen (18) meetings for this proposal. Note: The construction administrator and the inspector shall both attend these meetings. 6. Construction Surveying. a) Consultant shall include an allowance of $30,000 to cover the cost of construction staking as the level of effort cannot be determined at this time. If the consultant does not feel this amount will be sufficient to cover construction staking it should be noted in the proposal and the estimated amount can be discussed and the agreed upon amount can be included in the contract. 7. Construction Administration and Inspection. a) Construction administration services will be required including owner and contractor coordination, submittal review, answering design questions and responding to RFI’s, preparation and review of pay requests by funding category, construction coordination with residents, preparation of weekly project updates, attending weekly meetings including preparation of meeting minutes, monitoring and review of NPDES permit documentation, other permit coordination, negotiating and processing change orders, Spring work the following season, final closeout, and warranty coordination. The consultant shall request submittal review assistance as needed and distribute all approved submittals to the City during construction. The consultant shall maintain and distribute conformed contract documents after the bidding process and throughout construction as major plan updates occur. If the project is utilizing 452 3/20/2026 any Municipal State-Aid funding, the Consultant shall prepare and submit State-aid payment requests periodically on behalf of the city. The construction administration time including is task 7a shall be in addition to time allocated in tasks 7b (construction inspection) and 8 (project close-out) in this RFP. b) Construction inspection services shall include time on-site to monitor the construction, perform utility coordination, coordinate with residents as necessary, track quantities, attend weekly coordination meetings, coordinate with the City’s staff as needed, prepare daily reports, monitor all BMPs associated with the SWPPP and document compliance, and generally work with the Contractor. The inspector shall document and track all private utility interruptions and hits caused by the project via an up-to-date spreadsheet that can be accessed by City staff. The Consultant should include an allowance of 1000 hours of inspection time in 2027 in their proposal for the primary inspector. An allowance of an additional 100 inspection hours shall be reserved for the following Spring to follow-up on punch list items, wear course paving (if necessary), restoration, and closing-out the project. The consultant shall also perform inspections as needed through the warranty period in addition to coordinating with the contractor to ensure items are adequately communicated and repairs are completed. An allowance of an additional 50 hours shall be reserved for warranty period efforts. The primary inspector shall be certified through MnDOT certification classes including ADA certification in addition to the Erosion and Stormwater Management program through the University of Minnesota. This certification information should be indicated on the proposed inspector’s resume included within the proposal as part of the key personnel. The primary project inspector shall have a minimum of five (5) full years of construction experience. Completed daily reports for the past month shall be submitted with each contractor pay application or consultant monthly invoice. c) The consultant shall factor adjusted billing rates into the proposal for any necessary rate increases for construction time expended throughout the contract. The billing rates for all construction staff will not be allowed to be adjusted during the project because it would reduce the allotted amount of hours planned to complete the work. This is not intended to apply to design staff for work between Fall 2026 and Winter 2027 prior to the project being awarded by the City Council to a contractor. d) The city will contract separately for geotechnical support and materials testing during construction, however the consultant will coordinate and review all testing with the selected geotechnical firm during construction. The Consultant will provide testing quantity information based to the city based on the design as part of their scope for inclusion in the material testing RFP. 8. Preparation of as-built drawings and project closeout. a) Draft as-builts shall be completed and submitted to the city after the project is substantially complete and within the winter season following construction. The as-built requirements shall comply with section 9.19 of the City’s General Conditions. 453 3/20/2026 b) Provide completed MnDOT ADA Compliance Checklists with the final as- builts. c) The consultant shall coordinate all final documentation required to close out the construction contract. d) Final as-built information and all other final documentation shall be provided no later than 45 days after the final construction pay request has been approved. e) Time within task 8 shall be calculated separate from time included within Task 7b. C. Project Goals. The goals of the project are as follows, in no particular order of importance. These goals support the City’s Strategic Priorities. 1. Develop an appropriate pavement rehabilitation technique that meets design budget. (Financial Sustainability and Asset Management) 2. Incorporate appropriate improvements to public utilities and systems in the vicinity of the project by leveraging the opportunity of the street rehabilitation. (Asset Management) 3. Implement a project schedule that leverages an advantageous bidding climate. (Financial Sustainability) 4. Preparation of contract documents to a level of detail that meets City standards, minimizes cost and schedule risk exposure to the City, and clearly addresses impacts to private property. (Financial Sustainability, Asset Management and Operational Excellence) 5. Proactive communication with impacted residents and property owners. (Communication and Operational Excellence) 6. Develop trust between City and Consultant; and between City and Residents. (Communication and Operational Excellence) D. Project Schedule. The following is the estimated project schedule: Distribute RFP Proposal Submissions Award Consultant Contract at City Council Accept Feasibility Report; Call Public Hearing Neighborhood Project Open House Public Hearing on Feasibility; Order Project Approve Plans & Specifications, Authorize Ad Bid Opening Call Assessment Hearing Neighborhood Meeting Assessment Hearing; Award Contract March 20, 2026 April 10, 2026 April 27, 2026 September 14, 2026 September 16, 2026 September 28, 2026 January 25, 2027 February 18, 2027 March 8, 2027 March 10, 2027 March 22, 2027 454 3/20/2026 Start Construction Substantial Construction Complete Final Completion May 3, 2027 September 25, 2027 June 9, 2028 III. PROPOSAL A. Delivery of Proposals All proposals must be emailed to Assistant City Engineer George Bender at: gbender@chanhassenmn.gov All proposals must be received no later than 4:00 p.m. (central time) on Friday, April 10, 2026. Late proposals will not be considered. B. Proposal shall include at a minimum, the following: 1. Identification of the offering firm, including name, address and telephone number. 2. Acknowledgement of receipt of RFP addenda, if any. 3. Name, title, address, email address and telephone numbers of contact person during period of proposal evaluation. 4. Identify key team members and areas of responsibility, include resumes. 5. A brief, concise work plan that demonstrates the Consultant's understanding of the project and what needs to be done to successfully complete the scope of work, including overall project schedule. Special consideration will be giving for innovative public engagement during both design and construction phases. 6. A detailed not-to-exceed cost breakdown, in spreadsheet format, for performing the work including time and hourly rates for each named team member, permit fees, materials, equipment, and subcontractors required, if any. Costs shall be broken out into areas as indicated in Section II, Paragraph B. The estimate shall clearly identify any proposed alternates and reimbursable expenses as well as any deviations from the requirements of this RFP. 7. Other services outside the scope of this proposal that the firm feels may be needed, if any. The Consultant may also may propose cost-savings items or deviations from the requirements of the RFP which may be considered an advantage to the City. Any modifications or deviations shall be noted separately in the proposal and not part of the overall not-to-exceed fee. 8. Any exceptions to the requirements in this RFP, including the language in the contractual terms, must be included in the proposal. If the Consultant proposes any changes to the scope of work or requirements detailed within the RFP, include a description, reason for the change and added/deducted engineering costs. Segregate all exceptions as a separate element of the proposal under the heading "Exceptions and Deviations". C. Proposal Evaluation Proposals will be evaluated based on the following criteria: 455 3/20/2026 1. Completeness and quality of the proposal including a demonstrated understanding of the scope as it relates to the stated goals of the project and conformance with the RFP. (35%) 2. Resources of firm and experience of key personnel identified in the proposal to perform the complete scope of services and the firm’s ability to meet the project schedule. Proposed personnel and their availability shall be clear within the proposal. Experience includes past performance on similar projects and experience on previous City of Chanhassen projects. (35%) Please note when the City evaluates the personnel proposed to be utilized on the project it becomes assumed these personnel will be available to work on the project based on the availability identified in the proposal. If project personnel needs to be modified by the selected consultant – the City reserves the right to approve the proposed changes. The consultant shall communicate the need for the requested modification and explain any effects on the project for City consideration and approval. 3. Fee. (30%) Interviews are not anticipated to be utilized as part of proposal evaluation process but the City reserves the right to interview firms to make a determination regarding the final selection. 456 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Street Details: Lake Riley Blvd City of Chanhassen | | | | Lake Riley S h o r e v i e w C t Parkland Way S pr i n g f i e l d D r G re e nleaf Ct ReflectionsRd Greenview Dr Chesterfield L n S u n n y v ale Dr Kiow a T r l Lyman Blvd La k e R i l e y B l v d Sum merfield D r DeerfootTrl Riley Ridge Park As-Built: 77-02 & 93-32B Installed: 10-03-1977 Inspection PCI: 18.8 Inspection Date: 06-26-2024 As-Built: 77-02 & 93-32B Installed: 06-01-1977 Inspection PCI: 17.87 Inspection Date: 06-26-2024 Date Created: 1/15/2026 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Legend ||Pavement Segment 457 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Water Features: Lake Riley Blvd City of Chanhassen !( !( !( !( !( !( !( !( !( !(!( !( !( !( !( !( !( !(!( !(!( !(!( !(!( !( !( !( !( !( !( !( !( !( !( !( !(!(!( !( !(!(!( !(!( !( !( !( !(!( !( !( !(!( !( !( !( !(!( !( !(!(!(!( !( !(!( !( !( !( !( &( &( &( &( &(& & & & & & & S h o r e v i e w C t Overlook Ct Parkland Way Sprin g f i e l d D r G reenleaf Ct ReflectionsR d G r e e n v i ew Dr Chesterfield Ln S u n n y v a l e D r Lyman Blvd LakeRileyBlvd Kiow a T r l Su m m erfield Dr Deerfoot Trl Date Created: 12/11/2025 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Water Infrastructure Inside Project Area Affected Curb Boxes Affected Hydrants &(Affected Valves &Hydrant Valve Affected Water Mains Affected Water Lateral Lines Water Infrastructure Outside Project Area Water Hydrants !(Water System Valves Water Curb Box Water Lateral Lines Water Mains 458 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Sanitary Structures: Lake Riley Blvd City of Chanhassen "" " " " " "" "" " """ """" " " " " """ """ " " " " " " """ "" " "" " """ " " "" " """" " """" " " """"" "" " " " "" "" " "" " " " " " " " " """""""""""""""" "" " " " " " " " " " " " " " " " " " " " " " " " " " " """ " " " " " " " " " " " """ " " " " " " " " " " " " "" " " S h o r e v i e w C t Parkland Way S p r i n g f i e l d D r G re e nleaf C t ReflectionsRd Greenvie wDr Chesterfield L n S u n n y v a l e Dr Kiowa Trl L y ma n B l v d La k e R i l e y B l v d Su m m erfield Dr Deerfoot Trl Date Created: 12/11/2025 Created By: City of Chanhassen - Engineering Departmentµ0 0.05 Mile 0 300 Feet Sanitary Infrastructure Inside Project Area Affected Manholes Affected Lift Station "Affected Sewer Main "Affected Sewer Force Mains Sanitary Infrastructure Outside Project Area Sewer Force Mains Sewer Network Structures Sewer Manholes "Sewer Gravity Mains 459 Do c u m e n t P a t h : K : \ D e p a r t m e n t s \ E n g i n e e r i n g \ P r o j e c t s \ 2 7 - 0 1 \ 2 7 - 0 1 C i t y P a v e m e n t R e h a b . a p r x 27-02 Affected Storm Features: Lake Riley Blvd City of Chanhassen " " " " " " "" " " " " " " "" " " " " " " " " " " " " " " " " " " " " " " " " " " " "" "" "" " "" " " " " " " " """"""" " " " " " " " " " "" "" "" " " """ " " " " " " " """ " " " " """ "" " " S h o r e v i e w C t Parkland Way S p r i n g f i e l d D r G r e e nleaf Ct ReflectionsR d Greenview Dr Chesterfield Ln S u n n y v a l e D r K i o w aTrl Lyman Blvd La k e R i l e y B l v d Su m merfieldDr Deerfoot Trl µ0 0.05 Mile 0 300 Feet Date Created: 12/11/2025 Created By: City of Chanhassen - Engineering Department Storm Infrastructure Inside Project Area Manholes Inlets Outlets Mains Culverts Basins Storm Infrastructure Outside Project Area Outlets Inlets Manholes Culverts "Mains 460 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this ________ day of ___________________, 20__, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and __________________________________________ "Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for_____________________. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for quote – __________________ dated ______, 20___; C. Insurance Certificate; D. Consultant’s ______, 20___ proposal for___________________ (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of __________________ Dollars ($_____, inclusive of expenses. Services performed directly by Consultant shall be paid at an hourly rate in accordance with the Proposal, subject to the not to exceed fee. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 461 2 201749v1 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficien cies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each occurrence/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 462 3 201749v1 11. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 13. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 14. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 15. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 463 4 201749v1 16. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 17. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 18. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 19. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 20. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including pa yment for services performed or furnished to the date and time of termination. Dated: _______________, 20__. CITY OF CHANHASSEN BY: _____________________________________________ Elise Ryan, Mayor BY: _____________________________________________ Laurie Hokkanen, City Manager Dated: _______________, 20__. _______________________ BY: _____________________________________________ Its 464 1 201749v1 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this 27th day of April, 2026, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City") and BOLTON & MENK Inc. "Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for engineering design and construction phase professional services for the 2027 Lake Riley Blvd Reconstruction Project, City Project No. 27-02. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Professional Services Agreement; B. Request for Proposal – 2027 Lake Riley Blvd Reconstruction Project dated March 20, 2026; C. Insurance Certificate; D. Consultant’s April 10, 2026 proposal for 2027 Lake Riley Blvd Reconstruction Project (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of five hundred fifty-seven thousand four hundred seventeen Dollars ($557,417.00), inclusive of expenses. Services performed directly by Consultant shall be paid at an hourly rate in accordance with the Proposal, subject to the not to exceed fee. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Payment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 465 2 201749v1 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker’s Compensation Acts, automobile liability, and from claims for bodily injury, death, or property damage which may arise from the performance of services under this Agreement. Such insurance shall be written for amounts not less than: Commercial General Liability $2,000,000 each occurrence/aggregate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each occurrence/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, equipment, and incidentals necessary for Consultant’s performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant’s own FICA payments, workers compensation payments, unemployment compensation payments, 466 3 201749v1 withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 11. SUBCONTRACTORS. Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes § 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 13. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Consultant receives a request to release data, Consultant must immediately notify City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 14. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 15. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemnify and 467 4 201749v1 defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 16. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 17. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 18. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 19. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 20. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including payment for services performed or furnished to the date and time of termination. Dated: _______________ CITY OF CHANHASSEN BY: _____________________________________________ Elise Ryan, Mayor BY: _____________________________________________ Laurie Hokkanen, City Manager Dated: _______________ _______________________ BY: _____________________________________________ Its 468 City Council Item April 27, 2026 Item Resolution 2026-XX: Authorize Submission for Carver County Community Development Agency Community Growth Partnership Initiative (CGPI) Redevelopment Assistance Grant Application File No.Item No: D.20 Agenda Section CONSENT AGENDA Prepared By Sam DiMaggio, Economic Development Manager Reviewed By SUGGESTED ACTION "The Chanhassen City Council adopts the Resolution Authorizing Submission for Carver County Community Development Agency Community Growth Partnership Initiative (CGPI) Redevelopment Grant Application." Motion Type Simple Majority Vote of members present Strategic Priority Financial Sustainability SUMMARY City staff identified the Carver County Community Development Agency (CDA) Community Growth Partnership Initiative (CGPI) Community Development Redevelopment Grant as a potential funding source to help offset eligible redevelopment costs associated with proposed reinvestment and tenant- focused improvements at the West One Building in downtown Chanhassen. BACKGROUND The Hansen family, owners of the West One Building (7900 Kerber Blvd) located in downtown Chanhassen, has approached the city regarding their planned redevelopment of the property. Following recent tenant turnover and ownership consolidation, the property owners are pursuing a reinvestment strategy intended to modernize and reposition the building for a mix of small businesses, creative 469 enterprises, and community-serving uses. Preliminary concept plans provided by the applicants include proposed improvements for a new coworking and community-focused space called Wonder Haus, along with updated tenant spaces for Dandy Lion Coffee, Hansen Builders, Sky Candy Studios, and existing youth-oriented uses. Additional prospective tenants, such as fitness, wellness, and childcare providers, are also being evaluated as part of the long-term multi-tenant vision. The proposed redevelopment would repurpose an existing underutilized building and is anticipated to require significant interior and exterior rehabilitation, code compliance upgrades and site improvements (i.e., stormwater, parking, sidewalks, etc.). The applicants estimate over $1 million in private investment, including tenant improvements, exterior upgrades, and activation of community-oriented space. Because several of the anticipated improvements may qualify as eligible redevelopment activity, such as rehabilitation, potential demolition or clearance, environmental or code-related upgrades and site improvements, the property owners have requested that the city consider submitting a Community Growth Partnership Initiative (CGPI) Community Development Redevelopment Grant Application to the Carver County Community Development Agency (CDA) on their behalf. This application allows the city to seek funding to offset extraordinary redevelopment costs, while supporting reinvestment in an existing commercial building consistent with ongoing downtown revitalization and placemaking efforts. At this stage, the applicants have provided conceptual plans, renderings, and preliminary project descriptions, and are working to compile additional information needed for the CGPI review process. DISCUSSION Additional city approvals and permits are required before this project can be implemented. The ownership is aware of these requirements. BUDGET There is no budget impact to the city; the grant requires $2 in private or other funds for every $1 in grant funds. RECOMMENDATION Staff recommends the adoption of the attached resolution. ATTACHMENTS Resolution 2026-XX WestOne Concept Image WestOne Concept Image 2 Parking Concept - NOT APPROVED 470 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 13, 2026 _____________RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION APPROVING THE SIGNATURE OF THE APPLICATION TO THE CARVER COUNTY COMMUNITY DEVELOPMENT AGENCY FOR A GRANT FUNDING THROUGH THEIR COMMUNITY GROWTH PARTNERSHIP INITIATIVE WHEREAS, the City of Chanhassen has identified a proposed project within the city that meets the Carver County Community Development Agency (“ CDA”) Community Growth Partnership Initiative Grant (“CGPI”) program’s purpose and criteria; and WHEREAS, the City of Chanhassen has identified economic development technology tools and systems to improve its ability to attract industry and support economic growth; and WHEREAS, the City of Chanhassen has the capacity and capability to ensure the proposed technological assistance will be completed and administered within the CGPI guidelines; and WHEREAS, the City of Chanhassen has the legal authority to apply for financial assistance; and WHEREAS, the City of Chanhassen is supportive of affordable housing and of the CDA’s mission to improve the lives of Carver County residents through affordable housing and community development. NOW, THEREFORE, BE IT RESOLVED that the City Council of the City of Chanhassen approves the application for funding from the Carver County CDA Growth Partnership Initiative Grant program. BE IT FURTHER RESOLVED that if the application is approved by the Carver County CDA, the City of Chanhassen, the Community Development Director, Eric Maass, is hereby authorized to execute such agreements as are necessary to receive and use the funding for the proposed project. 471 PASSED AND ADOPTED by the Chanhassen City Council on this 13th day of April 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 472 473 474 475 City Council Item April 27, 2026 Item 2026 Quarter One Fire Department Update File No.Item No: F.1 Agenda Section FIRE DEPARTMENT/LAW ENFORCEMENT UPDATE Prepared By Andrew Heger, Fire Chief Reviewed By SUGGESTED ACTION Receive the 2026 quarter one fire department update. Motion Type N/A Strategic Priority Operational Excellence SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION ATTACHMENTS 476 City Council Item April 27, 2026 Item Resolution 2026-XX: Accept the Bids and Award the Contract for the 2026 City Pavement Rehabilitation Project; and Resolution 2026-XX: Adopt Final Assessment Roll for the 2026 City Pavement Rehabilitation Project File No.ENG Project No. 26-01 CIP No. ST-012 Item No: G.1 Agenda Section PUBLIC HEARINGS Prepared By George Bender, Assistant City Engineer Reviewed By Charlie Howley SUGGESTED ACTION "The Chanhassen City Council adopts a resolution accepting the bids and awarding the construction contract, and also adopts a resolution adopting the assessment roll for the 2026 City Pavement Rehabilitation Project No 26-01." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY Conduct Public (Assessment) Hearing for the 2026 City Pavement Rehabilitation Project No. 26-01. Adopt the final assessment roll for the project. Accept the bids and award the project to a contractor. BACKGROUND As part of the overall Pavement Management Program (PMP), the city annually plans to rehabilitate a section or sections of public streets across the city. The Five-year Capital Improvement Plan (CIP) identifies the near-term streets to be rehabilitated. This 2026 project includes approximately 2.2 miles of city streets for rehabilitation. 477 Key dates and items relative to this project: In November 2024, the city created a project page and email subscription list. On June 13, 2025, the Engineering Department released a Request for Proposals (RFP) for design and construction services for the 26-01 project. On June 20, 2025, the Engineering Department released a Request for Proposals (RFP) for geotechnical services for the 26-01 project. On July 14, 2025, the City Council approved a Professional Services Agreement with Houston Engineering, Inc. for design and construction services for the 26-01 project. On July 14, 2025, the City Council approved a Professional Services Agreement with Braun Intertec for geotechnical exploration and engineering services in association with the 26-01 design contract. On November 10, 2025, the City Council called for a Public Hearing to be held regarding the proposed improvements on November 24, 2025. On November 19, 2025, the Engineering Department and Houston Engineering hosted a public Open House meeting at City Hall to discuss the project and respond to questions with the impacted properties. Riley Purgatory Bluff Creek Watershed District staff also attended this meeting and presented on the proposed project within North Lotus Lake Park. Approximately 73 residents attended and 20 comment cards were received. On November 24, 2025, the City Council accepted the feasibility study, conducted a Public Hearing related to the proposed improvements, and authorized the preparation of plans and specifications for the 26-01 project. On February 17, 2025, the Engineering Department and Houston Engineering hosted a pop-up meeting for the property owners in the Fox Hollow neighborhood to specifically discuss the proposed alignment of the portion of Fox Hollow Dr between Pleasantview Rd and the cul-de-sac near the tennis courts. Approximately 43 residents attended and 6 comment cards were received. On March 9, 2026, the City Council accepted the plans and specifications and authorized the advertisement for bids for the 26-01 project. On March 31, 2026, Houston Engineering and the Engineering Department hosted a bid opening. On April 13, 2026, The City Council called for a Public Hearing regarding the proposed assessments to be held on April 27, 2026. On April 14, 2026, the Engineering Department hosted a second public open house for the project in the training room at City Hall. Project information is available on the city's website at: https://www.chanhassenmn.gov/government/projects/street-projects/2026-city-pavement-rehabilitation- project 478 To subscribe to the city's distribution list in order to receive routine project updates via email - interested residents and property owners should visit the following link to sign up: https://www.chanhassenmn.gov/i-want-to/subscribe. As of April 22, 2026, there are 732 email addresses subscribed to receive project updates. DISCUSSION The 26-01 project area is shown in the attached 5-year Capital Improvement Plan (CIP) map representing the years 2026 through 2030. The CIP is the planned sequence of pavement rehabilitation projects based on the annual budgeted pavement rehabilitation funding that strives to meet the city's goal of having an average overall condition index (OCI) at or above 70 across the city's local and municipal state-aid (MSA) street pavements. The OCI is currently at an average rating of 76 across all of the city's local and MSA streets indicating the designated goal is currently being met. Two neighborhood areas are proposed to be rehabilitated with the 26-01 project. The Fox Hollow neighborhood area has approximately 1.3 miles of existing streets being proposed to be rehabilitated while the Vasserman Ridge neighborhood area has approximately 0.9 miles of existing streets being proposed to be rehabilitated. Houston Engineering was provided the city's asset management and geotechnical information relative to this project to factor into the feasibility analysis to incorporate with the subsequent design. Based on the existing maintenance and rating history, on-site street observations, and the feasibility analysis - the following recommendations in the subsequent paragraphs are being proposed. The Fox Hollow development was originally constructed in phases between 1985 and 1988 except for Fox Dr. These streets were seal coated in 2006. Fox Dr was originally constructed in 2005 and seal- coated in 2015. Fox Hollow Ct is also within this neighborhood area but it is a private street. Fox Hollow Ct is not proposed to be rehabilitated. The largest infrastructure issue with this neighborhood is lack of drainage, primarily in the street pavement section. This area is scoped to be a reconstruction project except for Fox Dr which is proposed to be a mill and overlay. The Vasserman Ridge development was originally constructed in phases between 2002 and 2004. This area is scoped to be a mill and overlay. The approved plans and specifications were bid on March 31, 2026. Three responsive bids were received from contractors. The bids ranged from $6,218,794.49 to $6,598,439.25. The Engineer's Estimate for the bid was $7,772,680.00. There weren't any alternates bid with this project. The low contractor for the base bid was GMH Asphalt. GMH Asphalt last performed the City's annual pavement rehabilitation project in 2022. GMH's work associated with the 2022 project was acceptable. GMH is also performing the contractor pothole patching work for Public Works this year. The bid tabulation has been attached. SCHEDULE The remaining schedule for the project is as follows: Task Date Begin Construction Mid-May 2026 Substantial Completion Early November 2026 Final Completion June 2027 479 Final assessment notices were sent out to all assessable properties per the required MS 429 process on April 9, 2026. The final assessment amounts contained within the notices are related to the flat fee amounts associated with each type of pavement rehabilitation per the City's 2026 fee schedule. These amounts are $2,940 for a mill & overlay (M&O), $5,150 for an FDR, and $9,550 for a full reconstruction. The proposed assessment amounts for each project area are as follows: Project Area Preliminary Assessment Amount Final Assessment Amount Vasserman Ridge Area (M&O)$2,940 $2,940 Fox Hollow Area (Reconstruction) except Fox Dr (M&O) $9,550 (Reconstruction) & $2,940 (M&O) $9,550 & $2,940 (6 properties along Fox Dr) BUDGET This project is included in the 5-year CIP and the budget for 2026. Funding for the project is budgeted to come from the Pavement Management Program (PMP) fund, which includes special assessments to benefiting properties as part of the revenue source. The special assessments are being managed per the City’s Assessment Policy. Utility Enterprise funds will be utilized to cover the rehabilitation needs specific to each utility. The overall 26-01 project budget approved with the 2025-29 Capital Improvement Plan is $8,755,000. The table below indicates the estimated cost in comparison to the project budget: Fund Project Budget Fox Hollow Area Bid Costs Vasserman Ridge Area Bid Costs Total Project Costs (with Engineering) PMP (Street)$4,835,000 $3,354,600.25 $498,677.45 $4,335,833 Surface Water $2,130,000 $758,789.64 $46,971.00 $906,668 Sanitary Sewer $800,000 $237,724.00 $105,774.00 $386,515 Watermain $990,000 $1,208,661.15 $7,597.00 $1,368,573 Total $8,755,000 $5,559,775.04 $659,019.45 $6,997,589 The low bid amount has a total of $6,218,794.49. Engineering costs are expected to be $778,794.00 which is 11% of the construction cost which is a good percentage relative to the engineering effort. Based on the bid amount and engineering costs the project is expected to finish under budget by $1,757,411. The watermain fund is overbudget by approximately $160,000, but the costs have been reduced significantly from the feasibility estimate. As a reminder the existing watermain is being fully replaced with this project in the Fox Hollow area due to the break history. RECOMMENDATION 480 Staff recommends the City Council adopt the resolution accepting the bids and approving a construction contract to GMH Asphalt Corp. for the bid amount. Staff recommends the City Council adopt the resolution adopting the final assessment rolls for the 2026 City Pavement Rehabilitation Project No. 26-01. ATTACHMENTS Resolution 2026-XX Accept Bids & Award Contract 26-01 Resolution 2026-XX Adopt Assessment Roll 26-01 Bid Tabulation for 26-01 Project 26-01 Pavement Rehab Property Assessment Roll - Both Areas - Final. Assessment Policy - 2025 Update Assessment FAQ PMP FAQ 5-Year CIP Map for Streets for 2026-2030 CIP Budgetary Sheet for 26-01 Project Presentation 481 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 27, 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION ACCEPTING THE BIDS AND AWARDING A CONTRACT FOR THE 2026 CITY PAVEMENT REHABILITATION PROJECT NO. 26-01 WHEREAS, pursuant to an advertisement for bids for Project No. 26-01 (2026 City Pavement Rehabilitation Project), bids were received, opened, and tabulated according to law, and the following bids were received complying with the advertisement: Bidder Bid Amount GMH Asphalt, Corp. $6,218,794.49 S.M. Hentges & Sons, Inc. $6,530,078.75 Northwest Asphalt, Inc. $6,598,439.25 WHEREAS, GMH Asphalt, Corp. is the lowest responsible bidder with a bid amount to be awarded of $6,218,794.49; NOW THEREFORE, BE IT RESOLVED by the Chanhassen City Council: 1. The Mayor and Clerk are hereby authorized and directed to enter into a contract with GMH Asphalt Corp. in the name of the City of Chanhassen for the 2026 City Pavement Rehabilitation Project No. 26-01 according to the plans and specifications therefore approved by the City Council and on file in the office of the City Clerk. 2. The City Clerk is hereby authorized and directed to return forthwith to all bidders the deposits made with their bids, except that the deposits of the successful bidder and the next lowest bidder shall be retained until a contract has been signed. PASSED AND ADOPTED by the Chanhassen City Council this 27th day of April, 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 482 1 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 27, 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION ADOPTING ASSESSMENT ROLL FOR THE 2026 CITY PAVEMENT REHABILITION PROJECT NO. 26-01 WHEREAS, pursuant to proper notice duly given as required by law, the Council has met and heard and passed upon all objections to the proposed assessment for the improvement of the project area contained within the: 2026 City Pavement Rehabilitation Project No. 26-01 NOW THEREFORE, BE IT RESOLVED by the City Council of Chanhassen, Minnesota: 1. Such proposed assessment, a copy of which is attached hereto and made a part hereof, is hereby accepted and shall constitute the special assessment against the lands named therein, and each tract of land therein included is hereby found to be benefited by the proposed improvement in the amount of the assessment levied against it. 2. Assessments between $0 and $500 shall be paid within 1 year. Assessments above $501.00 and at or under $2,500.00 shall be payable in equal annual installments extending over a period of five (5) years. Assessments above $2501.00 and at or under $5,000.00 shall be payable in equal annual installments extending over a period of eight (8) years. Assessments above $5,001.00 and at or under $15,000.00 shall be payable in equal annual installments extending over a period of ten (10) years. Assessments $15,001.00 and above shall be payable in equal annual installments extending over a period of fifteen (15) years. The first of the installments to be payable on or before the first Monday in January, 2027, and shall bear interest at the rate of 5.285 percent (5.285%) per annum. This assessment will appear on the first property tax statement for 2027. To the first installment shall be added interest on the entire assessment from November 21, 2026 until December 31, 2026. To each subsequent installment, when due, shall be added interest for one year on all unpaid installments. 3. The owner of any property so assessed may, at any time prior to certification of the assessment to the county auditor, pay the assessment on such property, with interest accrued to the date of payment, to the city treasurer, except that no interest shall be charged if the assessment is paid by November 20, 2026; and the owner may, at any time thereafter, pay to the city treasurer the entire amount of the assessment remaining unpaid, with interest accrued to December 31 of the year in which such payment is made. Such payment must be made before November 15 or interest will be charged through December 31 of the next succeeding year. If the property owner decides not to prepay the assessment before the date given above, the rate of interest that will apply shall be 5.285 percent (5.285%) per year. 483 2 4. The clerk shall forthwith transmit a certified duplicate of this assessment to the county auditor to be extended on the property tax lists of the County. Such assessments shall be collected and paid over in the same manner as other municipal taxes. PASSED AND ADOPTED by the Chanhassen City Council this 27th day of April, 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor 484 Item Code Item Description UofM Quantity Unit Price Extension Unit Price Extension Unit Price Extension Unit Price Extension 1 MOBILIZATION Lump Sum 1 $335,000.00 $335,000.00 $125,000.00 $125,000.00 $163,231.19 $163,231.19 $317,212.00 $317,212.00 2 CONSTRUCTION ENTRANCE Each 2 $2,000.00 $4,000.00 $750.00 $1,500.00 $6,200.00 $12,400.00 $1,750.00 $3,500.00 3 CLEARING AND GRUBBING Sq. Yd. 80 $65.00 $5,200.00 $193.00 $15,440.00 $40.00 $3,200.00 $38.50 $3,080.00 4 REMOVE TREES Each 14 $1,500.00 $21,000.00 $550.00 $7,700.00 $700.00 $9,800.00 $715.00 $10,010.00 5 STREET SWEEPING (WITH PICKUP BROOM) Hrs. 80 $200.00 $16,000.00 $195.00 $15,600.00 $220.00 $17,600.00 $200.00 $16,000.00 6 FULL DEPTH RECLAMATION (INCL. SAWCUT) Sq. Yd. 20320 $4.00 $81,280.00 $5.30 $107,696.00 $2.00 $40,640.00 $0.95 $19,304.00 7 REMOVE BITUMINOUS TRAILS & DRIVEWAYS (INCL. SAWCUT) Sq. Yd. 2000 $5.00 $10,000.00 $8.45 $16,900.00 $10.00 $20,000.00 $7.22 $14,440.00 8 REMOVE CONCRETE PAVEMENT (INCL. SAWCUT) Sq. Yd. 680 $16.00 $10,880.00 $21.00 $14,280.00 $14.00 $9,520.00 $14.45 $9,826.00 9 REMOVE CONCRETE CURB & GUTTER (INCL. SAWCUT) Lin. Ft. 11300 $8.00 $90,400.00 $3.20 $36,160.00 $2.00 $22,600.00 $5.78 $65,314.00 10 SAW AND SEAL EXISTING CURB Each 4 $250.00 $1,000.00 $15.85 $63.40 $60.00 $240.00 $16.50 $66.00 11 2" MILL BITUMINOUS SURFACE (INCL. SAWCUT) Sq. Yd. 1440 $3.00 $4,320.00 $2.50 $3,600.00 $2.95 $4,248.00 $4.13 $5,947.20 12 TEMPORARY MAILBOXES Lump Sum 1 $2,500.00 $2,500.00 $8,968.00 $8,968.00 $9,000.00 $9,000.00 $9,350.00 $9,350.00 13 SALVAGE MAILBOX/POST/GROUPING Each 105 $75.00 $7,875.00 $132.00 $13,860.00 $130.00 $13,650.00 $137.50 $14,437.50 14 INSTALL SALVAGED MAILBOX/POST/GROUPING Each 105 $150.00 $15,750.00 $185.00 $19,425.00 $185.00 $19,425.00 $192.50 $20,212.50 15 EXCAVATION - COMMON (P) Cu. Yd. 24800 $20.00 $496,000.00 $36.75 $911,400.00 $28.00 $694,400.00 $27.99 $694,152.00 16 SELECT GRANULAR BORROW Ton 18690 $20.00 $373,800.00 $20.65 $385,948.50 $15.00 $280,350.00 $15.52 $290,068.80 17 SALVAGE & INSTALL RECLAMATION MATERIAL (CV) Cu. Yd. 4520 $20.00 $90,400.00 $27.40 $123,848.00 $107.00 $483,640.00 $35.20 $159,104.00 18 AGGREGATE BASE COURSE CLASS 5 Ton 10250 $35.00 $358,750.00 $12.05 $123,512.50 $0.10 $1,025.00 $25.78 $264,245.00 19 AGGREGATE SURFACING COURSE CLASS 2 Ton 5 $35.00 $175.00 $81.00 $405.00 $120.00 $600.00 $85.50 $427.50 20 3" MINUS AGGREGATE Ton 300 $70.00 $21,000.00 $31.45 $9,435.00 $45.00 $13,500.00 $34.85 $10,455.00 21 BITUMINOUS TRAILS & DRIVEWAYS PATCH (SPWEA340B) Ton 460 $120.00 $55,200.00 $181.00 $83,260.00 $150.00 $69,000.00 $201.61 $92,740.60 22 BITUMINOUS WEAR (SPWEA340C) Ton 2720 $110.00 $299,200.00 $98.00 $266,560.00 $97.44 $265,036.80 $92.16 $250,675.20 23 BITUMINOUS NON-WEAR (SPNWB330C) Ton 2540 $105.00 $266,700.00 $84.55 $214,757.00 $86.02 $218,490.80 $82.95 $210,693.00 24 BITUMINOUS MATERIAL FOR TACK COAT Gal. 1240 $8.00 $9,920.00 $3.50 $4,340.00 $0.01 $12.40 $4.00 $4,960.00 25 BITUMINOUS RAMP CURB EDGE (see note below) Lin. Ft. 12170 $2.00 $24,340.00 $10.00 $121,700.00 $8.75 $106,487.50 $12.71 $154,680.70 26 SURMOUNTABLE CONCRETE CURB & GUTTER Lin. Ft. 10890 $30.00 $326,700.00 $21.25 $231,412.50 $19.85 $216,166.50 $20.30 $221,067.00 27 CONCRETE CURB & GUTTER DESIGN B612 Lin. Ft. 160 $40.00 $6,400.00 $28.50 $4,560.00 $33.92 $5,427.20 $29.70 $4,752.00 28 CONCRETE CURB & GUTTER DESIGN B618 Lin. Ft. 1120 $30.00 $33,600.00 $21.25 $23,800.00 $37.19 $41,652.80 $20.30 $22,736.00 29 CONCRETE CURB DESIGN V Lin. Ft. 118 $40.00 $4,720.00 $42.20 $4,979.60 $47.97 $5,660.46 $44.00 $5,192.00 30 6" CONCRETE WALK/DRIVEWAY PATCH & PED. RAMPS Sq. Yd. 730 $80.00 $58,400.00 $87.70 $64,021.00 $101.27 $73,927.10 $84.15 $61,429.50 31 TRUNCATED DOMES Sq. Ft. 38 $75.00 $2,850.00 $52.75 $2,004.50 $65.00 $2,470.00 $55.00 $2,090.00 32 SALVAGE AND REINSTALL PAVER DRIVEWAY Sq. Yd. 13 $100.00 $1,300.00 $209.00 $2,717.00 $340.00 $4,420.00 $317.00 $4,121.00 33 TEMPORARY TRAFFIC CONTROL Lump Sum 1 $25,000.00 $25,000.00 $2,638.00 $2,638.00 $14,600.00 $14,600.00 $2,695.00 $2,695.00 34 STORM DRAIN INLET PROTECTION Each 45 $250.00 $11,250.00 $217.00 $9,765.00 $550.00 $24,750.00 $300.00 $13,500.00 35 SEED 25-141 WITH HYDRAULIC MATRIX MULCH Acre 0.5 $10,000.00 $5,000.00 $20,418.00 $10,209.00 $6,500.00 $3,250.00 $10,000.00 $5,000.00 36 SEED 25-151 WITH HYDRAULIC MATRIX MULCH Acre 1 $10,000.00 $10,000.00 $25,806.00 $25,806.00 $5,000.00 $5,000.00 $10,000.00 $10,000.00 37 SODDING TYPE LAWN Sq. Yd. 2600 $20.00 $52,000.00 $11.40 $29,640.00 $12.00 $31,200.00 $21.00 $54,600.00 38 PLANT TREE (3") Each 13 $750.00 $9,750.00 $739.00 $9,607.00 $800.00 $10,400.00 $750.00 $9,750.00 39 COMMON TOPSOIL BORROW (LV) Cu. Yd. 700 $40.00 $28,000.00 $53.45 $37,415.00 $42.00 $29,400.00 $58.75 $41,125.00 40 LANDSCAPING RESTORATION Allowance 1 $25,000.00 $25,000.00 $25,000.00 $25,000.00 $25,000.00 $25,000.00 $25,000.00 $25,000.00 41 IRRIGATION AND PET CONTAINMENT SYSTEMS REPAIRS Allowance 1 $30,000.00 $30,000.00 $30,000.00 $30,000.00 $30,000.00 $30,000.00 $30,000.00 $30,000.00 42 INSTALL SIGN Each 23 $225.00 $5,175.00 $317.00 $7,291.00 $210.00 $4,830.00 $275.00 $6,325.00 43 SIGN PANEL SQ. FT. 47 $40.00 $1,880.00 $52.75 $2,479.25 $44.00 $2,068.00 $49.50 $2,326.50 44 24" SOLID LINE MULTI COMP GR IN Lin. Ft. 26 $20.00 $520.00 $21.10 $548.60 $21.00 $546.00 $14.30 $371.80 45 4" NON-PERF PVC PIPE DRAIN Lin. Ft. 1100 $40.00 $44,000.00 $9.80 $10,780.00 $22.00 $24,200.00 $18.50 $20,350.00 46 4" PERF PVC SDR 35 PIPE DRAIN Lin. Ft. 11490 $60.00 $689,400.00 $11.15 $128,113.50 $14.00 $160,860.00 $19.25 $221,182.50 47 DRAIN SUMP BASIN Each 111 $400.00 $44,400.00 $494.00 $54,834.00 $780.00 $86,580.00 $560.00 $62,160.00 48 4" SOLID LINE MULTI COMP Lin. Ft. 366 $8.00 $2,928.00 $6.05 $2,214.30 $3.15 $1,152.90 $6.60 $2,415.60 49 PVMT MESSAGE ADA SYMBOL MULTI COMP Each 1 $250.00 $250.00 $158.00 $158.00 $160.00 $160.00 $495.00 $495.00 50 PVMT MESSAGE “ NO PARKING" MULTI COMP Each 1 $150.00 $150.00 $158.00 $158.00 $160.00 $160.00 $495.00 $495.00 51 SALVAGE STREET SIGN Each 9 $75.00 $675.00 $26.40 $237.60 $42.00 $378.00 $55.00 $495.00 52 INSTALL SALVAGED STREET SIGN Each 9 $150.00 $1,350.00 $317.00 $2,853.00 $210.00 $1,890.00 $192.50 $1,732.50 $4,021,388.00 $3,354,600.25 $3,284,245.65 $3,472,307.40 2026 City Pavement Rehabilitation, City Project No. 26-01 FOX HOLLOW-REMOVALS, GRADING, PAVING, AND RESTORATION GMH Asphalt CorporationEngineer Estimate NorthwestS.M. Hentges & Sons, Inc. Owner: City of Chanhassen, MN Engineer: Houston Engineering Inc. 03/31/2026 10:00 AM CDT 485 Item Code Item Description UofM Quantity Unit Price Extension Unit Price Extension Unit Price Extension Unit Price Extension 1 REMOVE EXISTING MANHOLE Each 19 $1,600.00 $30,400.00 $871.00 $16,549.00 $600.00 $11,400.00 $650.00 $12,350.00 2 REMOVE EXISTING STORM SEWER Lin. Ft. 1568 $15.00 $23,520.00 $13.00 $20,384.00 $18.00 $28,224.00 $24.50 $38,416.00 3 REMOVE AND DISPOSE FES SEDIMENT DELTA Cu. Yd. 220 $40.00 $8,800.00 $38.60 $8,492.00 $46.00 $10,120.00 $77.00 $16,940.00 4 EXCAVATION - COMMON (for BMP) (P) Cu. Yd. 3200 $20.00 $64,000.00 $24.50 $78,400.00 $20.00 $64,000.00 $6.00 $19,200.00 5 4" PVC NON-PERFORATED Lin. Ft. 216 $50.00 $10,800.00 $10.90 $2,354.40 $22.00 $4,752.00 $20.00 $4,320.00 6 4" PVC PERFORATED Lin. Ft. 90 $50.00 $4,500.00 $13.00 $1,170.00 $12.00 $1,080.00 $36.50 $3,285.00 7 10" PVC NON-PERFORATED Lin. Ft. 16 $100.00 $1,600.00 $70.60 $1,129.60 $75.00 $1,200.00 $39.25 $628.00 8 15" RC PIPE SEWER CLASS V Lin. Ft. 1453 $120.00 $174,360.00 $48.20 $70,034.60 $84.00 $122,052.00 $69.00 $100,257.00 9 18" RC PIPE SEWER CLASS V Lin. Ft. 626 $130.00 $81,380.00 $51.05 $31,957.30 $82.00 $51,332.00 $73.00 $45,698.00 10 21" RC PIPE SEWER CLASS IV Lin. Ft. 869 $170.00 $147,730.00 $62.45 $54,269.05 $82.00 $71,258.00 $77.50 $67,347.50 11 30" RC PIPE SEWER CLASS IV Lin. Ft. 116 $225.00 $26,100.00 $114.00 $13,224.00 $139.00 $16,124.00 $120.00 $13,920.00 12 15" HDPE PIPE SEWER Lin. Ft. 184 $100.00 $18,400.00 $53.60 $9,862.40 $47.00 $8,648.00 $53.25 $9,798.00 13 24" HDPE PIPE SEWER Lin. Ft. 244 $140.00 $34,160.00 $80.70 $19,690.80 $59.00 $14,396.00 $68.50 $16,714.00 14 51" SPAN RC PIPE-ARCH SEWER CLASS V Lin. Ft. 182 $180.00 $32,760.00 $216.00 $39,312.00 $238.00 $43,316.00 $215.00 $39,130.00 15 51" SPAN RC PIPE-ARCH APRON Each 1 $10,000.00 $10,000.00 $2,567.00 $2,567.00 $2,700.00 $2,700.00 $2,285.00 $2,285.00 16 30" RC PIPE APRON Each 2 $8,500.00 $17,000.00 $1,902.00 $3,804.00 $1,600.00 $3,200.00 $1,470.00 $2,940.00 17 21" RC PIPE APRON Each 1 $7,000.00 $7,000.00 $1,404.00 $1,404.00 $1,100.00 $1,100.00 $1,195.00 $1,195.00 18 INSTALL 48" MANHOLE Each 27 $7,000.00 $189,000.00 $4,486.00 $121,122.00 $4,450.00 $120,150.00 $4,405.00 $118,935.00 19 INSTALL 60" MANHOLE Each 3 $8,000.00 $24,000.00 $5,619.00 $16,857.00 $6,360.00 $19,080.00 $6,000.00 $18,000.00 20 INSTALL 84" MANHOLE Each 1 $15,000.00 $15,000.00 $8,433.00 $8,433.00 $11,100.00 $11,100.00 $8,885.00 $8,885.00 21 INSTALL 60" SUMP MANHOLE Each 5 $12,000.00 $60,000.00 $7,378.00 $36,890.00 $8,700.00 $43,500.00 $7,120.00 $35,600.00 22 INSTALL 84" SUMP MANHOLE Each 1 $20,000.00 $20,000.00 $12,571.00 $12,571.00 $18,300.00 $18,300.00 $12,585.00 $12,585.00 23 INSTALL 2'X3' CATCH BASIN Each 16 $4,500.00 $72,000.00 $3,294.00 $52,704.00 $3,200.00 $51,200.00 $3,545.00 $56,720.00 24 RECONSTRUCT MANHOLE Each 4 $3,000.00 $12,000.00 $3,432.00 $13,728.00 $3,600.00 $14,400.00 $2,825.00 $11,300.00 25 INSTALL NEW CASTING ASSEMBLY AND RINGS Each 7 $2,000.00 $14,000.00 $1,861.00 $13,027.00 $1,500.00 $10,500.00 $1,195.00 $8,365.00 26 RIPRAP CL III Cu. Yd. 220 $150.00 $33,000.00 $120.00 $26,400.00 $175.00 $38,500.00 $152.00 $33,440.00 27 INFILTRATION SYSTEM TESTING Allowance 1 $4,000.00 $4,000.00 $4,000.00 $4,000.00 $4,000.00 $4,000.00 $4,000.00 $4,000.00 28 BIO-FILTRATION BASIN - NORTH LOTUS LAKE PARK Lump Sum 1 $9,000.00 $9,000.00 $12,753.00 $12,753.00 $7,300.00 $7,300.00 $5,500.00 $5,500.00 29 BIO-FILTRATION BASIN - CURB CUT Lump Sum 1 $5,000.00 $5,000.00 $11,474.00 $11,474.00 $4,800.00 $4,800.00 $4,500.00 $4,500.00 30 CURB OPENING INLET WITH STONE SPLASH BLOCK ASSEMBLY Each 1 $6,500.00 $6,500.00 $3,154.00 $3,154.00 $4,100.00 $4,100.00 $2,500.00 $2,500.00 31 PERENNIAL PLUGS ( for BMP) Each 200 $10.00 $2,000.00 $9.50 $1,900.00 $13.50 $2,700.00 $20.00 $4,000.00 32 SILT FENCE; TYPE HI (for BMP) Lin. Ft. 2000 $4.00 $8,000.00 $5.55 $11,100.00 $2.50 $5,000.00 $3.95 $7,900.00 33 SEDIMENT CONTROL LOGS TYPE STRAW Lin. Ft. 215 $6.00 $1,290.00 $4.45 $956.75 $4.00 $860.00 $4.50 $967.50 34 ROLLED EROSION PREVENTION CATEGORY 25 (for BMP) Sq. Yd. 12070 $3.50 $42,245.00 $2.23 $26,916.10 $3.00 $36,210.00 $2.50 $30,175.00 35 SEED SOUTHERN SHORT GRASS Acre 1.2 $10,000.00 $12,000.00 $1,638.00 $1,965.60 $5,000.00 $6,000.00 $5,000.00 $6,000.00 36 SEED WET DITCH Acre 0.48 $10,000.00 $4,800.00 $3,618.00 $1,736.64 $5,500.00 $2,640.00 $5,000.00 $2,400.00 37 24" RC PIPE SEWER CLASS IV Lin. Ft. 91 $150.00 $13,650.00 $71.40 $6,497.40 $98.00 $8,918.00 $100.00 $9,100.00 $1,239,995.00 $758,789.64 $864,160.00 $775,296.00 1 REMOVE SANITARY SEWER PIPE Lin. Ft. 200 $20.00 $4,000.00 $76.70 $15,340.00 $100.00 $20,000.00 $65.00 $13,000.00 2 INSTALL NEW CASTING ASSEMBLY AND RINGS Each 38 $2,000.00 $76,000.00 $2,420.00 $91,960.00 $1,600.00 $60,800.00 $2,062.00 $78,356.00 3 8" X 4" PVC WYE Each 1 $1,000.00 $1,000.00 $586.00 $586.00 $1,200.00 $1,200.00 $2,850.00 $2,850.00 4 8" PVC SDR 26 PIPE SEWER Lin. Ft. 200 $100.00 $20,000.00 $114.00 $22,800.00 $365.00 $73,000.00 $287.65 $57,530.00 5 SEWER PIPE JOINT SEALING Each 1 $2,500.00 $2,500.00 $3,798.00 $3,798.00 $6,500.00 $6,500.00 $2,750.00 $2,750.00 6 REPAIR MANHOLE: GROUT/SEAL MANHOLE JOINTS & REBUILD INVERT Each 12 $2,500.00 $30,000.00 $7,556.00 $90,672.00 $7,400.00 $88,800.00 $6,935.00 $83,220.00 7 RECONSTRUCT MANHOLE Each 8 $3,000.00 $24,000.00 $1,571.00 $12,568.00 $3,300.00 $26,400.00 $2,780.00 $22,240.00 $157,500.00 $237,724.00 $276,700.00 $259,946.00 FOX HOLLOW-STORM SEWER GMH Asphalt CorporationEngineer Estimate NorthwestS.M. Hentges & Sons, Inc. FOX HOLLOW-SANITARY SEWER 486 Item Code Item Description UofM Quantity Unit Price Extension Unit Price Extension Unit Price Extension Unit Price Extension 1 REMOVE GATE VALVE AND BOX Each 31 $500.00 $15,500.00 $245.00 $7,595.00 $200.00 $6,200.00 $172.00 $5,332.00 2 REMOVE HYDRANT Each 14 $900.00 $12,600.00 $734.00 $10,276.00 $300.00 $4,200.00 $450.00 $6,300.00 3 REMOVE WATER MAIN Lin. Ft. 6341 $20.00 $126,820.00 $16.35 $103,675.35 $12.00 $76,092.00 $10.50 $66,580.50 4 REMOVE WATER SERVICE (INCLUDES PIPE, FITTINGS, CURB STOP, AND BOX) Each 110 $350.00 $38,500.00 $245.00 $26,950.00 $100.00 $11,000.00 $207.00 $22,770.00 5 ABANDON WATER MAIN Lin. Ft. 240 $18.00 $4,320.00 $17.50 $4,200.00 $23.00 $5,520.00 $11.00 $2,640.00 6 TEMPORARY WATER SERVICE LS 1 $50,000.00 $50,000.00 $44,798.00 $44,798.00 $74,000.00 $74,000.00 $111,000.00 $111,000.00 7 6" GATE VALVE & BOX Each 23 $3,200.00 $73,600.00 $3,115.00 $71,645.00 $2,900.00 $66,700.00 $3,287.00 $75,601.00 8 8" GATE VALVE & BOX Each 10 $4,000.00 $40,000.00 $4,460.00 $44,600.00 $3,800.00 $38,000.00 $4,225.00 $42,250.00 9 8" WET TAP AND GATE VALVE Each 1 $6,500.00 $6,500.00 $8,512.00 $8,512.00 $8,000.00 $8,000.00 $8,600.00 $8,600.00 10 HYDRANT Each 15 $10,500.00 $157,500.00 $9,036.00 $135,540.00 $7,600.00 $114,000.00 $7,400.00 $111,000.00 11 CURB STOP Each 110 $1,000.00 $110,000.00 $949.00 $104,390.00 $1,100.00 $121,000.00 $695.00 $76,450.00 12 CORPORATION STOPS Each 110 $525.00 $57,750.00 $535.00 $58,850.00 $760.00 $83,600.00 $400.00 $44,000.00 13 1" PE WATER SERVICE PIPE Lin. Ft. 4650 $35.00 $162,750.00 $26.90 $125,085.00 $28.00 $130,200.00 $59.00 $274,350.00 14 TREE REMOVAL (WATER SERVICE REPLACEMENT CONTINGENT) Each 26 $1,500.00 $39,000.00 $1,541.00 $40,066.00 $900.00 $23,400.00 $1,400.00 $36,400.00 15 PLANT TREE (3") (WATER SERVICE REPLACEMENT CONTINGENT) Each 26 $750.00 $19,500.00 $739.00 $19,214.00 $800.00 $20,800.00 $750.00 $19,500.00 16 6" PVC WATERMAIN Lin. Ft. 1631 $90.00 $146,790.00 $47.50 $77,472.50 $81.00 $132,111.00 $51.00 $83,181.00 17 8" PVC WATERMAIN Lin. Ft. 4546 $100.00 $454,600.00 $58.55 $266,168.30 $90.00 $409,140.00 $59.00 $268,214.00 18 WATERMAIN DIP FITTINGS Lbs. 5140 $15.00 $77,100.00 $11.60 $59,624.00 $0.10 $514.00 $18.00 $92,520.00 $1,592,830.00 $1,208,661.15 $1,324,477.00 $1,346,688.50 $7,011,713.00 $5,559,775.04 $5,749,582.65 $5,854,237.90 1 MOBILIZATION Lump Sum 1 $35,000.00 $35,000.00 $12,500.00 $12,500.00 $80,000.00 $80,000.00 $100,000.00 $100,000.00 2 CONSTRUCTION ENTRANCE Each 2 $2,000.00 $4,000.00 $750.00 $1,500.00 $6,200.00 $12,400.00 $1,750.00 $3,500.00 3 STREET SWEEPING (WITH PICKUP BROOM) Hrs. 40 $200.00 $8,000.00 $195.00 $7,800.00 $220.00 $8,800.00 $200.00 $8,000.00 4 2" MILL BITUMINOUS SURFACE (INCL. SAWCUT) Sq. Yd. 15510 $3.00 $46,530.00 $1.50 $23,265.00 $1.80 $27,918.00 $1.45 $22,489.50 5 REMOVE BITUMINOUS PAVEMENT (INCL. SAWCUT) Sq. Yd. 960 $15.00 $14,400.00 $7.00 $6,720.00 $22.00 $21,120.00 $13.75 $13,200.00 6 REMOVE CONCRETE PAVEMENT (INCL. SAWCUT) Sq. Yd. 535 $12.00 $6,420.00 $10.75 $5,751.25 $22.00 $11,770.00 $27.50 $14,712.50 7 REMOVE CONCRETE CURB & GUTTER Lin. Ft. 2170 $10.00 $21,700.00 $9.05 $19,638.50 $8.00 $17,360.00 $12.10 $26,257.00 8 SAW AND SEAL EXISTING CURB Each 98 $250.00 $24,500.00 $15.85 $1,553.30 $60.00 $5,880.00 $16.50 $1,617.00 9 CONCRETE GRINDING Each 9 $500.00 $4,500.00 $106.00 $954.00 $209.00 $1,881.00 $110.00 $990.00 10 SALVAGE STREET SIGN Each 7 $75.00 $525.00 $26.40 $184.80 $27.00 $189.00 $55.00 $385.00 11 INSTALL SALVAGED STREET SIGN Each 7 $150.00 $1,050.00 $317.00 $2,219.00 $315.00 $2,205.00 $192.50 $1,347.50 12 AGGREGATE BASE COURSE CLASS 5 Ton 100 $35.00 $3,500.00 $24.00 $2,400.00 $70.00 $7,000.00 $31.82 $3,182.00 13 BITUMINOUS TRAILS & DRIVEWAYS PATCH (SPWEA340B) Ton 60 $150.00 $9,000.00 $238.00 $14,280.00 $170.00 $10,200.00 $231.42 $13,885.20 14 BITUMINOUS WEAR (SPWEA340C) Ton 1950 $110.00 $214,500.00 $93.55 $182,422.50 $90.34 $176,163.00 $87.35 $170,332.50 15 BITUMINOUS NON-WEAR (SPNWB330C) Ton 80 $150.00 $12,000.00 $185.00 $14,800.00 $165.00 $13,200.00 $235.30 $18,824.00 16 BITUMINOUS MATERIAL FOR TACK COAT Gal. 860 $8.00 $6,880.00 $3.50 $3,010.00 $4.00 $3,440.00 $4.00 $3,440.00 17 CONCRETE CURB & GUTTER PATCH Lin. Ft. 1970 $35.00 $68,950.00 $34.00 $66,980.00 $38.00 $74,860.00 $33.55 $66,093.50 18 6" CONCRETE WALK/DRIVEWAY PATCH & PED. RAMPS Sq. Yd. 639 $80.00 $51,120.00 $93.60 $59,810.40 $101.50 $64,858.50 $91.85 $58,692.15 19 8" CONCRETE STREET INTERSECTION WITH VALLEY GUTTER Sq. Yd. 80 $95.00 $7,600.00 $98.65 $7,892.00 $143.00 $11,440.00 $102.85 $8,228.00 20 TRUNCATED DOMES Sq. Ft. 180 $75.00 $13,500.00 $52.75 $9,495.00 $65.00 $11,700.00 $55.00 $9,900.00 21 SALVAGE AND REINSTALL PAVER DRIVEWAY Sq. Yd. 10 $100.00 $1,000.00 $209.00 $2,090.00 $330.00 $3,300.00 $317.00 $3,170.00 22 TEMPORARY TRAFFIC CONTROL Lump Sum 1 $12,000.00 $12,000.00 $2,638.00 $2,638.00 $6,300.00 $6,300.00 $2,695.00 $2,695.00 23 STORM DRAIN INLET PROTECTION Each 45 $250.00 $11,250.00 $217.00 $9,765.00 $550.00 $24,750.00 $300.00 $13,500.00 24 SEDIMENT CONTROL LOGS TYPE STRAW Lin. Ft. 520 $6.00 $3,120.00 $4.45 $2,314.00 $4.00 $2,080.00 $4.50 $2,340.00 25 SEED MIX 25-141 WITH HYDRAULIC MATRIX MULCH Acre 0.1 $20,000.00 $2,000.00 $20,418.00 $2,041.80 $10,000.00 $1,000.00 $20,000.00 $2,000.00 26 SODDING TYPE LAWN Sq. Yd. 820 $20.00 $16,400.00 $11.40 $9,348.00 $14.00 $11,480.00 $21.00 $17,220.00 27 COMMON TOPSOIL BORROW (LV) Cu. Yd. 130 $45.00 $5,850.00 $53.45 $6,948.50 $65.00 $8,450.00 $81.94 $10,652.20 28 LANDSCAPING RESTORATION Allowance 1 $3,000.00 $3,000.00 $3,000.00 $3,000.00 $3,000.00 $3,000.00 $3,000.00 $3,000.00 29 IRRIGATION AND PET CONTAINMENT SYSTEMS REPAIRS Allowance 1 $7,500.00 $7,500.00 $7,500.00 $7,500.00 $7,500.00 $7,500.00 $7,500.00 $7,500.00 30 4" PERF PVC SDR 35 PIPE DRAIN Lin. Ft. 200 $60.00 $12,000.00 $12.10 $2,420.00 $28.00 $5,600.00 $19.25 $3,850.00 31 DRAIN SUMP BASIN Each 1 $300.00 $300.00 $506.00 $506.00 $1,700.00 $1,700.00 $560.00 $560.00 32 24" SOLID LINE MULTI COMP GR IN Lin. Ft. 46 $20.00 $920.00 $21.10 $970.60 $21.00 $966.00 $14.30 $657.80 33 CROSSWALK MULTI COMP GR IN Sq. Ft. 396 $12.00 $4,752.00 $15.05 $5,959.80 $13.60 $5,385.60 $13.75 $5,445.00 $633,767.00 $498,677.45 $643,896.10 $617,665.85 VASSERMAN RIDGE-REMOVALS, GRADING, PAVING AND RESTORATION NorthwestS.M. Hentges & Sons, Inc.GMH Asphalt CorporationEngineer Estimate FOX HOLLOW-WATERMAIN FOX HOLLOW TOTAL 487 Item Code Item Description UofM Quantity Unit Price Extension Unit Price Extension Unit Price Extension Unit Price Extension 1 REMOVE MH/CB Each 1 $2,500.00 $2,500.00 $1,145.00 $1,145.00 $1,500.00 $1,500.00 $2,180.00 $2,180.00 2 INSTALL 72" DIA. MH/CB WITH SUMP Each 1 $16,000.00 $16,000.00 $9,811.00 $9,811.00 $12,000.00 $12,000.00 $8,350.00 $8,350.00 3 SEWER PIPE JOINT SEALING Each 4 $2,500.00 $10,000.00 $5,064.00 $20,256.00 $6,500.00 $26,000.00 $2,750.00 $11,000.00 4 ADJUST CASTING AND INSTALL NEW RINGS Each 21 $1,100.00 $23,100.00 $473.00 $9,933.00 $800.00 $16,800.00 $715.00 $15,015.00 5 INSTALL NEW CASTING ASSEMBLY AND RINGS Each 6 $2,000.00 $12,000.00 $971.00 $5,826.00 $1,400.00 $8,400.00 $1,470.00 $8,820.00 $63,600.00 $46,971.00 $64,700.00 $45,365.00 1 ADJUST CASTING AND INSTALL NEW RINGS Each 23 $1,100.00 $25,300.00 $2,574.00 $59,202.00 $1,100.00 $25,300.00 $962.00 $22,126.00 2 INSTALL NEW CASTING ASSEMBLY AND RINGS Each 6 $2,000.00 $12,000.00 $1,861.00 $11,166.00 $1,500.00 $9,000.00 $1,512.00 $9,072.00 3 RECONSTRUCT MANHOLE Each 2 $3,000.00 $6,000.00 $3,432.00 $6,864.00 $3,200.00 $6,400.00 $2,825.00 $5,650.00 4 REPAIR MANHOLE: GROUT/SEAL MANHOLE JOINTS Each 5 $1,500.00 $7,500.00 $2,937.00 $14,685.00 $2,900.00 $14,500.00 $6,935.00 $34,675.00 5 REPAIR MANHOLE: REBUILD INVERT Each 3 $2,000.00 $6,000.00 $4,619.00 $13,857.00 $4,500.00 $13,500.00 $2,125.00 $6,375.00 $56,800.00 $105,774.00 $68,700.00 $77,898.00 1 ADJUST GATE VALVE AND BOX Each 7 $800.00 $5,600.00 $911.00 $6,377.00 $350.00 $2,450.00 $385.00 $2,695.00 2 REMOVE AND REPLACE UPPER SECTION OF GATE VALVE BOX Each 1 $1,200.00 $1,200.00 $1,220.00 $1,220.00 $750.00 $750.00 $577.50 $577.50 $6,800.00 $7,597.00 $3,200.00 $3,272.50 $760,967.00 $659,019.45 $780,496.10 $744,201.35 $7,772,680.00 $6,218,794.49 $6,530,078.75 $6,598,439.25BID TOTAL Note: The Bid Totals reflect the corrected totals based on the revised bid quantity for Item Bituminous Ramp Curb Wedge listed under the Removals, Grading, Paving, and Restoration Section for Fox Hollow. The quantity on the Bid Form was incorrectly listed as 1,217 lin. ft. The correct quantity is 12,170 lin. ft. NorthwestS.M. Hentges & Sons, Inc.GMH Asphalt CorporationEngineer Estimate VASSERMAN RIDGE-STORM SEWER VASSERMAN RIDGE-SANITARY SEWER VASSERMAN RIDGE-WATERMAIN VASSERMAN RIDGE TOTAL 488 Column1 Column2 Column3 Column4 Column5 Column6 Column7 Column8 Column9 Column10 PROPERTY NUMBER PIN PARCEL ADDRESS TAXPAYER NAME TAXPAYER ADDRESS TAXPAYER CITY, ST ZIP PROPERTY TYPE ASSESSMENT UNITS REHAB METHOD PROPERTY ASSESSMENT 201 252730010 10 FOX HOLLOW DR RYAN PARKER 10 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 202 252730020 20 FOX HOLLOW DR NORA J AND JEFFREY D W KIRKWOLD 20 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 203 252730030 30 FOX HOLLOW DR VALYA RAMAKRISHNAN 30 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 204 252730840 31 FOX HOLLOW DR KRISTINA THEODOSOPOULOS 31 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 205 252730040 40 FOX HOLLOW DR CONSTANCE M KEEFE 40 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 206 252730850 41 FOX HOLLOW DR JEFFERY B & CYNTHIA S HALL 41 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 207 252730100 100 FOX HOLLOW DR BRADY P TOMLINSON 100 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 208 252730110 110 FOX HOLLOW DR ORHAN AND PATRICIA UNER TTEE OF TRUST 110 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 209 252730120 120 FOX HOLLOW DR ANN MARIE S FREEMAN 120 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 210 252730550 121 FOX HOLLOW DR DAVID V ALBRIGHT 121 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 211 252730130 130 FOX HOLLOW DR FRANK & MELODY K KLOIDA 130 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 212 252730540 131 FOX HOLLOW DR DAVID P & SUSAN E VONFRUKE 131 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 213 252730530 141 FOX HOLLOW DR HENRY L AND LINDA L WALTON REV TR 141 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 214 252730190 160 FOX HOLLOW DR MICHAEL & MARGARET SCHREIBER 160 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 215 252730810 161 FOX HOLLOW DR JENNA VOGEL 161 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 216 252760030 170 FOX HOLLOW DR DARON WALTER 170 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 217 252730820 171 FOX HOLLOW DR ROBERT WIESE 171 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 218 252760020 180 FOX HOLLOW DR CHET A OLINGER 180 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 219 252730830 181 FOX HOLLOW DR HPA BORROWER 2018-1 MS LLC PO BOX 4900 SCOTTSDALE, AZ 85261 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 220 252760010 200 FOX HOLLOW DR EDITH N DULL 200 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 221 255570120 220 FOX HOLLOW DR ANDREW B & JULIE S ROTHMAN 220 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 222 255570110 240 FOX HOLLOW DR KARL F FITZLOFF 240 FOX HOLLOW DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 223 252730050 50 HUNTERS CT ALEJANDRO VIVA 50 HUNTERS CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 224 252730060 60 HUNTERS CT MICHAEL P, EMILIE B PETERSON GROENEWOLD 60 HUNTERS CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 225 252730070 70 HUNTERS CT DAVID F WANEK 70 HUNTERS CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 226 252730080 80 HUNTERS CT DANIEL J BUJOLD 80 HUNTERS CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 227 252730090 90 HUNTERS CT WEI WEI MA 90 HUNTERS CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 228 252730140 140 BLUFF RIDGE CT THE CARLSON FAMILY TRUST 140 BLUFF RIDGE CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 229 252730150 150 BLUFF RIDGE CT KEVIN & CHERYL PETERSON 150 BLUFF RIDGE CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 230 252730160 160 BLUFF RIDGE CT THOMAS VANDEHEI 160 BLUFF RIDGE CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 231 252730170 170 BLUFF RIDGE CT LYA M HURST 170 BLUFF RIDGE CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 232 252730180 180 BLUFF RIDGE CT XIAOBIN YING GU WANG 180 BLUFF RIDGE CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 233 252780050 110 GRAY FOX LN PIYALI GUHATHAKURTA 110 GRAY FOX LN CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 234 252780040 130 GRAY FOX LN STEPHEN G & SUSANNE THEISSEN 130 GRAY FOX LN CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 235 252780030 150 GRAY FOX LN WAYNE A & JULIE K SIEBER 150 GRAY FOX LN CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 236 252780020 170 GRAY FOX LN ANTHONY LEIF 170 GRAY FOX LN CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 237 252780010 190 GRAY FOX LN KRISTOFER K & TRACI L RYDMARK 190 GRAY FOX LN CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 238 255570040 6400 PLEASANT PARK DR TAYLOR J KOHL 6400 PLEASANT PARK DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 239 255570030 6410 PLEASANT PARK DR THE NAROG LIVING TRUST 6410 PLEASANT PARK DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 240 255570050 6411 PLEASANT PARK DR MATTHEW STELLMACHER 6411 PLEASANT PARK DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 241 255570020 6420 PLEASANT PARK DR ABIJAH MUTHYALA 6420 PLEASANT PARK DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 242 255570070 6421 PLEASANT PARK DR MEGAN MARIE REILLY 6421 PLEASANT PARK DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 243 255570010 6430 PLEASANT PARK DR PHILIP B, WENDY M LANIGAN SAILOR 6430 PLEASANT PARK DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 244 255570080 6431 PLEASANT PARK DR DAVIS OGILVIE 6431 PLEASANT PARK DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 245 255570090 6441 PLEASANT PARK DR WALKER 2021 IRREVOCABLE LEGACY TRUST 6441 PLEASANT PARK DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 246 255570100 6451 PLEASANT PARK DR LEONARD J GROSCHEN TR 6451 PLEASANT PARK DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 247 252730200 6500 GRAY FOX CURV JEFFREY J & DIANE L BROWN 6500 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 248 252730210 6502 GRAY FOX CURV NATHAN PAULSON 6502 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 249 252730860 6503 GRAY FOX CURV YANG XU 6503 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 250 252730220 6504 GRAY FOX CURV CHRISTOPHER SMITH 6504 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 251 252730870 6505 GRAY FOX CURV SVETLANA COLVILLE 6505 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 252 252730230 6506 GRAY FOX CURV SEAN MADSON 6506 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 253 252730880 6507 GRAY FOX CURV QUINN COUGHLIN 6507 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 254 252730240 6508 GRAY FOX CURV IDRISS M KHADIJA, ELBEKRAOUI ELBEKRAOUI 6508 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 255 252730890 6509 GRAY FOX CURV JEFFREY R & TERESE C KRULIK 6509 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 256 252730250 6510 GRAY FOX CURV ROBERTA BROUGHTON 6510 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 257 252740020 6511 GRAY FOX CURV JEFFREY P & RONDA M SEILER 6511 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 258 252730260 6512 GRAY FOX CURV SHANE T FLANNERY 4955 W 86TH ST CHASKA, MN 55318 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 259 252740030 6513 GRAY FOX CURV DANIEL P & ANNETTE M MAXWELL 6513 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 260 252730340 6514 GRAY FOX CURV ERIC E ROTH 6514 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 261 252740010 6515 GRAY FOX CURV ANDREW HOGG 6515 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 262 252730350 6516 GRAY FOX CURV RUI HUANG & TENGFEI SONG JOINT TRUST 6516 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 263 252730570 6517 GRAY FOX CURV SCOTT A & SUSAN T MITCHELL 6517 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 264 252730360 6518 GRAY FOX CURV PATRICIA D BESSER 6518 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 265 252730580 6519 GRAY FOX CURV AKEEM ADEWUSI 6519 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 266 252730370 6520 GRAY FOX CURV SCOTT W & RHONDA S KULLMAN 6520 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 267 252730590 6521 GRAY FOX CURV BRADLEY BLADINE 6791 BRIARWOOD CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 268 252730380 6522 GRAY FOX CURV LISA N DOUGHERTY 6522 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 Fox Hollow Area Property Assessment ASSESSMENT - UNIT 48 9 269 252730600 6523 GRAY FOX CURV DAN R PIERCE 6523 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 270 252730390 6524 GRAY FOX CURV JUSTIN C JOHNSON 6524 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 271 252730610 6525 GRAY FOX CURV MARY K MCDONALD 6525 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 272 252730400 6526 GRAY FOX CURV DEBORAH A KERSHAW 6526 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 273 252730620 6527 GRAY FOX CURV ROGER L PIERCE 6527 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 274 252730410 6528 GRAY FOX CURV PARKER LIVING TRUST 6528 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 275 252730630 6529 GRAY FOX CURV JEFFREY NOURSE 6529 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 276 252730470 6530 GRAY FOX CURV PETER D JOHNSON 6530 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 277 252730640 6531 GRAY FOX CURV ELIZABETH DROTNING HARTWELL 6531 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 278 252730480 6532 GRAY FOX CURV TIMOTHY R, CAROLYN K MARTIN KLUENDER 6532 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 279 252730650 6533 GRAY FOX CURV SAMUEL CAMPBELL 6533 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 280 252730490 6534 GRAY FOX CURV STEVEN J & LUANN LUTGEN 6534 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 281 252730660 6535 GRAY FOX CURV AARON BOYER 6535 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 282 252730500 6536 GRAY FOX CURV THE SCHEFFLER LIVING TRUST 6536 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 283 252730670 6537 GRAY FOX CURV JEFFREY B & DONNA M DAHL 6537 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 284 252730510 6538 GRAY FOX CURV AARON KOHRS 6538 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 285 252730680 6539 GRAY FOX CURV KENTON & JULIA KELLY 6539 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 286 252730520 6540 GRAY FOX CURV KENT AND CONNIE OLIVER TR 6540 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 287 252730690 6541 GRAY FOX CURV NICHOLAS S AND CARYL A MANOLES TRUST 6541 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 288 252730700 6543 GRAY FOX CURV NATHANIEL BURNS 6543 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 289 252730710 6545 GRAY FOX CURV CARRIE M BARCLAY 6545 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 290 252730720 6547 GRAY FOX CURV STEVEN J HARROLD 6547 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 291 252730730 6549 GRAY FOX CURV BRUCE M EDWARDS 6549 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 292 252730740 6551 GRAY FOX CURV SCOTT M STEINKAMP 6551 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 293 252730750 6553 GRAY FOX CURV BRIAN E NORMAN 6553 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 294 252730760 6555 GRAY FOX CURV ANN WENDLING 6555 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 295 252730770 6557 GRAY FOX CURV JOSEPH D KNOBLAUCH 1465 KNOB HILL LN EXCELSIOR, MN 55331 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 296 252730780 6559 GRAY FOX CURV MARKUS & MIGNON FAELDONEA 6559 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 297 252730790 6561 GRAY FOX CURV CHAD R LUNSKI 6561 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 298 252730800 6563 GRAY FOX CURV DORIS E CARLSON 6563 GRAY FOX CURV CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 299 252730300 6520 QUAIL XING ALEXIS PENDON 6520 QUAIL XING CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 300 252730290 6521 QUAIL XING GLEN & STEPHANIE SKRIVSETH 6521 QUAIL XING CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 301 252730310 6530 QUAIL XING JOSEPH JR & KELLY J FERNANDES 6530 QUAIL XING CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 302 252730280 6531 QUAIL XING STEPHEN VIEL 6531 QUAIL XING CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 303 252730320 6540 QUAIL XING DAVID E & SHARON T TUPPER 6540 QUAIL XING CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 304 252730270 6541 QUAIL XING ANDREW C SCHIEFELBEIN 6541 QUAIL XING CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 305 252730330 6550 QUAIL XING ASHLEY DIVISH 6550 QUAIL XING CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 306 252730460 6561 FOXTAIL CT AMY KIM SCHROEDER-TOYA 6561 FOXTAIL CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 307 252730450 6571 FOXTAIL CT ROBERT & CATHERINE ENGELHARDT 6571 FOXTAIL CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 308 252730440 6581 FOXTAIL CT MATTHEW THOMAS PELTO 6581 FOXTAIL CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 309 252730430 6591 FOXTAIL CT JUSTIN ROBINSON 6591 FOXTAIL CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 310 252730420 6595 FOXTAIL CT JOHN DAVID SCHULTZ 6595 FOXTAIL CT CHANHASSEN, MN 55317 SINGLE FAMILY 1 RECONSTRUCTION $9,550.00 311 252910030 6440 FOX DR BENJAMIN C KRUEGER 6440 FOX DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 312 252910040 6441 FOX DR JOEL SCHRIMPF 6441 FOX DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 313 252910020 6450 FOX DR SARAH STEINER 6450 FOX DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 314 252910050 6451 FOX DR JOLIE ODAM 6451 FOX DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 315 252910010 6460 FOX DR ANDREW MOGENSEN 6460 FOX DR CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 316 252910060 6461 FOX DR ANJALI DAHIYA 18310 KYLIE COURT MINNETONKA, MN 55345 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 116 $1,068,256.00TOTALS 49 0 Column1 Column2 Column3 Column4 Column5 Column6 Column7 Column8 Column9 Column10 PROPERTY NUMBER PIN PARCEL ADDRESS TAXPAYER NAME TAXPAYER ADDRESS TAXPAYER CITY, ST ZIP PROPERTY TYPE ASSESSMENT UNITS REHAB METHOD PROPERTY ASSESSMENT 101 258280210 7602 RIDGEVIEW WAY JOE AND EILEEN KIEFFER LIV TR 7602 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 102 258280220 7608 RIDGEVIEW WAY TODD BENJAMIN BULLINGER 7608 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 103 258290010 7614 RIDGEVIEW WAY SRIRAM GAYATHRI, SAMBASIVAN VISWANATHAN 7614 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 104 258290020 7620 RIDGEVIEW WAY DAVID KLEINSCHMIT 7620 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 105 258290030 7626 RIDGEVIEW WAY R AND T SWANSON REV LIV TR 7626 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 106 258290040 7632 RIDGEVIEW WAY DAVID W & LORI E MOSER 7632 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 107 258290280 7633 RIDGEVIEW WAY TAMARA LAINE HODGINS REV TR 7633 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 108 258290050 7638 RIDGEVIEW WAY CHAD A HAMANN TRUST AGREEMENT 7638 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 109 258290270 7639 RIDGEVIEW WAY BRIAN F SCHOENBERGER 418 AMBERG LN CHASKA, MN 55318 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 110 258290060 7644 RIDGEVIEW WAY MELISSA GRANT 7644 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 111 258290260 7645 RIDGEVIEW WAY DAVID DONELSON 7645 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 112 258290070 7650 RIDGEVIEW WAY TIMOTHY M & VALERIE R PASS 7650 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 113 258290250 7651 RIDGEVIEW WAY ERIC KEITH & REGINA H DEANES 7651 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 114 258290080 7656 RIDGEVIEW WAY ANDREW MELROY 7656 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 115 258290240 7657 RIDGEVIEW WAY EMILY HARRIS 7657 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 116 258290090 7662 RIDGEVIEW WAY PATRICK J DEWALL 7662 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 117 258290230 7663 RIDGEVIEW WAY JESSICA MILLER-STICKSEL 7663 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 118 258290150 7668 RIDGEVIEW WAY DEREK & KRISTI BUSH 7668 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 119 258290220 7669 RIDGEVIEW WAY BENJAMIN FIMAN 7669 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 120 258290160 7674 RIDGEVIEW WAY ERIK A MOORE 7674 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 121 258290210 7675 RIDGEVIEW WAY STACEY N DOVE REV TR 7675 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 122 258290170 7680 RIDGEVIEW WAY ARIAN TAVAKOLIAN 7680 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 123 258290180 7686 RIDGEVIEW WAY DAVID J VESLEDAHL 7686 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 124 258290190 7692 RIDGEVIEW WAY RICHARD F & LISA BIRHANZEL 7692 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 125 258310040 7698 RIDGEVIEW WAY SAMUEL R BLOOM 7698 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 126 258310090 7699 RIDGEVIEW WAY HOLSHOUSER FAMILY TRUST 7699 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 127 258310030 7704 RIDGEVIEW WAY JINJUN XIAO 7704 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 128 258310080 7705 RIDGEVIEW WAY ANDREW S EILERTSON 7705 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 129 258310020 7710 RIDGEVIEW WAY T KLEIN AND S DAUGHERTY KLEIN 7710 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 130 258310070 7711 RIDGEVIEW WAY STEVEN R SHELDON 7711 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 131 258310010 7716 RIDGEVIEW WAY MATTHEW BERHOW 7716 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 132 258310060 7717 RIDGEVIEW WAY ADAM H & CHRISTINE M BAUMAN 7717 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 133 258310050 7723 RIDGEVIEW WAY JILL D EVERSMAN LIVING TRUST 7723 RIDGEVIEW WAY CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 134 258290130 7563 RIDGEVIEW PT DANIEL E & STACY L BENO 7563 RIDGEVIEW PT CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 135 258290120 7569 RIDGEVIEW PT TODD A & KATHLEEN M PRICE 7569 RIDGEVIEW PT CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 136 258290140 7574 RIDGEVIEW PT ERIC J ZORN REVOCABLE TRUST 7574 RIDGEVIEW PT CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 137 258290110 7575 RIDGEVIEW PT LU KWOK WONG NG LI 7575 RIDGEVIEW PT CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 138 258290100 7581 RIDGEVIEW PT KYAN G HECK 7581 RIDGEVIEW PT CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 139 258290200 7670 VASSERMAN TRL DAVID J JR & ILA J WHEELER 7670 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 140 258310100 7676 VASSERMAN TRL PATRICK LAM 7676 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 141 258310310 7677 VASSERMAN TRL DANIEL P & KELLY L BOCK 7677 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 142 258310110 7682 VASSERMAN TRL KEVIN R & KELLY C KOEMPTGEN 7682 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 143 258310320 7683 VASSERMAN TRL SIBLEY LIVING TRUST 7683 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 144 258310120 7688 VASSERMAN TRL JESSE TIDWELL 7688 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 145 258310330 7689 VASSERMAN TRL DEREK E THOMAS 7689 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 146 258310340 7695 VASSERMAN TRL KEVIN POWELL 7695 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 147 258280225 7701 VASSERMAN TRL VASSERMAN RIDGE MASTER ASSOC 6438 CITY WEST PKWY EDEN PRAIRIE, MN 55344 1 MILL AND OVERLAY $2,940.00 148 258280100 7710 VASSERMAN TRL JOHN SCHULLO 7710 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 149 258280090 7714 VASSERMAN TRL TIMOTHY J GUILFOIL 20750 N 87TH ST UNIT 2095 SCOTTSDALE, AZ 85255 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 150 258280200 7715 VASSERMAN TRL MARK I & MAUREEN E MAGNUSON 7715 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 151 258280190 7719 VASSERMAN TRL GEORGE M JANDL 7719 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 152 258280080 7720 VASSERMAN TRL CHERYL A STANTON 7720 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 153 258280070 7724 VASSERMAN TRL JEFFREY D HELSTROM 7724 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 154 258280180 7725 VASSERMAN TRL DANIEL L REVSBECH 7725 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 155 258280170 7729 VASSERMAN TRL GELINO FAMILY TRUST 7729 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 156 258280060 7730 VASSERMAN TRL MARLENE J OLSON 7730 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 157 258280050 7734 VASSERMAN TRL BRADLEY J STARK 7734 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 158 258280160 7735 VASSERMAN TRL JULIE ANN ERICKSON ROJAS 7735 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 159 258280150 7739 VASSERMAN TRL BRENT RICKENBACH REVOCABLE TRUST 7739 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 160 258280040 7740 VASSERMAN TRL DIANE JULSON 7740 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 161 258280030 7744 VASSERMAN TRL THOMAS W KRAUS TRUST 7744 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 162 258280140 7745 VASSERMAN TRL JAMES H & AMELIA A CHMURA 7745 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 163 258280130 7749 VASSERMAN TRL VASSERMAN LLC 6918 W VAN RD DULUTH, MN 55803 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 164 258280020 7750 VASSERMAN TRL THE RITA K MASON REVOCABLE TRUST 7750 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 165 258280010 7754 VASSERMAN TRL DUANE A & LOIS I LUBBERS JT REV TRUST 7754 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 166 258280120 7755 VASSERMAN TRL GERALD P & PEGGY A WOLFE 7755 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 167 258280110 7759 VASSERMAN TRL SHIELDS FAM TR 7759 VASSERMAN TRL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 168 258310130 7702 VASSERMAN PL SCOTT L COCHRAN 7702 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 Vasserman Ridge Area Property Assessment ASSESSMENT - UNIT 49 1 169 258310300 7703 VASSERMAN PL DANIEL AND DIANE EIDSMO REV LIV TR 7703 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 170 258310140 7706 VASSERMAN PL DEL J AND BARBARA A VANDERPLOEG 7706 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 171 258310290 7707 VASSERMAN PL B & J BARGANZ REV TR 590 W 32830 GRANITE TRL MUKWONAGO, WI 53149 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 172 258310150 7712 VASSERMAN PL STEFANIE AMUNDSON 7712 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 173 258310280 7713 VASSERMAN PL PETERSON LIVING TRUST 7713 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 174 258310160 7716 VASSERMAN PL MARCIA M MAYO 7716 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 175 258310270 7717 VASSERMAN PL BONNIE L MCGILL REVOC TRUST 7717 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 176 258310170 7722 VASSERMAN PL SALLY KANGAS 7722 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 177 258310180 7726 VASSERMAN PL CANDICE L CRANDALL REV TR 7726 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 178 258310190 7732 VASSERMAN PL NANCY C SUTHERLAND 7732 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 179 258310200 7736 VASSERMAN PL HAIGHT LIVING TRUST 7736 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 180 258310210 7742 VASSERMAN PL DARRELL L BUELL 7742 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 181 258310220 7746 VASSERMAN PL EVANS REV LIVING TRUST 7746 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 182 258310230 7752 VASSERMAN PL STANLEY W MARY LYNN, VALENSKY VALENSKY 7752 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 183 258310240 7756 VASSERMAN PL PAUL J WOLETZ 7756 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 184 258310250 7762 VASSERMAN PL ARTEMAS MARY K ROBERTS ROBERTS 7762 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 185 258310260 7766 VASSERMAN PL KENDALL LIVING TRUST 7766 VASSERMAN PL CHANHASSEN, MN 55317 SINGLE FAMILY 1 MILL AND OVERLAY $2,940.00 85 $249,900.00TOTALS 49 2 Page 1 of 5 CITY OF CHANHASSEN ASSESSMENT POLICY Date of Last City Council Adoption: May 5, 2025 The City of Chanhassen’s Assessment Policy is intended to provide general direction to City Staff and their consultants in preparation of assessment rolls to establish fair and consistent treatment of all properties within the City that are subject to an assessment. This document can also be used to educate and explain to property owners about the Policy. All assessments shall follow the process outlined in Minnesota State Statutes, Chapter 429, which gives the City the legal authority to assess benefiting property for public improvements. The strict interpretation of this Policy may not apply in all circumstances, it is intended to be a guide for a systematic process. The City Council may direct staff to use special consideration and discretion for the assessment methodology on projects. WHICH PROPERTIES ARE TO BE ASSESED Determination about which properties are to be included in the assessment role generally fall into two (2) property types: 1. Type 1: Land use that generates a low level of vehicular traffic, such as low-density residential properties. o These properties shall be included in the assessment role for public street improvements that have their primary driveway access, or that it can be reasonably determined will have a future driveway access, to the street being rehabilitated. This includes property with a shared driveway or private street access to the public street, except where said private street meets applicable criteria to allow for a reduced or no assessment. The policy acknowledges that private streets are not maintained by the City and therefore all costs associated with the maintenance of them are borne by the property legally required to maintain them. Applicable criteria of private streets includes whether the street meets City Code requirements with respect to width, pavement section, and appropriate fire apparatus turn-around. 2. Other land use property types that generate increased levels of vehicular traffic, such as commercial, multi- family, or schools. o These properties shall be included in the assessment role for all adjacent public street improvement projects, regardless of which street their primary driveway takes access from, or the number of driveway access points; unless it can be reasonably determined that the use of the property does not have any traffic impact on the adjacent public street receiving the improvements. ASSESSMENT METHODOLOGY There are various ways to calculate assessments. The typical methodology is based on the number of parcels, an area, or linear foot calculation. Chanhassen has also developed a policy that utilizes a flat rate, meaning all parcels to be assessed receive the same assessment regardless of any particular property characteristic. • For property type 1 listed above, the properties to be assessed will receive an assessment amount equal to the flat rate for which rehabilitation type the project is utilizing (mill and overlay, full depth reclamation, or reconstruction). The flat rate is established on the City’s Fee Schedule, which is updated and approved by the City Council annually. The flat rate utilized for a project will be the rate that is in effect on the date the assessment role is adopted. • For property type 2 listed above, the City shall use the calculation method that creates a reasonable distribution of assessments across the entire roll. 493 Page 2 of 5 • Where reasonable to do so, when more than one “neighborhood” is contained within the same project, the assessment roll may be calculated per each neighborhood, rather than the total project. This would not apply to property type 1 as they would all receive a flat rate assessment. • Unless otherwise exempt, public property, government land, private associations, schools, churches, and non-profit property uses shall be included in the assessment roll. • Commercial property, and Medium and High-Density Residential property shall be assessed based on a reasonable determination of vehicular traffic generated. • A duplex that is located on a single parcel, shall be considered two units. Generally, when traffic volumes are used as the assessment methodology, a Residential Equivalent Unit (REU) or similar other unit assessment relationship shall be used. NEW CONSTRUCTION: 100% assessed to all benefitting properties. New construction is typically paid for by the development itself and therefore not formally assessed. In some instances, the City will undertake proactive installation of public utilities to unserved areas and then assess the benefiting properties, or establish an improvement district/area with deferred access charges to cover the cost for the added service. In other instances, properties may petition the City directly for the installation of the public improvements in which case 100% of the costs are paid for by the benefiting properties. Assessable Costs Include: • Construction of a new public street, trail and/or sidewalk. • Installation of public water main, storm sewer and/or sanitary sewer system, including appurtenances (structures, valves, hydrants, lift stations, etc.), where it did not previously exist. • Indirect costs (design, legal, and administration fees). Notes: • Oversizing of streets and utilities beyond the city’s standard details, or what is needed for the development itself, are paid for by the city and are typically not assessed. RECONSTRUCTION/REHABILITATION: 40% assessed to all benefitting properties, unless a flat rate methodology is utilized. When determining the rehabilitation method to be used, the following decision matrix shall be used for planning purposes: Question If Yes If No Does the street need to change its intended use; change to meet our current standard (width, thickness, C&G, drainage, etc.); and/or has it met its useful service life (~50 yrs)? Plan for Reconstruction Move to next question Is the pavement condition OCI between 0 and 29? Plan for Reconstruction Move to next question Is the pavement condition OCI between 30 and 59? Plan for FDR Move to next question Is the pavement condition OCI greater than 60? Plan for M&O n/a Notes: • Once a project is under design, an engineering analysis will be undertaken to determine the appropriate rehabilitation method. 494 Page 3 of 5 • Two inches (2”) shall be the standard depth for a mill and overlay unless particular circumstances exist. Under such circumstances, the flat rate will not be adjusted. Assessable Costs Include: • Pavement associated with public streets, trails and/or sidewalks. This includes draintile, geotechnical (soil corrections, etc.), and other improvements needed to support the function of the pavement structure. o In situations where there is no existing trail or sidewalk infrastructure, but such improvements are being added by the project, the costs associated with the addition shall not be assessed unless particular circumstances exist such as when the benefit of the new infrastructure is of primary benefit to the assessable properties only. • Curb and gutter, including curb impacted solely by utility improvements. • Driveway pavement and aprons directly affected by the project work. • Storm Sewer and appurtenances associated with street drainage. • Multi-Modal improvements such as ADA ramps and actuated pedestrian crossings such as Rectangular Rapid- Flashing Beacons (RRFB’s). • Signing and striping. • Retaining walls required within the Right-of-Way. • Tree removal and/or landscaping improvements directly affected by the project work. • Applicable percentage of indirect costs (design, legal, and admin fees). Notes: • If a residential property has access from a collector or otherwise oversized street, the assessment amount shall be based on an equitable formula compared to a typical local roadway, including normalizing to a city standard width, typical street pavement section, typical lot width, and other applicable factors. This normalization does not apply to a flat rate assessment. • Pavement projects on streets that provide direct access to Chanhassen property(s) that are being implemented by an adjacent municipality shall not be assessed to the Chanhassen property(s) unless the adjacent municipality is assessing the benefiting property in their jurisdiction as part of the project. • Replacement, maintenance, or repair of existing public water main, sanitary sewer, and indirect stormwater management infrastructure shall not be assessed. The City will pay 100% of these improvement costs out of the associated enterprise fund. REGULAR MAINTENANCE: Benefiting properties are not assessed. • Activities Include: Pavement patching, pothole filling, crack sealing, chip sealing, sealcoating, sign maintenance, lighting, and pavement markings. PAYMENT OPTIONS • Assessments can be paid in full up-front with no finance charge, otherwise the assessment will be certified to the County and added to annual property taxes with interest. • If elected to add to annual property taxes, the balance can be paid off at any time during the term if requested by the property owner. • Interest will be charged to property owners who choose to not pay their assessments in full by November 15th in the year the special assessment is levied. The interest rate will be equal to the yield on the 7-year Treasury Note on the date the special assessment roll is adopted, plus 1.0%. 495 Page 4 of 5 • Unless approved otherwise by the City Council, the maximum financing term for assessments shall be as follows: o $0-$500 1 year o $501-$2,500 5 years o $2,501-$5,000 8 years o $5,001-$15,000 10 years o $15,001 and above 15 years HARDSHIP ASSESSMENT DEFERAL FOR SENIORS, DISABLED, OR MILITARY PERSONS Minnesota Statute §435.193 allows a statutory city to establish standards and guidelines to defer special assessments. A deferment of a special assessment for a homesteaded property may be granted if: (1) The property is owned by a person 65 years of age or older or retired by virtue of a permanent and total disability* for whom it would be a hardship to make the payments; or (2) The property is owned by a person who is a member of the Minnesota National Guard or other military reserves who is ordered into active military service, as defined in Minnesota Statutes § 190.05, subdivision 5b or 5c, as stated in the person’s military orders, for whom it would be a hardship to make the payments. The deferment is not an elimination of the assessment, but rather a temporary pause of paying the assessment until the hardship no longer exists. Interest on deferred assessments shall be subject to and charged at the interest rate set by the City Council on its resolution adopting the special assessment, and such interest shall accrue on said principal until the special assessment is paid in full. The option of the property owner to defer the payment of special assessments shall terminate and all amounts accumulated plus accrued interest (compounded annually) shall become due and payable within sixty (60) days upon the occurrence of any of the following events: (1) The sale, transfer, or subdivision of the property or any part thereof, or the property is in any way conveyed to another person; or (2) The subject property loses its homestead status for any reason; or (3) The death of the owner qualified for deferral status unless a surviving spouse is eligible for benefits hereunder; or (4) If for any reason the City Council determines that there would be no hardship in requiring an immediate or partial payment of the deferred special assessment. To request deferral of a special assessment, the property owner must request a deferment on the form prescribed by the City Clerk within thirty (30) days after the adoption of the improvement assessment by the City Council. The applicant must submit a copy of the federal income tax return from the year prior to the assessment to verify that all sources of income do not exceed the very low-income limits for the Carver County area as established by the Department of Housing and Urban Development. The property must be the applicant’s principal residence and classified on the real estate tax rolls as the applicant’s homestead. City staff will review the application and if the applicant meets the standards and guidelines above, the deferment will be granted. The City Council has the discretion to make the determination that a hardship exists based on exceptional and unusual circumstances not covered by the standards and guidelines where the determination is made in a 496 Page 5 of 5 nondiscriminatory manner and does not give the applicant an unreasonable preference or advantage over other applicants. *Permanent and total disability shall have the same definition for purposes of assessment deferral as is used for social security. FREQUENTLY ASKED QUESTIONS A Frequently Asked Questions (FAQ) document addressing the most common questions concerning assessments is attached to this policy and can also be found on the City’s website. 497 G:\ENG\Assessments\Assessment FAQ 2022 Update - Clean.docx Page 1 of 2 What are assessments? Assessments are charges to benefiting properties utilized to help finance an improvement project. In Chanhassen and most metro area cities, assessments are used to help finance street reconstruction and rehabilitation projects. These projects are programmed via the Pavement Management Program (PMP). Minnesota State Statutes, Chapter 429, allows the City the authority to assess for projects. Who is assessed for a street improvement project? Owners of property that directly access a public street, or that have a private driveway that has access to a public street, or that have potential future access within the project area are assessed. These properties are determined to be “benefitting properties” and are assessed a cost based on the City’s Assessment Policy. Does the City have an Assessment Policy? Yes. It can be found on the City’s website at this location: https://www.ci.chanhassen.mn.us/432/Assessment-Policy The City started assessing for street improvements in 1993. The Policy was last updated in January 2022. For the construction of a new public streets or public utilities, 100% of the cost is assessed to the benefitting properties. For an improvement project of an existing street, 40% of the cost is assessed to the benefitting properties and the City pays 60% of the street improvement cost. 100% of the public storm sewer, sanitary sewer and water main costs associated with the project are paid by the associated utility enterprise funds and are not included in the cost assessed to the benefitting properties. Why does the City assess for street improvement projects? Why doesn’t the City pay 100% of the project cost? Public streets are part of the City’s Multi-Modal transportation system to provide access to all residents. The City acknowledges the system benefit of a street project by paying 60% of the project cost. Benefitting properties use the roads to get to and from their property on a daily basis, which is why they are assessed 40% of the street project cost. When someone buys a new home in a new subdivision, the cost to construct the new infrastructure was incorporated into the purchase price of the home and property by the Developer and thus was the initial assessment to the property. When is the assessment amount determined? An estimate of the assessment is calculated with the Feasibility Study, which is typically completed six months to a year before a project begins. The final assessment amount is based on the lowest responsible bid amount and is set by City Council at the assessment hearing, CITY OF CHANHASSEN FAQs: ASSESSMENTS 498 G:\ENG\Assessments\Assessment FAQ 2022 Update - Clean.docx Page 2 of 2 which typically occurs in April or May of the construction year. Properties being assessed for the project are notified of the assessment hearing formally by US mail, but the process is also communicated by the City via its website, public open houses, the Chanhassen Connection, social media, and at City Council meetings. What are the payment options for assessments? Please refer to the timeline below for payment options. The City does not accept partial payments of the assessment. Assessment Hearing & final assessment amount is determined and the Assessment Roll is adopted Payments received by this date are not charged interest Payments received by this date are charged the interest that has accrued from the date the Assessment Roll is adopted Annual payments to the assessment are paid with your property taxes. Interest is collected each year based on the outstanding principle owed on the assessment April or May (typically) 90 days after the Assessment Roll is adopted End of the year Term of the assessment* *You can pay off an assessment after it has been certified to your property taxes. The City of Chanhassen Finance Department will calculate the payoff amount, which will include the interest. The Term is based on a tiered amount found in the Policy. Why does the City charge interest on assessments? The City finances the entire project cost until all the assessments have been paid. The interest charged on assessments is the rate the City pays for the bonding (as of the date of the assessment) plus 2%. The interest charged is calculated as simple interest and not a compound interest. Benefitting property owners are encouraged to consult private financial institutions for other ways that can be used to pay off the assessment. This allows the property owner the ability to negotiate the term and interest rates within the competitive market and may have some tax advantages. What does the Franchise Fees Pay for? The Franchise Fees (passed in 2018) help pay for the City’s cost of the project. In lieu of Franchise Fees, the annual property tax levy would have to be adjusted to fund the overall Pavement Management Program (PMP). How can I provide input on the project and the planned improvements? A couple ways: 1. The City and their design consultants typically hold 2 public open houses during the project implementation process. You can attend one or both of these and verbally discuss the project or provide written comments on a comment card at those meetings. 2. Call the City’s Engineering Department at (952) 227-1160 and talk to one of the staff working on the project. 3. E-mail the City’s Engineering Department at Engineering@ci.chanhassen.mn.us and provide your comments or concerns. 499 4/18/24, 2:24 PM FAQ List | Chanhassen, MN https://www.chanhassenmn.gov/i-want-to/faq-list/-selcat-84#faqCats 1/2 FAQ List Pavement Management How long has the Pavement Management Program (PMP) been in place? The city has always performed some degree of pavement management, but it wasn’t a formalized process. Implementation of the current Pavement Management Program (PMP) began in 2020 after the City Council approved the franchise fee. How does the city manage its street pavements? The city has an outlined Pavement Management Program (PMP) and a dedicated funding source (the PMP Fund). A general tax levy, franchise fees, municipal state aid (MSA), and assessments comprise the revenue of the PMP fund. The projects are outlined in the 5-Yr Capital Improvement Plan (CIP), where the projects are identified on this map. There is a separate FAQ category related to the franchise fee. Chanhassen has approximately 119 miles of city-owned streets and has committed to its residents to provide a systematic rehabilitation and repair program to assure that the streets are serviceable, safe, functional, and provided at a reasonable cost to meet the needs of our residents and the traveling public. The city is broken up into three geographic areas, and each area is field-reviewed for pavement condition once every three years. This ensures we have accurate and timely information related to the condition of the pavement. The pavement condition is based on a scale from 0-100, where 0 is a completely failed pavement, and 100 is brand new. The city has established a goal to have the average pavement condition across the entire network be 70 or greater. 70 is considered good condition. This means that many streets will have a pavement condition less than 70, and many will have a pavement condition greater than 70, but the average is to stay at or above 70. City staff annually analyzes the condition rating of the streets and proceeds in a manner that “makes sense” and is within the funding provided. The goal of the program is to “do the right maintenance at the right time.” Four (4) maintenance and construction techniques are used as part of the PMP program: Sealcoat, Mill and Overlay, Reclamation, and Reconstruction. 1. Sealcoat involves spraying a bituminous adhesive on the existing surface and topping it with small graded aggregate rock. The excess aggregate is swept off and recycled. This activity helps protect the pavement from oxidation and the effects of moisture. 2. Mill and overlay involve grinding off the top layer of the surface and installing a new top layer of pavement. This is a structural improvement and extends the life cycle of the original pavement. 3. Reclamation takes it a step further, grinding up the asphalt and mixing it with the top part of the rock base to create a new base layer. Then, two new layers of asphalt are installed on top of that base layer. Excess material is generated and must be reused or hauled off and recycled. 500 4/18/24, 2:24 PM FAQ List | Chanhassen, MN https://www.chanhassenmn.gov/i-want-to/faq-list/-selcat-84#faqCats 2/2 4. Reconstruction removes and replaces the existing asphalt pavement and aggregate base entirely and installs an entire sand subsection, drain tile, curb, and gutter if not already present. Some streets, typically the ones with a higher traffic volume, are designated as municipal state aid routes and, therefore, are eligible for funding from the state. These streets are typically rehabilitated as separate projects from normal city streets, but the techniques used and the project delivery are no different. All street projects are assessed to benefit properties, whether they are MSA Routes or not. Assessments have a separate FAQ. 501 ## ## ########### ##### ### ### # # # ## ##### # ## # # ## ## # ###### # # ### # # #### # # ##### # # # # ## ## ## # # Lake Virginia Christmas Lake Lotus Lake Brendan Pond Lake Harrison Kerber Pond Lake Susan Rice Marsh Lake Lake Riley Rice Lake Lake St. Joe Lake Minnewashta Lake Ann Lake Lucy ST18 ST14 ST15 ST17 ST61 Minnewashta Regional Park North Lotus Lake Park Meadow Green Park Lake Ann Park Chanhassen Pond Park Chanhassen Nature Preserve Chanhassen Recreation Center Lake Susan Park Rice Marsh Lake Preserve Power Hill Park Fox Woods Preserve Bandimere Community Park Bluff Creek Golf Course Hesse Farm Park Preserve Lake Susan Preserve City Center Park Raguet Wildlife Management Are MN Valley National Wildlife Re MN Landscape Arboretum Seminary Fen Scientific & Nat* Bluff Creek Preserve Independent School District 11 Independent School District 112 Independent School District 276 Riley Ridge Park Lake Ann Park Preserve SA5 SA7 SA5 SA101 SA5 SA41 )212 P o w e r s Blvd Hw y 2 1 2 Au d u b o n R d Cha nha s s e n Rd Arboretum Blvd Pioneer Trl Galpin Bl v d Lyman Blvd Ha z e l t i n e B l v d M a r k e t Bl v d Po w e r s B l v d Hwy 7 F l y i n g C l o u d D r G reat Pl a insBlvd Arbo r e t u m B l v d C o R d 1 0 1 ST101 ST101 Date Created: 12/8/2025 Do c u m e n t P a t h : K: \ D e p a r t m e n t s \ E n g i n e e r i n g \ C I P \ 2 0 2 6 - 2 0 3 0 \ C I P _ 5 Y e a r _ 2 0 2 6 - 2 0 3 0 . a p r x Created By: City of Chanhassen - Engineering Department µ0 3,000 Feet 0 0.5 Mile 5-Year CIP Pavement Management Plan (PMP) - Streets (2026-2030) City of Chanhassen Legend Mill & Overlay Full Depth Reclamation ## ##Reconstruction 2026 2027 2028 2029 2030 502 Streets - 2026 Street Improvements Overview Request Owner Charlie Howley, PW Director/City Engineer Department Annual Pvmnt Mgmt Contracted Form Type Capital Improvement Request Type Street Construction/Reconstruction Project Number ST-012-2026 Description The 5-year Capital Pavement Management Plan identi es the planned streets for the next ve years. The Plan is updated every fall to review priorities and needs, but generally intends to keep the overall condition index (OCI) average across all streets at 70 or higher. 2026 Reconstruction 601-6054-XXXX The City uses a Pavement Management System in Cartegraph to monitor the condition of City streets. While proper preventative maintenance extends the life of the street and is cost effective, a street will eventually deteriorate to a point that major maintenance is required. Rehabilitation projects exited the life of the street. In cases when utilities or poor subgrade needs to be replaced or where streets have deteriorated to a point where rehabilitation will no longer be practical, reconstruction of the street is necessary. A feasibility study is written to consider the merits of the project, scope of work, costs, and assessments. The City has an Assessment Policy that identi es what and how much of the project is assessed to bene ting properties. The 2026 project is a full reconstruction scope. Details Type of Project Reconstruction 503 Capital Cost Breakdown Capital Cost FY2026 Total Engineering $870,000 $870,000 Construction/Maintenance $7,885,000 $7,885,000 Total $8,755,000 $8,755,000 Capital Cost FY2026 Budget $8,755,000 Total Budget (all years) $8.755M Project Total $8.755M Capital Cost by Year Construction/Maintenance Engineering 2026 $8,755,000.00 $0 $2.5M $5M $7.5M Capital Cost for Budgeted Years TOTAL $8,755,000.00 Construction/Maintenance (90%)$7,885,000. Engineering (10%)$870,000.00 504 Funding Sources Breakdown Funding Sources FY2026 Total Streets - PMP Funds $2,900,000 $2,900,000 Streets - PMP Assessments $1,935,000 $1,935,000 Utility Fund - Water $990,000 $990,000 Utility Fund - Sewer $800,000 $800,000 Utility Fund - SW Mgmt $2,130,000 $2,130,000 Total $8,755,000 $8,755,000 Funding Sources FY2026 Budget $8,755,000 Total Budget (all years) $8.755M Project Total $8.755M Funding Sources by Year Streets - PMP Assessments Streets - PMP Funds Utility Fund - Sewer Utility Fund - SW Mgmt Utility Fund - Water 2026 $8,755,000.00 $0 $2.5M $5M $7.5M Funding Sources for Budgeted Years TOTAL $8,755,000.00 Streets - PMP Assessments (22%)$1,935,000.0 Streets - PMP Funds (33%)$2,900,000.00 Utility Fund - Sewer (9%)$800,000.00 Utility Fund - SW Mgmt (24%)$2,130,000.00 Utility Fund - Water (11%)$990,000.00 505 2026 City Pavement Rehabilitation Project Approval and Public Assessment Hearing City Project 26-01 April 27, 2026 506 Tonight’s Actions 1.Discuss the improvements and bid results a)Vasserman area b)Fox Hollow area 2.Host the 2nd Public Hearing 3.Consider Accepting the Bids and Awarding the Construction Contract, and Adoption of the Final Assessment Roll 507 Project Area and Scope -Vasserman •~0.9 miles of public street rehabilitation •Average pavement OCI = 78.5 •Mill and Overlay •Spot repair of public utilities •ADA improvements •Spot repairs of concrete curb and sidewalk •Proposed median and center island removal with HOA 508 Project Area and Scope – Fox Hollow •~1.3 miles of public street rehabilitation •Average pavement OCI Fox Drive = 80.8 Rest of neighborhood = 17.6 •Full reconstruction of the streets (except for Fox Drive which is planned for a M&O) •Improve alignment of Fox Hollow Dr near the park •Replacement of watermain (15 documented breaks) •Spot repairs for sanitary sewer + Private I/I program •Addition of storm sewer (+ North Lotus Lake WD project) •Minor stormwater pond maintenance + a public raingarden 509 North Lotus Lake Park Stormwater Project •To be implemented and funded by RPBCWD •Provides for the majority of stormwater management permitting requirements for this neighborhood area of the 2026 City Pavement Rehabilitation Project •Project boards and Staff from RPBCWD were present at both open houses •RPBCWD is working with the City regarding reasonable implementation of certain measures until final construction of this project •Cooperative Agreement necessary between City and RPBCWD 510 Public Engagement Efforts •1-yr advanced notification via postcard •Specific project webpage. Multiple project update notifications. •Project survey •1st Open House hosted on November 19, 2025 (~75 attendees) •Fox Hollow Dr re-alignment follow-up meeting on February 17, 2026 (~43 attendees) •2nd Open House hosted on April 14, 2026 (~40 attendees) •Included representatives from the Contractor •Mailed notification letter announcing tonight’s public hearing and specific final assessment information •Various other outreach efforts. Refrigerator magnets will be distributed again. 511 Public Feedback Summary •Main theme’s 1.Lots of feedback received prior to and at the 1st open house 2.Support of revised re-alignment design and other improvements to Fox Hollow Drive near the park 3.Support of drainage improvements within project area and for RPBCWD’s project within the park 4.Generally unhappy with receiving an assessment and the amount of the assessment 5.Staff would like to highlight in the second year of utilizing flat rate assessment amounts … the policy change has greatly reduced the volume of inquiries 512 Fox Hollow Dr. @ North Lotus Lake Park •Standard street width and section •B618 curb in this area to help keep parked cars off lawns •Engineered curvature – 15mph •Removal of unsafe wood posts through curves •Controlled and defined additional street parking for the park included an ADA spot •The northern edge of the cul-de-sac will be within the public right of way •Improved trail alignment within park 513 Bid Results •The low bidder, GMH Asphalt, has previously performed satisfactory project work in conjunction with similar projects within Chanhassen •GMH Asphalt completed the 22-01 and 18-02 street projects for Chanhassen 514 Budget and Cost Summary •The project costs per budgetary fund are shown below: •The project is under-budget in aggregate but the watermain fund is over-budget •The watermain is being fully replaced with the project. This was determined to be feasible and necessary during the design process. 515 Project Schedule •Begin Construction: Expected Week of May 11 or May 18, 2026 •Substantial Completion: Early November 2026 •Final Completion: June 2027 516 Final Assessment Summary •The project follows the 2025 revision of the City’s Assessment Policy which incorporated a Flat Rate assessment methodology for residential properties •Assessment amounts are based on the engineered pavement rehabilitation technique •The proposed assessment amount did not change between the preliminary notification and the final notification letters •2026 Assessment Rates: Mill and Overlay $ 2,940 Full Reconstruction $ 9,550 517 Recommendation •Staff recommends the City Council accept the bids •Staff recommends the City Council award a construction contract to the lowest bidder – GMH Asphalt •Staff recommends the City Council adopt the final assessment roll 518 Questions for Staff? Followed by hosting the Public Hearing 519 Proposed Motion “The Chanhassen City Council adopts a resolution accepting the bids and awarding the construction contract, and also adopts a resolution adopting the assessment roll for the 2026 City Pavement Rehabilitation Project No. 26-01.” 520 City Council Item April 27, 2026 Item Resolution 2026-XX: 7480 Frontier Trail - Easement Acquisition Agreement and Vacation File No.ENG 25-01 and Vacation 26-01 Item No: G.2 Agenda Section PUBLIC HEARINGS Prepared By Joe Seidl, Water Resources Engineer Reviewed By Charlie Howley SUGGESTED ACTION "The Chanhassen City Council approves an easement acquisition agreement with the owners of 7480 Frontier Trail and approves a resolution authorizing the vacation of existing public drainage and utility easement required as part of the agreement in conjunction with the 2025 Street Improvement Project." Motion Type Simple Majority Vote of members present Strategic Priority Asset Management SUMMARY The City of Chanhassen completed improvements to a stormwater pond as part of the 2025 City Pavement Rehabilitation Project No. 25-01. Portions of the pond’s 100-year flood elevation area were not previously covered by a drainage and utility easement, which is required under current standards. Acquiring the additional easement allows the city to rehabilitate the pond, improving its functionality and increasing its ability to treat stormwater that ultimately flows into Lotus Lake. City Staff and the 521 City Attorney worked with the property owners to secure a permanent easement to protect the pond and ensure the city has long-term access for maintenance of this stormwater infrastructure asset. As part of the agreement reached with the property owners a small portion of existing easement is proposed to be vacated as it no longer serves a public purpose. BACKGROUND The existing stormwater pond on the property serves to convey and treat stormwater runoff from a large portion of the Sante Fe Trail, Del Rio Drive, and Laredo Drive neighborhoods before ultimately discharging into Lotus Lake. The pond was in need of maintenance to both improve pond functionality and replace stormwater infrastructure to ensure the pond operates as designed. Portions of the existing pond and associated 100-year flood elevations were not contained within the original drainage and utility easement. The City of Chanhassen performed a pond improvement project on the pond in conjunction with the 2025 City Pavement Rehabilitation project which included pond expansion to improve the pond's capacity to treat stormwater and to provide additional flood mitigation. City Staff worked with property owners to obtain a right of entry to perform the work. DISCUSSION As part of it's Municipal Separate Storm Sewer (MS4) Permit the city is obligated to maintain stormwater infrastructure that conveys public stormwater. Having easements over stormwater infrastructure, including ponds, is essential to allow city staff and contractors the right to access the property to maintain the infrastructure. City Staff worked with the property owners and the City Attorney on an easement agreement. Details of the agreement can be found in the Grant of Permanent Easement legal paperwork attached to this report. Acquiring the easement would resolve the access and ownership issue with this pond. It is common to fix existing issues with maintenance projects including acquiring easements where needed. BUDGET N/A RECOMMENDATION Staff recommends approval of the agreement, easement acquisition, and the vacation of a portion of the existing easement. ATTACHMENTS Resolution_2026-XX_-_Resolution_Vacation_7480_Frontier_Trl GRANT OF PERMANENT DU EASEMENT KASBOHM FINAL Lotus Lake Woods Plat NOTICE_OF_PUBLIC_HEARING_FOR_VACATION_(PAPER) Frontier Trl NOTICE_OF_PUBLIC_HEARING_FOR_VACATION_(MAIL) Frontier Trl Presentation 522 1 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 27, 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: RESOLUTION VACATING RIGHT OF WAY ADJACENT TO LOT 6, BLOCK 1, LOTUS LAKE WOODS, CARVER COUNTY, MINNESOTA WHEREAS, The City of Chanhassen (“City”), is requesting the vacation of a small portion of right of way adjacent to the property platted as Lot 6, Block 1, Lotus Lake Woods, Caver County Minnesota; WHEREAS, the parcel of land that will be part of this plat are legally described as Lot 6, Block 1, Lotus Lake Woods, Caver County Minnesota; WHEREAS, pursuant to Minnesota Statutes § 412.851 the City Council of the City of Chanhassen has conducted a hearing preceded by the statutorily required two (2) weeks published and posted notice and mailed notice to the abutting property owners, to consider the vacation of the Right of Way; WHEREAS, New easements are being dedicated where necessary to allow maintenance for the onsite public stormwater infrastructure; WHEREAS, The Easement acquisition and public right of way vacation are detailed in the Grant of Permanent Easement Agreement. NOW, THEREFORE, BE IT HEREBY RESOLVED by the Chanhassen City Council: 1. The right of way area described in the Grant of Permanent Easement Agreement is hereby vacated conditioned upon the execution and recording of new easements via the agreement to grant easement between the City and the Owners of 7480 Frontier Trail. 2. The vacation shall not affect the authority of any person, corporation, or municipality owning or controlling the electric or telephone poles and lines, gas lines, sanitary and storm sewer lines, water pipes, mains, hydrants, and natural drainage areas thereon or thereund er, to continue maintain the same or to enter upon such way or portion thereof vacated to maintain, repair, replace, remove, or otherwise attend thereof. 3. The City Clerk shall transmit a certified copy of this Resolution to the County Auditor and County Recorder subject to the condition in Paragraph 1 of this Resolution. 523 2 PASSED AND ADOPTED by the Chanhassen City Council this 27th day of April, 2026. ATTEST: ___________________________________ ___________________________________ Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 524 525 526 527 528 529 530 531 CO O U O U O U O U O U OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU OU O U O U O U C E P C C CO CL V T D S S S S P P S 12 0 + 0 0 12 1 + 0 0 122+00 123+00 124+ 0 0 125+ 0 0 126 + 0 0 12 7 + 0 0 PT: 1 2 0 + 1 8 . 2 5 PC: 1 2 0 + 8 6 . 7 1 P T : 1 2 2 + 3 9 . 7 1 P C : 1 2 3 + 1 1 . 8 7 P T : 1 2 3 + 7 8 . 4 1 P C : 1 2 5 + 0 6 . 2 2 PT: 12 7 + 1 3 . 7 5 916 9 1 7 9 1 3 920 923 91 6 919 922 92 3 92 0 9 1 6 9 1 2 9 1 2 920 922 924 920 9 1 5 91 4 916 91 591 4 91 2 91 1 9 1 0 914 913 912 911 912 910 910 915 > > >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> >> > > >> >> >> >> >> 915.76 915.71 915.76 Horizontal Hor i z o n t a l 1: 4 . 9 9 1 6 9 1 7 9 1 8 9 1 5 9 1 6 9 1 7 9 1 8 9 1 9 SHEET B o l t o n & M e n k , I n c . 20 2 6 , A l l R i g h t s R e s e r v e d c H: \ C H A N \ 2 4 X 1 3 5 6 3 7 0 0 0 \ C A D \ C 3 D \ M I S C - 1 3 5 6 3 7 _ P o n d G r a d i n g - E a s e m e n t 2 . d w g 2/ 1 9 / 2 0 2 6 1 : 0 1 : 2 7 P M DESIGNED DRAWN CHECKED CLIENT PROJ. NO. ISSUED FOR DATENO.CITY OF CHANHASSEN, MINNESOTA 2025 CITY PAVEMENT REHABILITATION PROJECT 24X.135637.000DATELIC. NO. I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONAL ENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA. JOSHUA ECKSTEIN 48224 03/26/2025 KJW / JJZ KJW / JJZ RRJ 2638 SHADOW LANE, SUITE 200 CHASKA, MN 55318 Phone: (952) 448-8838 Email: Chaska@bolton-menk.com www.bolton-menk.comR R A LOTUS LAKE BASIN EASEMENT-GRADING EXHIBITFEETSCALE 0 20 40 HORZ. LEGEND SOIL BORINGS EXISTING MAJOR/MINOR CONTOURS PROPOSED MAJOR/ MINOR CONTOURS PROPOSED/EXISTING DRAINAGE FLOW CONSTRUCTION LIMITS 950 951 951 950 NOTE: 1.ALL GRADING AROUND PONDS, STREAMS, AND RAVINES SHALL BE 3:1 OR FLATTER. 532 533 534 NOTICE OF PUBLIC HEARING CITY OF CHANHASSEN COUNTY OF CARVER AND COUNTY OF HENNEPIN STATE OF MINNESOTA CITY COUNCIL MEETING April, 27, 2026 7:00 p.m. CHANHASSEN CITY HALL 7700 Market Boulevard, Chanhassen, MN 55317 NOTICE IS HEREBY GIVEN that the City Council for the City of Chanhassen will hold a public hearing on Monday, April, 27, 2026, at 7:00 p.m., in the Council Chambers at Chanhassen City Hall, 7700 Market Boulevard, pursuant to Minnesota Statutes § 412.851 to consider the vacation of a drainage and utility easement dedicated in Lot 6, Block 1, LOTUS LAKE WOODS, Carver County, Minnesota, which vacation is legally described as follows: Commencing at the most northerly northwest corner of said Lot 6; thence on assumed bearing of South 40 degrees 28 minutes 02 seconds West, along the northwesterly line of said Lot 6, a distance of 2.91 feet; thence South 49 degrees 31 minutes 58 seconds East a distance of 24.49 feet to a point on the existing drainage and utility easement line as donated on said LOTUS LAKE WOODS; thence North 41 degrees 21 minutes 38 seconds East, along said easement line, a distance of 7.82 feet; thence South 89 degrees 33 minutes 22 seconds East, along said easement line, a distance of 40.00 feet; thence South 81 degrees 53 minutes 22 seconds East, along said easement line, a distance of 89.00 feet; thence South 11 degrees 01 minute 38 seconds West, along said easement line, a distance of 20.82 feet to the point of beginning of the easement to be described; thence continuing South 11 degrees 01 minutes 38 seconds West, along said easement line, a distance of 7.18 feet; thence South 27 degrees 23 minutes 22 seconds East, along said easement line, a distance of 18.23 feet; thence North 00 degrees 39 minutes 40 seconds West a distance of 8.71 feet; thence North 25 degrees 27 minutes 27 seconds West, a distance of 16.08 feet to the point of beginning. All interested parties are encouraged to attend this public hearing and express their opinions with respect to this proposal. If you have any questions, please contact: Mackenze Grunig, Project Engineer Phone: (952) 227-1165 (Publish in the Sun Sailor on April 16 & April 23, 2026) 535 NOTICE OF PUBLIC HEARING CITY OF CHANHASSEN COUNTY OF CARVER AND COUNTY OF HENNEPIN STATE OF MINNESOTA CITY COUNCIL MEETING April, 27, 2026 7:00 p.m. CHANHASSEN CITY HALL 7700 Market Boulevard, Chanhassen, MN 55317 NOTICE IS HEREBY GIVEN that the City Council for the City of Chanhassen will hold a public hearing on Monday, April, 27, 2026, at 7:00 p.m., in the Council Chambers at Chanhassen City Hall, 7700 Market Boulevard, pursuant to Minnesota Statutes § 412.851 to consider the vacation of a drainage and utility easement dedicated in Lot 6, Block 1, LOTUS LAKE WOODS, Carver County, Minnesota, depicted as follows: All interested parties are encouraged to attend this public hearing and express their opinions with respect to this proposal. If you have any questions, please contact: Mackenze Grunig, Project Engineer Phone: (952) 227-1165 536 Easement Acquisition Agreement and Partial Vacation of Existing Public Drainage and Utility Easement For the property located at 7480 Frontier Trail City Council meeting April 27, 2026 537 Location Map 538 Existing Plat – 1996 Lot 6, Block 1 539 Easement Acquisition •The City completed improvements to the stormwater pond on the property as part of the 2025 City Pavement Rehabilitation Project. Portions of the pond’s 100-year flood elevation area are not covered by a D&U easement. •A right of entry was used to perform the work. 540 Easement Vacation •The area to be vacated is no longer needed for the pond and is being vacated as part of the agreement with the property owner for the acquisition area 541 Public Hearing Vacating Public Drainage and Utility Easements requires the city to hold a Public Hearing. The hearing was duly noticed and scheduled. No public comments have been received to date by the Engineering Department. 542 Recommended Motion "The Chanhassen City Council adopts a resolution approving a Grant of Permanent Easement and authorizes the partial vacation of existing public drainage and utility easement for the property located at 7480 Frontier Trail, Lot 6, Block 1, Lotus Lake Woods, Carver County, Minnesota." 543 City Council Item April 27, 2026 Item Resolution 2026:XX and Ordinance XXX: Consider a Metes & Bounds Subdivision and Rezoning from Rural Residential to Single-Family Residential for the property located at 6651 Galpin Boulevard File No.Planning Case #2026-06 Item No: G.3 Agenda Section PUBLIC HEARINGS Prepared By Rachel Arsenault, Associate Planner Reviewed By SUGGESTED ACTION “The Chanhassen City Council approves the proposed metes & bounds subdivision and rezoning from Rural Residential to Single-Family Residential for the property located at 6651 Galpin Boulevard.” Motion Type Simple Majority Vote of members present Strategic Priority Development & Redevelopment SUMMARY The Applicant is requesting a metes & bounds subdivision and a rezoning from Rural Residential to Single-Family Residential for the property located at 6651 Galpin Boulevard. BACKGROUND This property is located in the Lake Lucy Highlands development, platted in 1986. This development was guided as Residential Large Lot by the 2040 Comprehensive Plan. City sewer and water service were made accessible to this property during the reconstruction of Galpin Boulevard in the summer of 2024. The extension of these services made the property eligible to be reguided in accordance with the policies of the 2040 Comprehensive Plan. 544 On March 24, 2025, the Chanhassen City Council approved a Comprehensive Plan Amendment to reguide the property in the 2040 Comprehensive Plan from Residential Large Lot to Residential Low Density. This made the property eligible to be rezoned and subdivided. DISCUSSION BUDGET RECOMMENDATION The Chanhassen Planning Commission recommended approval of the requested rezoning from Rural Residential to Single-Family Residential for the property located at 6651 Galpin Boulevard, subject to the conditions of the staff report. The Planning Commission does not review or make recommendations for metes & bounds subdivisions and therefore does not make a recommendation on that portion of the proposal. ATTACHMENTS Resolution Metes and Bounds Subdivision Rezoning Ordinance Development Application Narrative Plan Set Survey Staff Report Findings of Fact and Decision 545 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: April 27, 2026 RESOLUTION NO: 2026-XX MOTION BY: SECONDED BY: A RESOLUTION APPROVING A METES AND BOUNDS SUBDIVISION AT 6651 GALPIN BOULEVARD, CHANHASSEN, MINNESOTA WHEREAS, the Property Owners of 6651 Galpin Boulevard have requested subdivision approval, described as Exhibit A, with a metes-and-bounds property description on property in Chanhassen described in Exhibit B: WHEREAS, the property is guided by the 2040 Comprehensive Plan as Residential Low Density; and WHEREAS, the property shall be rezoned in accordance with the City of Chanhassen Comprehensive Plan; and WHEREAS, the proposed metes and bounds subdivision complies with all requirements of the Chanhassen City Code; and WHEREAS, the proposed metes and bounds subdivision adequately provides for water supply, storm drainage, sewage disposal, streets, erosion control and all other improvements required by the city; and WHEREAS, the proposed metes and bounds subdivision is consistent with the Chanhassen Comprehensive Plan and Zoning ordinance. NOW, THEREFORE, BE IT RESOLVED that the Chanhassen City Council hereby approves a metes and bounds subdivision consisting of two parcels, Exhibit B, subject to the conditions of approval in the staff report dated April 22, 2026, and adoption of the Findings of Fact and Decision. PASSED AND ADOPTED by the Chanhassen City Council this 27th day of April 2026. ATTEST: Jenny Potter, City Clerk Elise Ryan, Mayor YES NO ABSENT 546 Exhibit A: Lot 2, Block 1, Lake Lucy Highlands, Carver County, Minnesota. 547 Exhibit B: Parcel A: The north 105 feet of Lot 2, Block 1, Lake Lucy Highlands, Carver County, Minnesota. Parcel B: That part of Lot 2, Block 1, Lake Lucy Highlands, Carver County, Minnesota lying south of the north 105 feet thereof. 548 1 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA ORDINANCE NO. ___ AN ORDINANCE AMENDING CHAPTER 20 OF THE CHANHASSEN CITY CODE, THE CITY'S ZONING ORDINANCE, BY REZONING CERTAIN PROPERTY TO SINGLE-FAMILY RESIDENTIAL DISTRICT (RSF) THE CITY COUNCIL OF THE CITY OF CHANHASSEN ORDAINS: Section 1. Chapter 20 of the Chanhassen City Code, the City's zoning ordinance, is hereby amended by rezoning all property in attached Exhibit A from Rural Residential (RR) to Single- Family Residential (RSF). Section 2. The zoning map of the City of Chanhassen shall not be republished to show the aforesaid zoning, but the Clerk shall appropriately mark the zoning map on file in the Clerk's Office for the purpose of indicating the rezoning hereinabove provided for in this ordinance, and all the notations, references, and other information shown thereon are hereby incorporated by reference and made a part of this ordinance. Section 3. This ordinance shall be effective immediately upon its passage and publication. PASSED AND ADOPTED this 27th day of April 2026, by the City Council of the City of Chanhassen, Minnesota. Jenny Potter, City Clerk Elise Ryan, Mayor (Published in _________________ on _______, 2026) 549 2 EXHIBIT A Lot 2, Block 1, Lake Lucy Highlands, Carver County, Minnesota. 550 551 552 Proposed amendment for Lot 2, Block 1, Lake Lucy Highlands Address: 5551 Galpin Boulevard Excelsior, Minnesota 55331 Ownerc: Steven W. Buresh and Wendy Lam Buresh Held in the Buresh Living Trust With the completion of the active sanitary sewer and city water connections on Galpin Boulevard north from Lake Lucy Road in 2024 and the two separate city connections created on the above property, we would like to propose the following amendments. 1) Rezone our property from large lot residential to residential low density. 2) Subdivide our 2.5-acre lot into two 1.25 acre lots. The current 2.5-acre lot is 235 feet on the east and west (facing Galpin Boulevard) sides. The proposed amendment would produce two lots 117.5 feet on the east and west sides and would remain 350 feet on the north and south sides. The existing home at 6551 Galpin Boulevard would remain on the new northern 1.25-acre lot. ln regards to the new southern 1.25-acre lot, our proposal is to build a new single level residential home after the sale of our existing home at 6651 Galpin Boulevard on the northern lot. This proposed change seems to fit with staff's future desire for the area and fits with the sanitary sewer and city water work that was done as part of the 2024 portion of the Galpin Boulevard project. Thank you for your consideration in this proposal. Steven W. Buresh and Wendy Lam Buresh 5651 Galpin Boulevard Excelsior, Minnesota 55331 Phone: 612-570-5983 553 55 4 55 5 PH (952) 227 -1100 • ChanhassenMN.gov 7700 MARKET BOULEVARD • PO BOX 147 • CHANHASSEN • MINNESOTA • 55317 Application: Metes & Bounds Subdivision and Rezoning (Planning Case #2026-06) Staff Report Date: April 22, 2026 Drafted By: Rachel Arsenault, Associate Planner Joe Seidl, Water Resources Engineer Mackenze Grunig, Project Engineer Planning Commission Review Date: April 7, 2026 City Council Review Date: April 27 2026 SUMMARY OF REQUEST: The Applicant is requesting a metes & bounds subdivision and a rezoning from Rural Residential to Single-Family Residential for the property located at 6651 Galpin Boulevard. PLANNING COMMISSION RECOMMENDATION: The Chanhassen Planning Commission recommends approval of the requested rezoning from Rural Residential to Single -Family Residential for the property located at 6651 Galpin Boulevard. The Planning Commission does not review metes & bounds subdivision proposals and therefore does not make a recommendation on that portion of the proposal. LOCATION: 6651 Galpin Blvd PID: 254070020 DEVELOPER/APPLICANT/ OWNER: Steve & Wendy Buresh PRESENT ZONING: Rural Residential, RR 2040 LAND USE PLAN: Residential Low Density ACREAGE: 2.50 acres DENSITY: 1.11 net units/acre PROPOSED MOTION: “The Chanhassen City Council approves the proposed metes & bounds subdivision and rezoning from Rural Residential to Single-Family Residential for the property located at 6651 Galpin Boulevard.” 556 LEVEL OF CITY DISCRETION IN DECISION-MAKING: The city has discretion in approving a rezoning because the city is acting in its legislative or policy-making capacity. A rezoning must be consistent with the city’s Comprehensive Plan. The city’s discretion in approving or denying a metes & bounds subdivision is limited to whether or not the proposed project complies with zoning ordinance requirements. If it meets these standards, the city shall approve the subdivision. This is a quasi-judicial decision. Notice of this public hearing has been mailed to all property owners within 500 feet. Notice of the rezoning public hearing at Planning Commission was mailed to all property owners within 500 feet. APPLICABLE REGULATIONS City of Chanhassen 2040 Comprehensive Plan and 2040 Future Land Use Map Chapter 18 – Subdivisions Chapter 20 – Article 20-XII RSF Single-Family Residential Chapter 20 – Article 20-VI Wetland Protection PROPOSAL/SUMMARY The Applicant is requesting a metes & bounds subdivision and a rezoning from Rural Residential to Single-Family Residential for the property located at 6651 Galpin Boulevard. BACKGROUND This property is located in the Lake Lucy Highlands development, platted in 1986. This development was guided as Residential Large Lot by the 2040 Comprehensive Plan. City sewer and water service were made accessible to this property during the reconstruction of Galpin Boulevard in the summer of 2024. The extension of these services made the property eligible for reguidance in accordance with the policies of the 2040 Comprehensive Plan. On March 24, 2025, the Chanhassen City Council approved a reguidance of the property in the 2040 Comprehensive Plan from Residential Large Lot to Residential Low Density. This reguidance made the property eligible for rezoning and subsequently subdivision. EXISTING CONDITIONS The property currently has one single-family home that meets the criteria of the Single-Family Residential zoning district. The home is situated on the north side of the property, and the driveway connects to the right-of-way on the north end of the property, which is preferred by engineering to minimize driveway access on a collector road such as Galpin Boulevard. There are no proposed changes to the existing structures or access. 557 METES AND BOUNDS SUBDIVISION Parcel Attributes Parcel A Parcel B RSF Zoning (MIN) Lot Frontage 105 feet 130 feet 90 feet Lot Depth 463.41 feet 463.41 feet 125 feet Lot Size 48,658.05 sq ft 60,243.30 sq ft 15,000 sq ft Developable Area 18,623.3 sq ft 18,531.37 sq ft - The proposed parcels for the metes & bounds subdivision meet the lot frontage minimum, lot depth minimum, and lot size minimum for the Single-Family Residential zoning district requested. The existing single-family home on Parcel A meets all the RSF Single-Family Residential Zoning code requirements, including front setback minimum, side setback minimum, rear setback minimum, and maximum lot coverage. Based on the developable area of the proposed parcels, the proposed density is approximately 2.35 dwelling units per acre. This is in accordance with the Residential Low Density guidance, which requires a minimum of 1.2 or a maximum of 4 dwelling units/acre based on the 2040 Comprehensive Plan. SURROUNDING ZONING DESIGNATION The properties to the north, south, and east are zoned Rural Residential. The property to the west is zoned Single-Family Residential. The Single-Family Residential zoning district is abundant surrounding this development and is a common zoning designation for this area of Chanhassen. The proposed rezoning is compatible with the character of the neighboring area. LAND USE ZONING CONSISTENCY The following zoning districts are consistent with Residential - Low Density land use in the 2040 Comprehensive Plan: • Single-Family Residential District, RSF; • Mixed Low Density Residential District, R-4; • Residential Low and Medium Density Residential District, RLM; and • Planned Unit Development – Residential, PUD-R. The applicant is proposing a zoning district in conformance with the 2040 Comprehensive Plan Guidelines. ENGINEERING PROJECT OVERVIEW The applicant is requesting a Metes and Bounds subdivision and site plan review for the creation of a second lot at the property located at 6651 Galpin Boulevard south of the existing 558 house. The proposal includes improvements to the site consisting of a new home and driveway, and new stormwater management features. Plans and a stormwater report dated March 9, 2026, both prepared by Lake & Land Surveying, were reviewed by staff. STREETS AND DRIVEWAY ACCESS The Developer proposes access to the subdivision via the existing public street abutting the property: Galpin Blvd. The Developer will be required to remove a portion of existing curb to construct a new driveway access to Galpin Blvd. The removal limits were not shown within the submitted plans and will be required to be shown prior to receiving the city’s Right of Way permit needed to construct the driveway. The driveway for Parcel B will be required to position as far south on the lot as possible while meeting city code regulations. This requirement aligns future potential driveways next to one another to effectively minimize the access point on Galpin Boulevard, a collector roadway. WETLANDS The proposed plan identifies one (1) wetland on -site, delineated by Midwest Natural Resources on March 3, 2026. This delineation has not yet been reviewed or approved by the City of Chanhassen in its role as the Local Government Unit (LGU) responsible for administering the Wetland Conservation Act (WCA). Wetland reviews under the WCA involve the Technical Evaluation Panel (TEP), which includes representatives from the city, Watershed District, Minnesota Department of Natural Resources (DNR), Board of Water and Soil Resources (BWSR), and the Carver County Soil and Water Conservation District (SWCD). The TEP is responsible for reviewing wetland applications, including confirming wetland types and boundaries. The submittal identifies the following wetland on-site: • Wetland 1 – sloping/depressional, Type 2/3/5 complex consisting of fresh wet meadow, shallow marsh, and open water. The applicant must submit a formal WCA Joint Permit Application (JPA) to the city. Upon receipt, the city and TEP will review the application and conduct a site visit to verify the wetland’s location and type. The JPA must be approved by the LGU prior to recording the subdivision. A formal Notice of Decision will be issued by the LGU to document the wetlan d boundary and establish the required buffer. Based on the current plan, the wetland does not appear to be directly impacted by development or construction. However, WCA regulations and City Ordinances are intended to protect wetlands due to their value for water quality, flood mitigation, and wildlif e habitat. The proposed subdivision will trigger wetland buffer requirements under Article VI, Chapter 20 of the City Code. Accordingly, the applicant must establish the required buffers following confirmation of the wetland delineation and MnRAM assessment by the TEP. The verified wetland boundary and buffer must be incorporated into the final survey prior to the issuance of building permits. 559 GRADING & DRAINAGE The proposed second lot, south of the existing house, currently contains open grass, wooded areas, and a wetland. Under existing conditions, the west half of the site drains southeast to a point just off-site, then re-enters the property in the southeastern portion. Ultimately, drainage from the entire site flows southeast off-site into a natural drainage channel. Under proposed conditions, the western half of the second lot will be mass graded to accommodate a new house and driveway. Overall, drainage patterns will remain generally consistent with existing conditions. An iron-enhanced filtration basin Best Management Practice (BMP) is proposed to treat runoff from new impervious surfaces, with a rate control basin located upstream of the filtration basin. Most disturbed areas will drain southeast to the proposed rate control basin and filtration system before discharging off-site to a southeast drainage ditch. However, a small portion in the southwest appears to drain south off -site under proposed conditions, bypassing the treatment BMPs. This flow path is not reflected in the current mapped drainage boundaries. The proposed iron-enhanced filtration basin and rate control basin are intended to provide treatment for new impervious surfaces and to meet applicable discharge rate requirements. However, the current design needs to be modified to meet rate control, volume control, or water quality requirements. EROSION CONTROL The proposed development is not expected to exceed one (1) acre of disturbance and will, therefore, not be subject to the General Permit Authorization to Discharge Stormwater Associated with Construction Activity Under the National Pollution Discharge Elimination/State Disposal System (NPDES Construction Permit). Though a NPDES permit is not required, the project shall still adhere to erosion and sediment control guidelines as outlined in Section 19 - 145 of City Code. All erosion control shall be installed and inspected by city staff prior to initiation of site grading activities. Total site disturbance shall be confirmed prior to issuance of building permits. The applicant shall develop a complete erosion control plan subject to staff approval. No earth-disturbing activities may occur until an approved erosion control plan is developed and implemented. 560 STORM WATER MANAGEMENT Article VII, Chapter 19 of the City Code establishes the required stormwater management development standards. Section 19-141 states that these standards must be reflected in plans prepared by developers and project proposers in the design and layout of site plans, subdivisions, and water management features. The standards require abstraction of runoff and water quality treatment sufficient to achieve removal of 90 percent total suspended solids (TSS) and 60 percent total phosphorus (TP). The proposed project is located within the jurisdiction of the Riley Purgatory Bluff Creek Watershed District and is therefore subject to its rules and regulations. A permit from the watershed district will be required prior to the issuance of building per mits. A Stormwater Management Report has been submitted for review to verify compliance with all applicable stormwater management requirements, including rate control, volume abstraction, and water quality treatment. All review comments from both the city and the watershed district must be addressed prior to project approval. The proposed design includes a rate control basin and an iron -enhanced filtration basin to meet stormwater management requirements. Surface runoff associated with the proposed rate control basin and filtration basin was evaluated as part of this analysis. However, design conditions chosen for TP and TSS modeling do not match the project plans. Due to inconsistencies, which include the modeled pond design level, compliance with removal standards cannot be confirmed at this time. The applicant submitted calculations and supporting documentation indicating that the proposed drainage design will not adversely impact adjacent properties. However, discrepancies were identified between the HydroCAD and MIDS models and the project plans. As a result, compliance with rate control requirements cannot be verified. These discrepancies include inconsistencies in storage surface areas and volumes, drainage boundaries, the pond overflow weir profile, and the treatment volume provided. In addition, the analysis should include the entire disturbed area, as well as any off-site areas that drain to the project site, to evaluate rate control. On-site undisturbed areas and off-site drainage to the west and north should also be analyzed, as the current drainage boundaries do not reflect the proposed site conditions. As part of the final site plan review and agreement, the applicant shall submit final versions of the stormwater modeling (HydroCAD and MIDS) and an updated Stormwater Management Report that addresses all outstanding comments and confirms compliance with rate control, volume abstraction, and water quality standards. All stormwater infrastructure on the site will be privately owned and maintained. The applicant shall prepare an Operation and Maintenance (O&M) Plan for the private stormwater infrastructure onsite. Maintenance of private stormwater systems is required in perpetuity. The O&M Plan must be approved by the Water Resources Engineer, or their designee, and recorded against the benefiting property. The stormwater O&M agreement shall be recorded prior to the issuance of building permits. 561 ANALYSIS – SUBDIVISION 1. (IS/IS NOT) consistent with the zoning ordinance; The proposed subdivision is consistent with the zoning ordinance. 2. (IS/IS NOT) consistent with all applicable city, county and regional plans including but not limited to the city's comprehensive plan; The proposed subdivision is consistent with applicable city, county and regional plans including but not limited to the city’s comprehensive plan. 3. The physical characteristics of the site, including but not limited to topography, soils, vegetation, susceptibility to erosion and siltation, susceptibility to flooding, and stormwater drainage (ARE/ARE NOT) suitable for the proposed development; The physical characteristics of the site are suitable for proposed development in accordance with staff conditions. 4. The proposed subdivision (DOES/DOES NOT) make adequate provision for water supply, storm drainage, sewage disposal, streets, erosion control and all other improvements required by this chapter; The proposed subdivision has adequate provision for all utilities. 5. The proposed subdivision (WILL/WILL NOT) cause environmental damage; The proposed subdivision will not cause environmental damage. 6. The proposed subdivision (WILL/WILL NOT) conflict with easements of record; The proposed subdivision will not conflict with easements of record. 7. The proposed subdivision (IS/IS NOT) not premature. The proposed subdivision is not premature in nature. ANALYSIS - REZONING Staff has reviewed the proposal and found it to be in conformance with the following criteria for rezoning property. 1. The proposed zoning has been considered in relation to the specific policies and provisions of and has been found to be consistent with the official City of Chanhassen 2040 Comprehensive Plan for Residential Low Density land use areas. 2. The proposed zoning is or will be compatible with the present and future land uses of the area. 3. The proposed zoning conforms to all performance standards contained in the Zoning Ordinance. 4. The proposed zoning will not tend to or actually depreciate the area in which it is proposed. 5. The proposed zoning can be accommodated with existing and planned public services and will not overburden the city's service capacity. 562 6. Traffic generation by the proposed use within the zoning district is within the capabilities of the streets serving the property. STAFF RECOMMENDATION Staff recommends that the Chanhassen City Council approve the requested metes & bounds subdivision and proposed rezoning from Rural Residential to Single -Family Residential for the property located at 6651 Galpin Boulevard, subject to the conditions of this report. APPLICATION REVIEW STAFF COMMENTS Water Resources: 1. The Developer and their design Engineer shall work with City Staff in amending the plans, dated March 9, 2026, prepared by Lake & Land Surveying, to fully satisfy plan comments and concerns. Final construction plans will be subject to review and approval by staff. 2. The Developer shall confirm filtration treatment volume provided onsite and verify that all stormwater design aspects match as modeled in HydroCAD and MIDS, presented in the stormwater management report, and shown on the plans. The applicant shall submit verification that rate control and water quality requirements are met prior to issuance of building permits. 3. The Developer shall secure an approved wetland type and boundary LGU decision prior to recording the subdivision. 4. The Developer shall work with staff to develop and implement an erosion and sediment control plan prior to the initiation of grading activities. 5. The Developer shall provide an explanation of treatment methods utilized in MIDS modeling or revise the model parameters to align with site conditions and verify compliance with water quality requirements prior to issuance of building permits. 6. Soil testing shall be required during construction to confirm underlying soil conditions are present at the basin location, since initial soil borings were not provided. 7. It is the Developer’s responsibility to ensure that permits are received from all other applicable agencies with jurisdiction over the project (i.e. Army Corps of Engineers, DNR, MnDOT, Carver County, RPBC Watershed District, Board of Water and Soil Resources, MDH, MPCA, etc.). The applicant shall submit verification that all applicable permits have been secured prior to the issuance of building permits. 8. The Developer shall provide final versions of hydrologic and hydraulic (H&H) and water quality modelling with the building permit submittal. 9. The Developer shall develop a maintenance plan for the private on-site stormwater system. An Operations and Maintenance Agreement shall be recorded prior to the issuance of building permits. Engineering: 563 1. The Developer shall enter into Encroachment Agreements for all private improvements located within public drainage and utility easements or right -of-way, as approved by the City Engineer, prior to issuance of building permits. 2. The Developer shall provide revised plans prepared by James Grams, dated March 9, 2026. 3. The Developer’s plans show a retaining wall along the drainage and utility easement. The applicant shall verify that no footings or structural components of the retaining wall are located within the easement. 4. The plans shall show bituminous trail removals due to driveway construction, as well as damage caused by installation of the existing home’s sewer and water services. 5. The plans shall show the date when the well on the site was sealed. 6. The plans shall be adjusted to show the rock entrance located outside the bituminous path. 7. The Developer shall provide appropriate trail signage when the path is closed. 8. The plans shall include curb and asphalt removal and replacement, as well as applicable city detail sheets. 9. The Developer shall provide revised plans for review and approval. 10. It is the Developer’s responsibility to ensure that all required permits are obtained from other agencies with jurisdiction over the project. Planning: 1. The driveway location for Parcel B shall require approval by City Staff. Forestry: 1. Tree survey: Survey requirements are laid out in Chapter 18 -61 of City Code where all trees over 5” dbh must be surveyed which would include location, diameter, species, condition rating and marked whether or not it is being removed or saved. All trees where the critical root zone (as defined in Chapter 1) that may be impacted by construction must be included on the survey. 2. A delineation of existing canopy coverage is needed. This can be done by taking an up- to-date aerial view of the site and calculating existing canopy coverage, minimum canopy coverage required and the canopy coverage post-construction. 3. Tree preservation detail: map of the site that includes the location of tree preservation fencing. Should also include fencing details itself- ex. 4’ orange snow fence will be used for tree protection fencing around the critical root zone of trees etc. 564 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA FINDINGS OF FACT AND DECISION IN RE: Application of Steve & Wendy Buresh for a metes & bounds subdivision and rezoning proposal. On April 7, 2026, the Chanhassen Planning Commission met at its regularly scheduled meeting to consider the application for rezoning located at 6651 Galpin Boulevard. The Planning Commission conducted a public hearing on the proposed development which was preceded by published and mailed notice. The Planning Commission heard testimony from all interested persons wishing to speak and made a recommendation of approval. On April 27, 2026, the City Council met at its regularly scheduled meeting to consider the rezoning and hold a public hearing for the metes & bounds subdivision. The City Council held a public hearing on the proposed development which was preceded by published and mailed notice. The City Council heard testimony from all interested persons wishing to speak and based on the rezoning and subdivision applications before the City Council, the City Council makes the following: FINDINGS OF FACT 1. On March 6, 2026 the City received a land use application for the property legally described in attachment Exhibit A for the following: A. A rezoning from Rural Residential (RR) to Single-Family Residential (RSF). B. A metes & bounds subdivision to create two parcels. 2. The property is currently zoned Rural Residential. 3. The property is guided by the Land Use Plan as Residential Low Density. 4. The Single-Family Residential (RSF) zoning district is an eligible zoning district for the Residential Low Density land use designation. REZONING FINDINGS 5. The proposed RSF Single-Family Residential District meets the required standards for approval: a. The proposed zoning has been considered in relation to the specific policies and provisions of and has been found to be consistent with the official City of Chanhassen 2040 Comprehensive Plan for Residential Low Density land use areas. Finding: The proposal for rezoning is consistent with the Comprehensive Plan. b. The proposed zoning is or will be compatible with the present and future land uses of the area. 565 Finding: The proposed zoning will be compatible with the present and future land uses of the area, as the proposed is single-family residential. c. The proposed zoning conforms to all performance standards contained in the Zoning Ordinance. Finding: The proposed zoning conforms to all performance standards in the zoning ordinance for Single-Family Residential. d. The proposed zoning will not tend to or actually depreciate the area in which it is proposed. Finding: The proposed zoning will not tend to or actually depreciate the area in which it is proposed. e. The proposed zoning can be accommodated with existing and planned public services and will not overburden the city's service capacity. Finding: The proposed zoning can be accommodated with existing public services and will not overburden the service capacity as the utilities were installed for the development with the reconstruction of Galpin Boulevard. f. Traffic generation by the proposed use within the zoning district is within the capabilities of the streets serving the property. Finding: The impact to traffic with this development will be minimal and is within the capabilities of Galpin Boulevard, as only one additional single-family home can be constructed in addition to the existing single-family home. SUBDIVISION FINDINGS a. The proposed subdivision is consistent with the zoning ordinances; Finding: No conflicts were found between the zoning ordinance and the proposed subdivision. b. The proposed subdivision is consistent with all applicable city, county and regional plans including but not limited to the City's Comprehensive Plan; Finding: The proposed subdivision is consistent with the property’s guidance under the City’s 2040 Comprehensive Plan and regional plans. c. The physical characteristics of the site, including but not limited to topography, soils, vegetation, susceptibility to erosion and siltation, susceptibility to flooding, and stormwater drainage are suitable for the proposed development; Finding: The physical characteristics of the site are conducive to residential single-family development. 566 d. The proposed subdivision makes adequate provision for water supply, storm drainage, sewage disposal, streets, erosion control, and all other improvements required by the subdivision ordinance, Chapter 18, and Water, Sewers and Sewage Disposal, Chapter 19; Finding: The proposed subdivision makes adequate provision for all utilities, access, erosion control, and all other improvements required by City Code.. e. The proposed subdivision will not cause significant environmental damage; Finding: The proposed subdivision is not expected to cause significant environmental damage. f. The proposed subdivision will not conflict with easements of record; and Finding: The proposed subdivision will not conflict with existing easements. g. The proposed subdivision is not premature since adequate infrastructure is available. A subdivision is premature if any of the following exists: 1). Lack of adequate stormwater drainage. 2). Lack of adequate roads. 3). Lack of adequate sanitary sewer systems. 4). Lack of adequate off-site public improvements or support systems. Finding: The proposed subdivision is not premature as adequate infrastructure is available to serve the proposed parcels. 6. The planning report Planning Case 2026-05, dated April 22, 2026, prepared by Rachel Arsenault, et al, is incorporated herein. 567 DECISION The City Council approves the Rezoning and Metes & Bounds Subdivision subject to the conditions outlined in the staff report. ADOPTED by the Chanhassen City Council this _____ day of _____________, 2026. CHANHASSEN CITY COUNCIL BY:___________________________________ Its Mayor BY:_ __________________________________ Its City Manager 568 EXHIBIT A Lot 2, Block 1, Lake Lucy Highlands, Carver County, Minnesota. 569 City Council Item April 27, 2026 Item Approve Facility Management Agreement for the Chanhassen Community Center with Sports Facilities Companies File No.Item No: H.1 Agenda Section GENERAL BUSINESS Prepared By Laurie Hokkanen, City Manager Reviewed By SUGGESTED ACTION "The Chanhassen City Council approves entering into a contract with Sports Facilities Companies for pre-opening and management services of the Chanhassen Community Center, subject to minor modifications as may be made by legal counsel." Motion Type Simple Majority Vote of members present Strategic Priority Financial Sustainability SUMMARY BACKGROUND The City Council will consider a management services agreement with Sports Facilities Companies to support the successful planning, activation, and long-term operations of the Chanhassen Community Center. Sports Facilities Companies brings national expertise in operating multi-use recreation and community facilities, including programming, membership development, and revenue optimization. This partnership will provide the city with experienced, data-driven guidance during final design and pre-opening phases, while positioning the facility for strong operational performance from day one. Approving this agreement aligns with the city’s commitment to delivering a high-quality, financially sustainable community asset that serves residents of all ages and stages. 570 DISCUSSION The management contract allows the city to retain control and ownership while leveraging specialized expertise to operate a complex, multi-use facility efficiently and successfully from day one. 1. Phased Engagement (Pre-Opening + Operations) SFC was engaged early during final design and construction. They have provided input on layout, programming space, staffing models, and revenue opportunities. Transition into full operational support at opening. Flat rate of $180,000 for pre-opening services as fully described in the attached proposal. 2. City Ownership and Policy Control The city retains ownership of the facility and sets policy direction (fees, access, priorities). SFC operates within cty-approved budgets, policies, and performance expectations. 3. Day-to-Day Operations SFC is responsible for daily management, including staffing, programming, memberships, scheduling, and customer experience. Focus on activating all spaces (ice, turf, fitness, community rooms, etc.) to maximize use. 4. Financial Management & Accountability Annual budget developed collaboratively with city oversight and Council approval. Regular financial reporting, forecasting, and performance tracking. Emphasis on revenue generation and cost control to support long-term sustainability. 5. Performance Metrics Clear KPIs tied to participation, membership growth, cost recovery, and customer satisfaction. Ongoing evaluation to ensure the facility meets both financial and community goals. 6. Staffing Model Staff may be a mix of SFC-employed and/or city employees, depending on final structure. Currently, General Manager will continue to be a city employee and all other staff will be SFC- employed. SFC leads hiring, training, and operational standards to ensure consistency and quality. 571 7. Risk Management Defined roles for liability, insurance, and compliance. SFC brings industry best practices for safety, operations, and maintenance coordination. 8. Term and Flexibility The agreement includes an initial term of 8 years, with renewal options. Off-ramps and performance-based provisions allow the city to maintain control and adjust if needed. 9. Marketing and Partnerships SFC leads branding, membership sales strategies, and program development. Supports sponsorships, partnerships, and community engagement efforts. BUDGET The city intends to operate the Chanhassen Community as a cost-neutral venture, with operating costs covered by revenues (excluding debt service and long-term maintenance costs). The pro forma completed for the SFC project indicates that the break-even point is expected to begin in Year Three of operations. The city intends to use the fund balance reserved for this purpose to cover operating gaps prior to. The $180,000 fee for pre-opening services was anticipated and included in the overall project budget. During the term of the management agreement, SFC will receive compensation from the city as follows, as provided in Exhibit B of the contract. 1. Base Management Fee $25,000 per month 2. Deferred Management Incentive Fee 3. Sponsorship & Advertising Compensation 4. Employee Compensation 5. Reimbursed Expenses RECOMMENDATION Staff recommends that the City Council approve the Facility Management Agreement with Sports Facilities Companies. ATTACHMENTS Final Draft CC packet SFC Contract 572 Exhibit C 573 1 FACILITY MANAGEMENT AGREEMENT between CITY OF CHANHASSEN and SPORTS FACILITIES MANAGEMENT, LLC Dated: April 27, 2026 574 2 FACILITY MANAGEMENT AGREEMENT THIS FACILITY MANAGEMENT AGREEMENT (the "Agreement") is made and entered into this 27th, Day of April (the "Effective Date"), by and between the City of Chanhassen (the "Owner" or “City”) and Sports Facilities Management, LLC, a Florida limited liability company (the "Manager"). RECITALS WHEREAS, Owner owns the infrastructure, buildings, parking, lighting, sports playing surfaces, sports equipment, and all other hard assets associated with the athletic complex as the same exist now or may exist in the future including improvements related thereto specifically located at Powers Boulevard and Highway 212 as the same exist now or may exist in the future, known as the "Chanhassen Bluffs Community Center” or any other name that may be identified in the future and more particularly described in Exhibit C attached hereto ("Facility"); WHEREAS, Manager has expertise in providing management services for athletic complex facilities throughout the United States; WHEREAS, Owner and Manager desire for Sports Facilities Management, LLC to open, operate, and manage the Facility subject to the terms and conditions set forth herein; NOW THEREFORE, in consideration of the promises and covenants herein contained and other good and valuable consideration, the receipt of which is hereby acknowledged, Owner and Manager agree as follows: ARTICLE 1 DEFINITIONS 1.1. Definitions. For purposes of this Agreement, the following terms have the meanings referred to in this Section: Affiliate: A person or company that directly or indirectly, through one or more intermediaries, controls or is controlled by, or is under common control with, a specified person or company. Agreement: The "Agreement" shall mean this Management Agreement, together with all exhibits attached hereto (each of which are incorporated herein as an integral part of this Agreement), as amended, supplemented or restated from time to time. Annual Business Plan or Business Plan: shall have the meaning given to such term in Section 2 of Exhibit “A.” Capital Expenditures: All expenditures for building additions, alterations, repairs or improvements and for purchases of additional or replacement furniture, machinery, or equipment, where the cost of such expenditure is greater than Ten Thousand Dollars ($10,000) and the depreciable life of the applicable item is, according to generally accepted accounting principles, in excess of five (5) years. Commencement Date: May 1, 2028. 575 3 Commercial Rights: Naming rights, pouring rights, advertising, sponsorships, the branding of food and beverage products for resale and memorial gifts at or with respect to the Facilities. Early Termination Fee: The term "Early Termination Fee" shall have the meaning ascribed to such term in Section 4.3(a) of this Agreement. Effective Date: "Effective Date" shall have the meaning ascribed to such term in the preamble of this Agreement. Emergency Repair: The repair of a condition which, if not performed immediately, creates an imminent danger to persons or property and/or an unsafe condition at the Facility threatening persons or property. Event of Force Majeure: An act of God, fire, earthquake, hurricane, flood, riot, civil commotion, terrorist act, terrorist threat, storm, washout, wind, lightning, landslide, explosion, epidemic, inability to obtain materials or supplies, accident to machinery or equipment, any law, ordinance, rule, regulation, or order of any public or military authority stemming from the existence of economic or energy controls, hostilities or war, a labor dispute which results in a strike or work stoppage affecting the Facility or services described in this Agreement, or any other cause or occurrence outside the reasonable control of the party claiming an inability to perform and which by the exercise of due diligence could not be reasonably prevented or overcome. Existing Contracts: Service Contracts, Revenue Generating Contracts, and other agreements relating to the day-to-day operation of the Facilities existing as of the Commencement Date. Facility: The "Facility" shall have the meaning ascribed to such term in the Recitals to this Agreement. FF&E: Furniture, fixtures and equipment to be procured for use at the Facilities. General Manager: The employee of Manager acting as the full-time on-site general manager of the Facilities. Laws: Means all applicable laws, statutes, rules, regulations and ordinances. Management-Level Employees: The General Manager, Marketing Manager, Operations Manager, Membership Manager, Finance Manager, and Sports Programming Manager. Manager: The term "Manager" shall have the meaning ascribed to such term in the Recitals to this Agreement. Operating Budget: A line-item budget for the Facility that includes a projection of Revenues and Operating Expenses, presented on a monthly and annual basis. Operating Expenses: All expenses incurred by Manager in connection with its operation, promotion, maintenance and management of the Facilities, including but not limited to the following: (i) employee payroll, bonuses and benefits (including payments to any national benefit system, relocation costs, termination costs (including severance costs and payments in lieu of termination), and related costs, (ii) cost of operating supplies, including general office supplies, (iii) advertising, marketing, 576 4 group sales, and public relations costs, (iv) cleaning expenses, (v) data processing costs, (vi) dues, subscriptions and membership costs, (vii) the Fixed Management Fee, (viii) printing and stationary costs, (ix) postage and freight costs, (x) equipment rental costs, (xi) minor repairs, maintenance, and equipment servicing, not including expenses relating to performing capital improvements or repairs, (xii) security expenses, (xiii) telephone and communication charges, (xiv) travel and entertainment expenses of Manager employees, (xv) cost of employee uniforms and identification, (xvi) exterminator and trash removal costs, if applicable (xvii) computer, software, hardware and training costs, (xviii) parking expenses, (xix) utility expenses, (xx) office expenses, (xxi) audit and accounting fees, (xxii) subject to the authorization and approval of the Owner in advance on the use of outside legal counsel, reasonable legal fees arising from Manager’s day-to-day operation of the Facility, but such fees shall not include under any circumstances any fees incurred by Manager in relation to: (1) a dispute, including litigation, between the Owner and Manager, or (2) fees arising from a dispute, including litigation, between Manager and any third party claimant, except that expenses relating to a claim by a third party claimant shall be an Operating Expense provided that the claim is not: (1) covered by insurance Manager is required to maintain hereunder, and (2) Manager’s intentional act or gross negligence caused such claim,, (xxiii) all bond and insurance costs, including but not limited to personal property, general liability, professional liability and worker's compensation insurance, (xxiv) commissions and all other fees payable to third parties (e.g. commissions relating to food, beverage and merchandise concessions services and commercial rights sales), (xxv) cost of complying with any Laws, (xxvi) costs incurred by Manager to settle or defend any claims asserted against Manager arising out of its operations at the Facilities on behalf of Owner, provided the claim is not: (1) covered by insurance Manager is required to maintain hereunder, and (2) Manager’s intentional act or gross negligence caused such claim; (xxvii) loss, costs, damage, liability and any other obligations arising under or incurred under Service Contracts and other agreements relating to Facility operations, and (xxviii) Taxes. The term "Operating Expenses" does not include debt service on the Facility, Capital Expenditures or any Incentive Fees (all of which shall be the responsibility of the Owner). Operating Year: Each twelve (12) month period during the Term, commencing on January 1 and ending on December 31, provided that the first Operating Year shall be a shortened year commencing on the Commencement Date and ending on December 31st of that year and the last Operating Year shall be a shortened year, ending upon the expiration of this Agreement. Operations Manual: The document has been developed by Manager, which shall contain terms regarding the management and operation of the Facility including detailed policies and procedures to be implemented in operating the Facility, as agreed upon by both the Owner and the Manager. Owner: The term "Owner" shall have the meaning ascribed to such term in the Recitals to this Agreement. Payroll Account: A separate account in the name of Manager at a licensed bank through which all Facility staff and other personnel employed by Manager (including related payroll taxes), or engaged by Manager as an independent contractor, are paid. Pre-Opening: Time period from the Effective Date to May 1, 2028 . Recruitment Fee: The term "Recruitment Fee" shall have the meaning ascribed to such term in Section 6.4 of this Agreement. Regulatory Approvals: All applicable governmental or regulatory approvals, authorizations, consents, licenses or permits. 577 5 Revenue: All revenues generated by Manager's operation of the Facility, including but not limited to event ticket proceeds income, rental and license fee income, merchandise income, gross food and beverage income, gross income from any sale of Commercial Rights, gross service income, equipment rental fees, box office income, and miscellaneous operating income, but shall not include event ticket proceeds held by Manager in trust for a third party and paid to such third party. Revenue Generating Contracts: Vendor, concessions and merchandising agreements, user/rental agreements, booking commitments, licenses, and all other contracts or agreements generating revenue for the Facility and entered into in the ordinary course of operating the Facility. Service Contracts: Agreements for services to be provided in connection with the operation of the Facility, including without limitation agreements for consulting services, ticketing, web development and maintenance, computer support services, FF&E purchasing services, engineering services, electricity, steam, gas, fuel, general maintenance, HVAC maintenance, telephone, staffing personnel including guards, ushers and ticket-takers, extermination, elevators, stage equipment, fire control panel and other safety equipment, snow removal and other services which are deemed by Manager to be either necessary or useful in operating the Facility. Taxes: Any and all governmental assessments, franchise fees, excises, license and permit fees, levies, charges and taxes, of every kind and nature whatsoever, which at any time during the Term may be assessed, levied, or imposed on, or become due and payable out of or in respect of, (i) activities conducted on behalf of the Owner at the Facility, including without limitation the sale of concessions, the sale of tickets, and the performance of events (such as any applicable sales and/or admissions taxes, use taxes, excise taxes, occupancy taxes, employment taxes, and withholding taxes), or (ii) any payments received from any holders of a leasehold interest or license in or to the Facility, from any guests, or from any others using or occupying all or any part of the Facility. Term: The term "Term" shall have the meaning ascribed to such term in Section 4.1 of this Agreement. ARTICLE 2 SCOPE OF SERVICES 2.1 Engagement. (a) Owner hereby engages Manager during the Term to act as the sole and exclusive manager and operator of the Facility, including, but not limited to, day-to-day operation, management, administration operation, use, scheduling, advertising, marketing, promotion, licensing, provision of concessions, maintenance, upkeep and minor ordinary repairs of the Facility, subject to and as more fully described in this Agreement, and, in connection therewith, to perform the services described herein and in Exhibits A and B attached hereto. Notwithstanding the above, manager shall have no right or authority, express or implied, to commit or otherwise obligate Owners, Owner’s funds, or to encumber the Facility in any manner whatsoever except to the extent specifically provided herein. (b) Manager hereby accepts such engagement, and shall perform the services described herein, subject to the limitations expressly set forth in this Agreement. 578 6 2.2 Limitations on Manager's Duties. Manager's obligations under this Agreement are contingent upon and subject to the Owner making available, in a timely fashion, the funds budgeted for and/or reasonably required by Manager to carry out such obligations during the Term. Manager shall not be considered to be in breach or default of this Agreement and shall have no liability to the Owner or any other party, in the event Manager does not perform any of its obligations hereunder due to failure by the Owner to timely provide such funds. 2.3 Manager’s Standard of Care. Manager acknowledges and agrees that by entering into this Agreement it accepts a fiduciary relationship of trust and confidence between Manager and Owner. In performing its obligations and providing the services set forth in this Agreement, Manager shall exercise a standard of care, skill, diligence, knowledge, judgment and quality of services so as to operate and maintain the Facility, commensurate with and at a standard consistent with comparable facilities, and meeting the Minimum Operation and Maintenance Standards to be developed by Manager and approved by the Owner prior to Commencement. 2.4 Specific Manager Responsibilities. Without limiting the generality of Section 2.1 above, and subject to all other provisions of this Agreement, Manager, itself or through its designated contractors or vendors, will perform the following services, and such other aspects of the operations of the Facility as may be agreed to by the parties: 2.4.1 Day-to-Day Operations. Manager shall manage and supervise all day-to-day operations of the Facility in accordance with the terms and conditions of this Agreement and the Annual Business Plan. 2.4.2 Staffing. Manager shall employ personnel and engage contractors necessary and sufficient to perform Manager's obligations under this Agreement in accordance with the terms of this Agreement and the Annual Business Plan. 2.4.3 City Policies and Park Rules. Manager shall implement Owner policies and city park rules, currently existing or as may be amended or adopted in the future by Owner, affecting the Facility and/or Manager’s management of the Facility, as determined by Owner. 2.4.4 Internal Policies and Procedures. Manager shall implement such additional internal policies and procedures necessary for the operation of the Facility, that are not in conflict with any terms of this Agreement, applicable laws, or any written Owner policies or city park rules currently existing or as may be adopted or amended by Owner during the Term. 2.4.5 Utilities. Arrange for Owner the provision of all utility services for the Facility, including electricity, water, sewer, solid waste, telephone (cell and land lines) and internet services. 2.4.6 Permits and Licenses. Arrange for and maintain in force for Owner all licenses, permits, certificates, approvals, franchises, and other authorizations required to perform and provide its services to Owner in connection with the operation, use, maintenance and ordinary and routine repair of the Facility in the name of Owner. 579 7 2.4.7 Intentionally Omitted. 2.4.8 Revenues and Expenses. Manager shall diligently collect and submit requests for payment of expenses, when due, to the Owner. 2.4.9 Financial and Administrative Services. Manager shall provide day-to-day financial and administrative services in support of its management activities pursuant to Annual Business Plan, including internal budgeting and accounting, purchasing, property management, personnel management, contracting outside services, record-keeping, collections, billing, and similar services. 2.4.10 Point of Sale System. Manager shall utilize a point-of-sale system that accurately records and tracks all revenue. Revenue information from point-of-sale system used must accommodate daily download and tracking of all revenues. Manager conducts a number of business operations at the Facility, and revenues shall be tracked separately by business operations. 2.4.11 Agreements. With the exception of Commercial Rights agreements, as provided herein, Manager shall administer, assure compliance with, negotiate, all agreements that are required in the ordinary course of business of operating the Facility or as otherwise necessary for Manager to perform the services hereunder. Such agreements may include licenses, rental agreements, booking commitments, advertising agreements, concession agreements, supplier agreements, ticket sales contracts, and all other Service Contracts and agreements in connection with the maintenance, improvements, management, promotion and operation of the Facility. The terms and provisions of all such agreements shall comply with this Agreement. 2.4.12 Information. Manager shall keep Owner fully informed at all times with respect to conditions and circumstances affecting the operation of the Facility; including prevailing market and sales conditions and the status of competition. 2.4.13 Building and Equipment Maintenance. Manager shall be responsible for arranging for an managing ordinary and routine corrective and preventative building and equipment maintenance and repair, as a Facility Operating Expense and for arranging and negotiating for (as part of the Operating Expenses) all supplies, parts, and equipment necessary to operate and maintain the Facility, for all buildings, structures, fixtures, and City owned equipment, which may now or hereafter exist on or in the Facility subject to city purchasing requirements and the terms of this Agreement. 2.4.14 Warranty Administration. Manager shall manage building and equipment warranties and monitor contractors compliance with terms and delivery of warranty services. Notwithstanding anything to the contrary set forth herein, Manager shall not take any action (or fail to take any action) that would have the effect of voiding or otherwise abrogating any warranty impacting any improvements, equipment, or component, without the prior express approval of Owner. Manager shall maintain a list and copies of all warranties, maintenance, and operating manuals for goods, equipment, and machinery purchased or installed by Manager or Owner as well as warranties delivered to Manager by Owner or Owner's contractor(s) and/or consultant(s) and shall use and enforce such warranties when maintaining, repairing, and/or replacing any such items. Further, Manager shall provide to the City Manager, and endeavor to subsequently keep up to date with the City Manager, a list and copies of all 580 8 warranties, maintenance, and operating manuals for goods, equipment, and machinery purchased or installed by Manager or Owner as well as warranties delivered to Manager by Owner or Owner's contractor(s) and/or consultant(s). Manager shall notify Owner in writing in the event any warranty is accessed to maintain, repair, or replace any item. Unless otherwise approved by Owner, the annual business budget shall not reflect the maintenance, repair, or replacement cost of goods, equipment, or machinery covered under a warranty and Manager is not authorized to separately contract for services, maintenance, or repairs that are covered by a warranty. 2.4.15 Custodial and Cleaning Services. Manager shall arrange for all routine cleaning and janitorial services at the Facility. 2.4.16 Pest Control. Manager shall arrange for all necessary pest control services as a Facility Operating Expense. 2.4.17 Sanitation. Manager shall keep the Facility in a clean and sightly condition; free from accumulation of refuse or any offensive matter or substance constituting an unnecessary, unreasonable, or unlawful fire hazard, or any material detrimental to the public or environmental health. 2.4.18 Trash Removal. Manager shall direct removal of all trash from the Facility and agrees that it shall not permit any employee, service provider, or concessionaire to place refuse outside any Facility building, except in designated trash containers, approved by Owner. Manager shall maintain an adequate number of Owner approved trash receptacles on the Facility and shall empty the containers daily. 2.4.19 Grounds. Manager shall maintain the landscaping of the Facility in accordance with the Maintenance and Operations Standards mutually agreed upon by Owner and Manager. 2.4.20 Sidewalks. Manager shall maintain all sidewalks and pedestrian ramps within the boundaries of the Facility in a clean and safe condition. Manager shall direct the repair of any damaged or defective sidewalks or ramps. 2.4.22 Safety. Manager shall immediately bring to Owner’s attention any unsafe conditions at the Facility it discovers, or notify the City Manager of any potentially unsafe conditions, as well as any potentially unsafe practices occurring thereon. Manager shall contact an emergency medical response provider as soon as reasonably possible after becoming aware of any person on or at the Facility who is in need of medical attention because of illness or injury. 2.4.23 Incident Reports. Manager shall notify Owner as soon as practical of any threatened claim relating to the ownership, operation, and/or maintenance of the Facility for damages arising 9 out of incidents, accidents, property damage, or destruction occurring at the Facility, and shall submit within twenty-four hours to the City Manager an incident report describing any of Manager’s knowledge on the alleged incident relating to the threatened claim. 2.4.24 Safety/Environmental Regulations. Manager shall take all reasonable actions to protect the safety of all Manager’s employees, customers, and the general public. Manager shall comply with all safety and environmental regulations of federal, state, and local governmental agencies, and 581 9 applicable federal occupational, health, and safety laws and regulations, as well as the American National Standards Institute Safety Standards. Manager shall make special effort to detect hazardous conditions and shall take prompt action where necessary to avoid accident, injury, or property damage. All spills, accidents, injuries, or claims or potential claims shall be reported promptly to the City Manager and appropriate emergency officials. 2.4.25 Security. Manager shall arrange for proper security at the Facility as a Facility Operating Expense subject to the city’s purchasing policies and the terms of this agreement. 2.4.26 Crowd Control. If necessary, Manager shall review and coordinate exterior crowd management and traffic control with appropriate local authorities. 2.4.27 Emergency Operations. Manager, in coordination with Owner, shall be responsible for maintaining and managing a building emergency action plan that addresses the various type of emergencies that may occur in or around the Facility. 2.4.28 Information Technology Support Services. Manager shall supervise all information technology functions and services for the Facility and onsite Manager employees and staff, and shall maintain, through Owner’s support staff and outside contractors as needed, such technology systems, websites, and social media in a manner consistent with a top tier sports and event center, and with Owner policies for websites and social media, where applicable. 2.4.29 Safeguarding of Information Systems. Manager shall apply basic safeguarding requirements and procedures designed to protect the Facility’ s information systems whenever the information systems store, process or transmit any information, not intended for public release, which is provided by or generated for Owner. This includes following all applicable City of Chanhassen Information Technology Policies and Procedures. This requirement does not include information provided by the Owner to the public or simple transaction or information, such as that necessary to process payments. These requirements and procedures shall include, at a minimum, the security control requirements “ reflective of actions of a prudent business person would employ” which are outlined in the Federal Acquisition Regulations FAR 52.204-21(b) and codified in the Code of Federal Regulations at 48 C.F.R. 52.204-21(b) (2016). 2.4.30 Box Office Operations. Owner shall direct box office operations and ticketing (to the extent not controlled by a promoter, performer, or licensee of an event). 2.4.31 Scheduling Events. Manager shall have the exclusive right to book and schedule 10 Events and shall maintain the booking calendar in accordance this Agreement. Manager and Owner shall identify dates that the Owner would like to reserve the Facility for Owner’s events. Manager shall develop and maintain a schedule of events at the Facility in a manner to maximize the use of the Facility so as to provide maximum Revenue for the Facility and accessibility for the community to the Facility. In an effort to further the Owner’s vision for the Facility as an asset to attract sports participants, spectators, and their families to the Owner and, in turn, to provide a positive economic impact on the Owner, Manager agrees to work collaboratively with the Owner to book tournaments and events that will maximize the economic impact on the City of Chanhassen. Manager also will work with the City Manager to schedule reasonable community usage of the Facility. 582 10 2.4.32 Event Setup. Manager shall be responsible for event set up and take down; event coordination and supervision. 2.4.33 Food and Beverage Operations. Manager shall direct all food and beverage operations at the Facility, including fixed/mobile concession stands, and all other services associated with food and beverage sales at the Facility in accordance with this Agreement. 2.4.34 Non-Consumable Concessions. Manager shall direct all non-consumable concession operations, and negotiate concession license agreements in accordance with this Agreement for final approval by the Owner. 2.4.35 Promotion and Marketing. Manager shall promote and market the Facility in accordance with the requirements of this Agreement and the Annual Business Plan. ARTICLE 3 COMPENSATION 3.1 Management Fees. In consideration of Manager's performance of its services hereunder, Owner shall pay Manager those payments as further set forth in Exhibit B attached hereto. ARTICLE 4 TERM; TERMINATION 4.1 Term. The term of this Agreement (the "Term") shall begin on the Effective Date and, unless sooner terminated pursuant to the provisions of Section 4.2 below, shall expire on the eighth (8th) anniversary of the Commencement Date at which time this Agreement shall automatically renew for up to two additional periods of five (5) years (each a “Renewal Term”) unless either party provides the other party with at least one hundred twenty (120) days’ notice before the expiration of the Term or any Renewal Term. Upon any renewal of this Agreement as provided herein, the Term shall be extended to include any such Renewal Term(s). 4.2 Early Termination. This Agreement may be terminated by Owner or Manager, with or without cause, at any time by providing the other party with written notice on or before the date such terminating party wishes to terminate this Agreement (the "Termination Date"). (a) For Owner’s Convenience: Owner shall have the right to terminate this Agreement for any reason or no reason subject to section 4.3 below. (b) For Manager’s Convenience: Manager shall have the right to terminate this Agreement for any reason or no reason upon six (6) months’ notice to Owner. (c) For Cause by Owner: Owner shall have the right to terminate this Agreement for Cause at any time. Upon termination by Owner for cause, Manager shall promptly vacate the Facility and no Early Termination Fee or other compensation, damages or lost profits related to early termination shall be 583 11 due or payable to Manager. Cause for termination shall include, but not be limited to, Manager’s failure to cure the breach of any material provision in this Agreement within twenty (20) days after receipt of written notice to cure from Owner detailing that breach; except that in the event that a cure is not objectively possible within twenty (20) days after that notice, Owner shall not be entitled to terminate for cause where Manager shall commence to cure the noticed breach as fully as possible within that twenty (20) day period and thereafter diligently and continuously pursue that cure to a successful completion within sixty (60) days after that notice. (d) For Cause by Manager: Manager shall have the right to terminate this Agreement for Cause at any time. Upon termination for cause by Manager shall be contingent upon Manager promptly vacating the Facility and taking nothing of value from Owner without owner’s written permission. Manager expressly waives any possessory lien rights or right of set-off it might have against any of Owner’s property or assets. Cause for termination shall include, but not be limited to, Owner’s (i) repeated failure to timely pay budgeted Owner contributions; (ii) Owner’s failure to cure the breach of any material provision in this Agreement within twenty (20) days after receipt of written notice to cure from Manager detailing that breach; except that in the event that a cure is not objectively possible within twenty (20) days after that notice, Manager shall not be entitled to terminate for cause where Owner shall commence to cure the noticed breach as fully as possible within that twenty (20) day period and thereafter diligently and continuously pursue that cure to a successful completion within sixty (60) days after that notice. (e) Lack of Project: At any time during the term of this Agreement, if it is publicly determined and announced that the project will not be constructed, Owner may terminate this Agreement with 30 days written notice to Manager. 4.3 Effect of Early Termination. (a) Upon termination by the Owner for any reason other than for "cause" due to Manager's breach of any material provision herein, without cure by Manager following written notice from Owner detailing such breach of this Agreement, Owner shall pay to Manager a termination fee (the "Early Termination Fee") on the Termination Date that is equal to (a) the greater of: (i) the trailing six (6) months' fees due to Manager hereunder or (ii) six (6) times the average monthly payment due to Manager during the Term; plus (b) any incentive payments that the Manager has earned through the Termination Date.. In the event that Owner terminates this Agreement, Owner shall have the right to request that Manager vacate the property and cease all management activities related to the Facility, in which case Owner shall pay Manager the Termination Fee as set forth above. (b) Upon termination or expiration of this Agreement for any reason, (i) Manager shall promptly discontinue the performance of all services hereunder, (ii) the Owner shall promptly pay Manager all fees due Manager up to the date of termination or expiration (subject to proration if the Term ends other than at the end of the Operating Year), (iii) Manager shall make available to the Owner all data, electronic files, documents, procedures, reports, estimates, summaries, and other such information and materials with respect to the Facilities as may have been accumulated by Manager in performing its obligations hereunder, whether completed or in process, and (iv) without any further action on part of Manager or Owner, the Owner shall, or shall cause the successor Facility manager to, assume all obligations arising after the date of such termination or expiration, under any Service Contracts, Revenue Generating Contracts, booking commitments and any other Facility agreements entered into by Manager in furtherance of its duties hereunder. Notwithstanding the foregoing, Manager is under no duty to provide certain proprietary 584 12 confidential materials or intellectual property to the Owner, including but not limited to national benchmarking formulas, key performance indicators reports, employee manuals, employee training materials, employee performance evaluations, financial forecasting formulas, Manager's internal databases or contact lists, Manager's operations manuals, and/or other intellectual property developed by and maintained by the Manager and which it may use in its regular course of business to provide services to clients similar to Owner, except as otherwise provided by law, including the Minnesota Data Practices Act as further identified under Section 13.7. Any obligations of the parties that are specifically intended to survive expiration or termination of this Agreement shall survive expiration or termination hereof. ARTICLE 5 OWNERSHIP; USE OF THE FACILITY 5.1 Ownership of Facility, Data, Equipment and Materials. The Owner will at all times retain ownership of the Facilities, including but not limited to real estate, technical equipment, furniture, displays, fixtures and similar property, including improvements made during the Term, at the Facility. Any data, equipment or materials furnished by Owner to Manager or acquired by Manager as an Operating Expense shall remain the property of Owner and shall be returned to Owner when no longer needed by Manager to perform under this Agreement. Notwithstanding the above, Owner shall not have the right to use any third- party software licensed by Manager for general use by Manager at the Facility and other facilities managed by Manager, the licensing fee for which is proportionately allocated and charged to the Facility as an Operating Expense; such software may be retained by Manager upon expiration or termination hereof. Furthermore, Owner recognizes that the Operations Manual to be developed and used by Manager hereunder is an instrument of service paid for by the Owner and shall belong to the Owner at the end of the Term. 5.2 Right of Use by Manager. The Owner hereby gives Manager the right and license to use the Facility for the Term, and Manager accepts such right of use, for the purpose of performing the services herein specified, including the operation and maintenance of all physical and mechanical facilities necessary for, and related to, the operation, maintenance and management of the Facility. The Owner shall provide Manager with a sufficient amount of suitable office space in the Facility (exact office space to be mutually agreed by the parties) and with such office equipment as is reasonably necessary to enable Manager to perform its obligations under this Agreement. In addition, the Owner shall make available to Manager, at no cost, parking spaces adjacent to the Facility for all of Manager's full-time employees and for the Facility’s event staff. 5.3 Right of Use of Staff by Manager. Manager shall have the right to utilize its employees as needed to support manager’s organization as a whole, including but not limited to reasonable travel for training for training approved by the Owner and temporary staffing coverage. Manager shall have the right to utilize the Facility to host events for its employees from time to time for the purpose of learning and development, at no cost to the Operating Budget other than that incurred by the staff who are regularly stationed at the Facility. 5.4 Observance of Agreements. The Owner agrees to pay, keep, observe and perform all payments, terms, covenants, conditions and obligations under any leases, bonds, debentures, loans and other financing and security agreements to which the Owner is bound in connection with its ownership of the Facility. 585 13 5.5 Owner's Right of Possession. This Agreement does not constitute a lease, and the right of possession of the Facility shall at all times remain with Owner. Owner and its authorized personnel shall have the right to enter the Facility at any time, without notice and for any official purpose; however, Owner will use reasonable efforts to avoid interfering with Manager’s performance of its obligations under this Agreement, whenever Owner personnel are at the Facility. Manager shall have no property interest in or to the Facility and no estate in or to the Facility, other than the limited license set forth above. 5.6 Rules and Regulations. Owner reserves the right from time to time during the Term of this Agreement, to promulgate such reasonable rules and regulations concerning the use of the Facility, and any part or parts thereof, as Owner in its sole discretion, shall deem appropriate. Nothing contained in this Agreement shall be deemed or construed to stop, limit, or impair Owner from exercising or performing any regulatory, policing, legislative, governmental or other powers or functions of a Minnesota municipality. ARTICLE 6 PERSONNEL 6.1 Generally. All Facility staff and other personnel shall be engaged or hired by Manager in its sole discretion. Owner shall have the right to preapprove the employment of Management-Level Employees, and Management-Level Employees shall be employees, agents or independent contractors of Manager, and not of the Owner. Manager shall select employees, in its sole discretion but subject to Owner's right to approve the Operating Budget. The Operating Budget shall define the number, function, qualifications, and compensation, including salary and benefits, of its employees and shall control the terms and conditions of employment (including without limitation termination thereof) relating to such employees. Manager agrees to use reasonable and prudent judgment in the selection and supervision of such personnel. Owner specifically agrees that Manager shall be entitled to pay its employees, as an Operating Expense, bonuses and benefits, as approved by Owner, in accordance with Manager's then current employee manual, which may be modified by Manager from time to time in its sole discretion. 6.2 General Manager and Management-Level Employees. Personnel engaged by Manager will include a full-time on-site General Manager and other Management-Level Employees. Hiring of the General Manager by Manager require the prior approval of the Owner, which approval shall not be unreasonably withheld or delayed; provided, however, in the event of a vacancy in the General Manager position, Manager may, upon notice to the Owner, temporarily fill such position with an interim General Manager for up to one hundred eighty (180) days without the necessity of obtaining the Owner's approval. The General Manager will have general supervisory responsibility for Manager and will be responsible for day-to-day operations of the Facility, supervision of employees, and management and coordination of all activities associated with events taking place at the Facility. 6.3 Work Environment. Employees will be required to work to the standards outlined in the most current version of Manager’s employee handbook. Owner shall not require employees of Manager to vary from those employment standards either directly, or indirectly through impacting decisions, including but not limited to not funding the correct staffing level, not providing safe work tools and a safe work environment, or an environment inconsistent with Manager’s values. 6.4 Post-Termination Employment. In the event of termination, or in any case where Owner, and/or its affiliated agencies or entities, expresses an interest in hiring Manager’s employee(s), Manager shall reserve the right to agree or deny such a request. In the event that Manager elects to permit Owner to hire 586 14 Manager's employee(s), Owner shall provide the Manager with a one-time fee (the "Recruitment Fee") equal to six (6) months' gross salary and benefits. In any of these events described, the Manager's employee would not retain the Manager's intellectual material in any future employment. Recruitment Fee will not apply to employees who were previously employed by the Owner or who are employed in other areas by Owner (i.e. different departments within the City). 6.5 Nondiscrimination. Manager shall comply with all applicable provisions of all federal, state and municipal laws which prohibit discrimination in employment to members of a protected class and all rules and regulations, promulgated and adopted pursuant thereto. 6.6 Background and Drug Screening (Harassment Policy). Manager shall be committed to promoting a drugfree workplace. To this end, all employees on site must pass a drug screen and criminal and sexual predator background screening similar to that required of Owner employees. Manager shall have in place policies that prohibit any form of harassment in the workplace. 6.7 Employee Identification and Uniform. Manager’s employees and other onsite personnel shall wear a uniform, or in some way be recognizable as staff at all times while working at the Facility. The logo, seal, or name of the Owner shall not be used without written permission of the Owner. 6.8 Contact Information for Key Employees. At all times, Manager shall provide the City Manager with the names and current telephone numbers (business, cell phone, and home number, if applicable) of all Management-Level Employees, including minimally, the General Manager, who can be called by the City Manager or his/her representatives at any time that a critical situation occurs during hours when Manager's normal work force is not present. Such employee will have full power and authority to take all actions on behalf of Manager required to address the emergency or said critical situation, including making an Emergency Repair. ARTICLE 7 PROCEDURE FOR HANDLING INCOME 7.1 Revenue. Except as otherwise agreed to by the parties in writing all Revenue derived from operation of the Facility shall be deposited by Manager with the City as soon as practicable upon receipt (but not less often than once each business day). The specific procedures (and authorized individuals) for making deposits to with the City shall be set forth in the Operations Manual. 7.2 Right to Audit. The Owner shall have the right to audit, upon reasonable notice and at the Owner’s own expense, records of the Manager with respect to this Agreement. Upon written request by the Owner, the Manager shall give the Owner or its agent, access to those certain records controlled by, or in the direct or indirect possession of, the Manager (other than records subject to legitimate claims of attorney-client privilege) with respect to this Agreement, and shall permit the Owner to review such records in connection with conducting a reasonable audit of other financial records of the Manager for the Facility. The Manager shall make these records available to the Owner electronically or at a location that is reasonably convenient for the Owner. The Owner and the Manager shall reasonably cooperate with the auditors (internal or external), and shall retain and maintain all such records for at least six (6) years from the date of termination of this Agreement. All audits must be diligently conducted and once begun, no records pertaining to such audit shall be destroyed. ARTICLE 8 FUNDING 587 15 8.1 Source of Funding. The designated City employee shall submit to the Owner for payment of all items of expense for the operation, maintenance, supervision and management of the Facility from City funds,. 8.2 Advancement of Funds. Under no circumstances shall Manager be required to pay for or advance any of its own funds to pay for any Operating Expenses. ARTICLE 9 FACILITY CONTRACTS; TRANSACTIONS WITH AFFILIATES 9.1 Existing Contracts. The Owner shall provide to Manager, on or before the Effective Date, full and complete copies of all Existing Contracts. Manager shall administer and use reasonable commercial efforts to assure compliance with such Existing Contracts to the extent provided to Manager. 9.2 Execution of Contracts. Owner shall provide an on-site employee of Owner who shall have the authority to enter into Service Contracts, Revenue Generating Contracts and other contracts related to the operation of the Facility on behalf of the Owner. This employee of Owner shall have the right to enter into Service Contracts and other contracts for the purchase of services or goods up to Ten Thousand Dollars ($10,000). Manager shall need approval from the City Manager for contracts above that amount and up to Nineteen Thousand Nine Hundred Ninety-Nine Dollars ($19,999). Any such contract of Twenty Thousand Dollars ($20,000) or more shall require approval of City Council and be executed by Owner, subject to any amendments to the City’s purchasing policies. All Revenue Generating Contracts shall use an Owner approved template. Any such material agreements shall contain standard indemnification and insurance obligations on the part of each vendor, licensee or service provider, as is customary for the type of services or obligations being provided or performed by such parties. 9.3 Transactions with Affiliates. In connection with its obligations hereunder relating to the procurement of services for the Facility (including without limitation food and beverage services, ticketing services and Commercial Rights sales), Manager may negotiate such services, with, an Affiliate of Manager, provided that the prices charged and services rendered by such Affiliate are competitive with those obtainable from any unrelated parties rendering comparable services. Manager shall, if requested by Owner, provide reasonable evidence establishing the competitive nature of such prices and services, including if appropriate, competitive bids from other persons seeking to render such services at the Facility, in accordance with the Owner’s purchasing policies. 9.4 Compliance with Laws/Procurement Policies. Manager shall at all times comply with the Owner’s procurement policy and procedures, as may be amended during the Term, and all applicable laws regarding the procurement of goods and services in conjunction with the operation of the Facility. 9.5 Commercial Rights Agreements. Notwithstanding anything in this Agreement to the contrary, Owner shall approve any agreements concerning Commercial Rights. The Owner may set forth acceptable guidelines for such agreements in the Annual Business Plan, City policy, or similar document. Manager understands and agrees that to maintain flexibility for hosting events and maximize revenue, it is the City’s desire that the Facility be a family-oriented facility. 588 16 ARTICLE 10 AGREEMENT MONITORING AND GENERAL MANAGER 10.1 Contract Administrator. Each party shall appoint a contract administrator who shall monitor such party 's compliance with the terms of this Agreement. Manager's contract administrator shall be its General Manager at the Facility, unless Manager notifies Owner of a substitute contract administrator in writing. Owner shall notify Manager of the name of its contract administrator within thirty (30) days of execution hereof. Any and all references in this Agreement requiring Manager or Owner participation or approval shall mean the participation or approval of such party 's contract administrator. ARTICLE 11 INSURANCE 11.1 Owner’s Types of Coverage and Policies. Owner is Minnesota statutory city and will keep and maintain insurance coverage in accordance with the laws of Minnesota. 11.2 Manager’s Types of Coverage; Certificates of Insurance. Manager agrees to obtain insurance coverage as provided under Section 11.3. Manager shall within 30 days after the Effective Date furnish to the Owner certificates of all of the insurance as well as certificates of renewal no later than ten (10) days prior to the expiration of each policy. Such insurance policies (as reflected by current certificates) held by Manager shall provide that “City of Chanhassen” is listed as Additional Insured on the Manager’s policy by endorsement. Manager will provide reasonable notice to Owner upon receipt of any intention by Insurer to cancel, not renew or make any adverse change in coverage. All certificates, cancellation, nonrenewal or adverse change notices shall be mailed to the respective addresses listed in the definition of Additional Insured, or at such other address as an Additional Insured shall give Manager written notice. New Certificates of Insurance are to be provided to the Additional Insureds at least 15 days after coverage renewals. If requested by the Owner, Manager shall furnish complete copies of insurance policies, forms and endorsements. Manager’s insurance coverage shall be provided by companies admitted to do business in Minnesota and rated A-:VI or better by AM Best Insurance Rating. Manager may maintain reasonable and customary deductibles, subject to approval by Owner. 11.3 Manager's Policies. Manager shall be responsible for obtaining and administering insurance in connection with the Facility as follows: (a) General Liability. Manager shall procure and maintain as a Facility Operating Expense a general liability policy (including contractual liability insurance, including an umbrella policy, and including hired, non-owned auto coverage, and abuse and molestation coverage) which insures Manager and which includes Owner as an additional named insured, with a general liability policy (including contractual liability insurance) with a combined single limit of $1,000,000 per occurrence and a general annual aggregate limit of $5,000,000. All such insurance shall be on an occurrence basis. (b) Professional Liability. Manager shall procure and maintain, as a Facility Operating Expense, a professional liability policy. 589 17 (c) Workers Compensation. Manager shall procure and maintain as a Facility Operating Expense worker’s compensation insurance required under applicable Minnesota state law. (d) Liquor Liability. If liquor (including beer or wine) is served/sold at the Facility during the Term of this Agreement or any extension, Manager shall maintain liquor liability coverage with limits of liability as required pursuant to Minnesota Statutes Section 340A.409. Owner shall be listed as an additional insured for bodily injury and property damage arising from the acts or omissions of Manager or its employees, representatives, agents, or subcontractors in the performance of this Agreement. (e) Crime. During the Term of this Agreement or any extension, Manager shall maintain Third- Party Crime Insurance, providing at least the following coverage in at least the amounts set forth below for each coverage: (a) Employee Dishonesty - $500,000; (b) Depositor's Forgery - $500,000; (c) Money & Securities - $500,000 (each, " Inside" and "Outside"); (d) Computer Theft - $500,000; (e) Wire Transfer Fraud 18 - $500,000; and (f) Money orders and counterfeit currency - $500,000; provided, however, that if such coverage are provided on a " blanket" limit basis, a blanket limit of $500,000 shall be considered to be sufficient to comply with this provision.. ARTICLE 12 COVENANTS AND REPRESENTATIONS 12.1 Owner's Covenants and Representations. Owner makes the following covenants and representations to Manager, which covenants, and representations shall, unless otherwise stated herein, survive the execution and delivery of this Agreement: (a) Owner's Status. Owner is a municipality duly organized, validly existing, and in good standing under the laws of the State of Minnesota with full power and authority to enter into this Agreement and execute all documents required hereunder. (b) Authorization. The making, execution, delivery, and performance of this Agreement by Owner has been duly authorized and approved by requisite action and this Agreement has been duly executed and delivered by Owner and constitutes a valid and binding obligation of Owner, enforceable in accordance with its terms and applicable laws. (c) Effect of Agreement. To Owner's best knowledge, without duty of inquiry, neither the execution and delivery of this Agreement by Owner nor Owner's performance of any obligation hereunder: (i) will constitute a violation of any law, ruling, regulation, or order to which Owner is subject; or (ii) shall constitute a default of any term or provision or shall cause an acceleration of the performance required under any other agreement or document (A) to which Owner is a party or is otherwise bound, or (B) to which the Facility or any part thereof is subject. (d) Ownership Rights. Owner shall obtain and retain the property interests in the Facility necessary to enable Manager to perform its duties pursuant to this Agreement peaceably and quietly. Owner represents and warrants that Manager's performance of the services required by this Agreement shall not violate the property rights or interests of any other Person. (e) Documentation. If necessary to carry out the intent of this Agreement, Owner agrees to execute and provide to Manager, on or after the Effective Date, any and all other instruments, 590 18 documents, conveyances, assignments, and agreements which Manager may reasonably request in connection with the operation of the Facility. 12.2 Manager's Covenants and Representations. Manager makes the following covenants and representations to Owner, which covenants, and representations shall, unless otherwise stated herein, survive the execution and delivery of this Agreement: (a) Corporate Status. Manager is a limited liability company duly organized, validly existing, and in good standing under the laws of the State of Florida and authorized to transact business throughout the United States with full corporate power to enter into this Agreement and execute all documents required hereunder. (b) Authorization. The making, execution, delivery, and performance of this Agreement by Manager has been duly authorized and approved by all requisite action of the board of directors of Manager, and this Agreement has been duly executed and delivered by Manager and constitutes a valid and binding obligation of Manager, enforceable in accordance with its terms and applicable laws. (c) Effect of Agreement. To Manager's best knowledge, without duty of inquiry, neither the execution and delivery of this Agreement by Manager nor Manager's performance of any obligation hereunder (i) will constitute a violation of any law, ruling, regulation, or order to which Manager is subject; or (ii) shall constitute a default of any term or provision or shall cause an acceleration of the performance required under any other agreement or document to which Manager is a party or is otherwise bound. 12.3 Indemnification. (a) Indemnification by Manager. Manager agrees to defend, indemnify and hold harmless the Owner and its officials, directors, officers, employees, agents, successors and assigns against any claims, causes of action, costs, expenses (including reasonable attorneys' fees) liabilities, or damages (collectively, "Losses") suffered by those parties, arising out of or in connection with any (i) grossly negligent act or omission, or willful misconduct, on the part of Manager or any of its employees or agents in the performance of its obligations under this Agreement; or (ii) breach by Manager of any of its representations, covenants or agreements made herein. (b) Indemnification by Owner. To the extent allowed by Minnesota, Owner agrees to defend, indemnify and hold harmless the Manager and its managers, directors, officers, employees, agents, successors and assigns against any claims, causes of action, costs, expenses (including reasonable attorneys' fees) liabilities, or damages (collectively, "Losses") suffered by those parties, arising out of or in connection with any (i) grossly negligent act or omission, or willful misconduct, on the part of Owner or any of its employees or agents in the performance of its obligations under this Agreement; or (ii) breach by Owner of any of its representations, covenants or agreements made herein. The indemnity and defense obligations provided in this Agreement shall not be construed as obligating the Owner to appropriate or budget public funds, nor shall it be construed as obligating the Owner to create a sinking fund to satisfy any obligation hereunder. Notwithstanding the foregoing, the City’s liability is subject to the limits provided under Minn. Stat. Ch. 466. (c) Conditions to Indemnification. With respect to each separate matter brought by any third party against which a party hereto ("Indemnitee") is indemnified by the other party ("Indemnitor") under this Section, the Indemnitor shall be responsible, at its sole cost and expense, for controlling, litigating, 591 19 defending and/or otherwise attempting to resolve any proceeding, claim, or cause of action underlying such matter, except that (a) the Indemnitee may, at its option, participate in such defense or resolution at its expense and through counsel of its choice; (b) the Indemnitee may, at its option, assume control of such defense or resolution if the Indemnitor does not promptly and diligently pursue such defense or resolution, provided that the Indemnitor shall continue to be obligated to indemnify the Indemnitee hereunder in connection therewith; and (c) neither Indemnitor nor Indemnitee shall agree to any settlement without the other party 's prior written consent (which shall not be unreasonably withheld or delayed). In any event, Indemnitor and Indemnitee shall in good faith cooperate with each other and their respective counsel with respect to all such actions or proceedings, at the Indemnitor's sole expense. With respect to each and every matter with respect to which any indemnification may be sought hereunder, upon receiving notice pertaining to such matter, Indemnitee shall promptly (and in no event more than ten (10) days after any third-party litigation is commenced asserting such claim) give reasonably detailed written notice to the Indemnitor of the nature of such matter and the amount demanded or claimed in connection therewith. (d) Survival. The obligations of the parties contained in this Section shall survive the termination or expiration of this Agreement. ARTICLE 13 MISCELLANEOUS 13.1 Relationship. Manager and Owner shall not be construed as joint venturers or general partners of each other, and neither shall have the power to bind or obligate the other party except as set forth in this Agreement. Manager understands and agrees that the relationship to Owner is that of independent contractor, and that it will not represent to anyone that its relationship to Owner is other than that of independent contractor. Nothing herein shall deprive or otherwise affect the right of either party to own, invest in, manage or operate property, or to conduct business activities, which are competitive with the business of the Facility. Manager covenants and agrees that even though it may have a management responsibility for other similar properties, which from “time to time" may be competitive with the Facility, Manager shall always represent the Facility fairly and deal with Owner on an equitable basis. Manager has the right to display its brand and marks in the Facility and on the Facility’s marketing materials in a manner that does not exceed 10% of the overall impression of the Facility’s own brand. Manager has the right to use and store the database and contact information of the customers of the Facility. Manager will provide from time-to-time images and other marketing material that it owns and holds the license to for use by the Facility. Owner agrees not to use those images and that material in any manner outside of the operation of the Facility while Manager is engaged to operate it. Manager has the right to use images and marks from the Facility solely for its own marketing and promotions material in perpetuity. 13.2 Representations. Owner represents and warrants: (i) that Owner has full power and authority to enter this Agreement; (ii) that to the best of Owner's knowledge, the property on which the Facility is located is zoned for the intended use; (iii) that all permits for the operation of the Facility have or will be secured and are or will be current; (iv) that the Facility and its operation do not violate any applicable statues, laws, ordinances, rules, regulations, orders, or the like (including, but not limited to, those pertaining to hazardous or toxic substances); and (v) that to the best of Owner’s knowledge, no unsafe condition exists. 13.3 Assignment. This Agreement shall not be assigned by either party without the express written consent of the non-assigning party. Any such assignment made without proper consent shall be deemed void. 592 20 13.4 Benefits and Obligations. The covenants and agreements herein contained shall inure to the benefit of, and be binding upon the parties hereto and their respective heirs, executors, successors, and assigns. 13.5 Fees for Legal Advice. Subject to the authorization and approval of the Owner in advance on the use of outside legal counsel, Owner shall pay reasonable expenses incurred by Manager in obtaining legal advice regarding compliance with any law affecting the Facility or any activities related to it. 13.6 Fees for Other Professional Services. Subject to the authorization and approval of the Owner in advance, Owner shall pay reasonable expenses incurred by Manager in obtaining financial advice, tax and audit advice, code compliance and engineering advice, regarding compliance with any law affecting the Facility or any activities related to it. 13.7 Minnesota Government Data Practices Act. Manager must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the Owner pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by Manager pursuant to this Agreement. Manager is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Manager receives a request to release data, Manager must immediately notify Owner. Owner will give Manager instructions concerning the release of the data to the requesting party before the data is released. Manager agrees to defend, indemnify, and hold Owner, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Manager’s officers’, agents’, Manager’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 13.8 Copyright. Manager shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and shall hold harmless the Owner from loss or damage resulting therefrom. 13.9 Patented Devices, Materials and Processes. If the Agreement requires, or the Manager desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Manager shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the Owner. If no such agreement is made or filed as noted, the Manager shall indemnify and hold harmless the Owner from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under this Agreement, and shall indemnify and defend the Owner for any costs, liability, expenses and attorney's fees that result from any such infringement. 13.10 Audit Disclosures. Pursuant to Minn. Stat. 16C.05, Subd. 5, the books, records, documents and accounting procedures and practices of the Manager or other parties relevant to this Agreement are subject to examination by the Owner and either the Legislative Auditor or the State Auditor for a period of six years after the effective date of this Agreement. 13.11 Building Compliance. Manager does not assume and is given no responsibility for compliance of the Facility or any equipment therein with the requirements of any building codes or with any 593 21 statute, ordinance, law, or regulation of any governmental body or of any public authority or official thereof having jurisdiction, except to notify Owner promptly, or forward to Owner promptly, any complaints, warnings, notices, or summonses received by Manager relating to such matters. Owner represents that to the best of Owner's knowledge, the Facility and all such equipment contained therein comply with all such requirements, and Owner authorized Manager to disclose the ownership of the Facility to any such officials and agrees to indemnify and hold Manager, its representatives, servants, and employees, harmless of and from all loss, cost, expense, and liability whatsoever which may be imposed by reason of any present or future violation or alleged violation of such laws, ordinances, statues, or regulations. 13.12 Notices. All notices provided for in this Agreement shall be in writing and served by registered or certified mail, return receipt requested, postage prepaid, at the following addresses until such time as written notice of a change of address is given to the other party: If to Owner: City of Chanhassen 7700 Market Boulevard Chanhassen, MN 55317 Attn: City Manager With a copy to: Campbell Knutson, P.A. Grand Oak Office Center I 860 Blue Gentian Road Suite #290 Eagan, MN 55121 Attn: Andrea McDowell Poehler If to Manager: Sports Facilities Management, LLC Attention: Jason Clement, Manager 17755 US Hwy 19N, Suite 300 Clearwater, FL 33764 Email: jclement@sportsfacilities.com with a copy to: Bruce Rector General Counsel Sports Facilities Management, LLC 17755 US Hwy 19N, Suite 300 Clearwater, FL 33764 Email: brector@sportsfacilities.com 13.13 Interest on Unpaid Sums. Any sums due Manager under any provision of this Agreement, and not paid by Owner within forty-five (45) days after such sums have become due, shall bear interest at the rate of one and one-half percent (1.5%) per month. 13.14 Owner Responsible for Payments. Upon termination of or withdrawal from this Agreement, Owner shall assume the obligations of any contract or outstanding bill executed by Manager 594 22 under this Agreement for and on behalf of Owner and responsibility for payment of all unpaid bills, provided that such obligation has been approved by Owner as set forth in Section 6.1. 13.15 Headlines. All headings and subheadings employed within this Agreement and in the accompanying schedules and exhibits are inserted only for convenience and ease of reference and are not to be considered in the construction or interpretation of any provision of this Agreement. 13.16 Force Majeure. Any time periods required for performance by either Party under this Agreement shall be extended by an Event of Force Majeure. 13.17 Entire Agreement. This Agreement, including any specified attachments, constitutes the entire agreement between Owner and Manager with respect to the management and operation of the Facility and supersedes and replaces any and all previous management agreements entered into or/and negotiated between Owner and Manager relating to the Facility covered by this Agreement. No change to this Agreement shall be valid unless made by supplemental written agreement executed and approved by Owner and Manager. Except as otherwise provided herein, any and all amendments, additions, or deletions to this Agreement shall be null and void unless approved by Owner and Manager in writing. Each party to this Agreement hereby acknowledges and agrees that the other party has made no warranties, representations, covenants, or agreements, express or implied, to such party, other than those expressly set forth herein, and that each party, in entering into and executing this Agreement, has relied upon no warranties, representations, covenants, or agreements, express or implied, to such party, other than those expressly set forth herein. 13.18 Rights Cumulative; No Waiver. No right or remedy herein conferred upon or reserved to either of the parties to this Agreement is intended to be exclusive of any other right or remedy, and each and every right and remedy shall be cumulative and in addition to any other right or remedy given under this Agreement or now or hereafter legally existing upon the occurrence of an event of default under this Agreement. The failure of either party to this Agreement to insist at any time upon the strict observance or performance of any of the provisions of this Agreement, or to exercise any right or remedy or be construed as a waiver or relinquishment of such right or remedy with respect to subsequent defaults. Every right and remedy given by this Agreement to the parties may be exercised from "time to time" and as often as may be deemed expedient by those parties. 13.15 Applicable Law. The execution, interpretation, and performance of this Agreement shall in all respects be controlled and governed by the laws of the State of Minnesota. Any civil action or legal proceeding arising out of or relating to this Agreement shall be venued in the state or federal courts with jurisdiction in Carver County, Minnesota.. Each party consents to the sole and proper jurisdiction of such court in any such civil action or legal proceeding and waives any objection to the laying of venue of any such civil action or legal proceeding in such court. 13.16 Acknowledgement. The parties hereto acknowledge that they have been provided with a copy of this Agreement for review prior to signing it, that they have been given the opportunity to review it prior to signing it, that they have been given the opportunity to have this Agreement reviewed by their attorney prior to signing it, and that they understand the purposes and effect of this Agreement. 13.17 Severability. If any provision or provisions of this Agreement shall be held to be invalid or unenforceable, such invalidity or unenforceability shall not affect any other provisions of this Agreement, 595 23 and this Agreement shall be construed and enforced as if such provision or provisions had not been included. 13.18 Intellectual Property. Owner acknowledges that Manager has certain intellectual property, trade secrets and proprietary business techniques ("Intellectual Property ") that it will on behalf of Owner to meet its obligations under this Agreement. Owner acknowledges that it obtains no ownership rights whatsoever in the Intellectual Property and, upon termination of this Agreement, Manager shall retain all rights to the Intellectual Property and remove such Intellectual Property from the Facility and its operations. For purposes of this Agreement, the term Intellectual Property shall include, without limitation, analytical tools and documented procedures for forecasting, performance tracking, operational and marketing systems that are unique to Manager's approach, staff training programs, program curriculum and agendas, rights to certain discounts or programs that Manager has negotiated for Manager-operated facilities, and other intellectual property which Manager has previously introduced to the Facility and of which Manager is an author. 13.19 Tax Exempt; Annual Appropriations. Owner is tax exempt and shall not be subject to or pay for any charges for taxes under the Agreement, except as otherwise required by law. All payments by the Owner under the Agreement, including any provision in the Agreement relating to penalties, overages, interest, collections, or any other additional costs, shall be subject to and conditioned upon the annual appropriation of public funding budgeted for the specific purposes of the Agreement in accordance with the Minnesota law. The Owner shall make a good faith effort to appropriate funds in accordance with Minnesota law; however, in the event funds are not appropriated, the Agreement shall automatically terminate without regard for any renewal or other notice requirements in the Agreement. [SIGNATURE PAGE TO FOLLOW] 596 24 IN WITNESS WHEREOF, the parties have caused this Agreement to be executed as of the day and year first above written. Attest: Print Name: Attest: OWNER: CITY OF CHANHASSEN BY: Its MANAGER: SPORTS FACILITIES MANAGEMENT, LLC, a Florida limited liability company ______________________________ BY: Print Name: Jason Clement Its Manager 597 EXHIBIT A MANAGEMENT SERVICES During the Term, Manager will be responsible for all aspects of oversight for the staffing, marketing, maintenance, event management, sponsorship and advertising sales, and day-to-day operations of the Owner's Facility. 1. Staffing. Manager shall provide a full-time on-site General Manager and other employees as required to meet the operational needs of the Facility, within the budgeted percentage of labor. 2. Annual Business Plan. Manager will produce an Annual Business Plan two months prior to the beginning of any Operating Year in the Term, Manager shall update the Business Plan and submit the revised Business Plan to Owner for its review and approval. Owner shall give its comments and/or approval of the updated Business Plan within sixty (60) days after receiving the Business Plan from the Manager. In the event of disapproval of the Business Plan, the Manager shall use commercially reasonable efforts to operate the facility pursuant to the general terms of this Agreement and the prior Business Plan then in effect, until such time as the revisions to the Business Plan are agreed upon. In the event of disapproval of the Budgets, the Manager shall continue operating the facility pursuant to the Budgets then in effect, subject to increases in Operating Expenses required due to (i) increases in Gross Receipts; or (ii) other matters beyond the control of the Manager, until such time as Owner and the Manager agree upon the appropriate replacement Budgets. However, in the event Owner disapproves of a Business Plan, revised Business Plan/Budget hereunder, and Manager and Owner fail to reach an agreement on a new Business Plan, revised Business Plan or Budget within ninety (90) days of such disapproval, either party may terminate this agreement by providing the other party with written notice sixty (60) days prior to the date such party intends to terminate. Owner and the Manager agree to use good faith efforts to resolve any differences in opinion regarding the Business Plan and any portion thereof so that agreement on the Business Plan can be reached as soon as possible after the date Manager first submits the revised Business Plan for such year to the Owner. 3. Employment Matters. The Manager shall present the then current staffing, the incentive bonus plan for employees, and all salaries and payments to employees through the Payroll Account in the Annual Operations Budget. It is understood by all parties that reductions and additions to various positions may be made at Manager's discretion throughout the year due to business tempo, trends, opportunities, and budget requirements. If a change is recommended that will require expense above the budgeted labor percentage, the change will be submitted for Owner 's review and approval by Owner via reforecast and revised business plan or budget. 4. Independent Accounting Firm. From time to time, as Owner requests, Manager shall hire an independent certified public accounting firm to be paid for out of the Operating Budget of the Facility and to be selected by mutual agreement of Owner and Manager to audit the financial statements required under this Agreement. 5. Accounting Records and Reporting. During the Term, Manager shall maintain professional accounting records. Manager shall provide the financial statements in a format reasonably specified by Owner. INTERNAL CONTROL. The Manager agrees to develop, install, and maintain reasonably appropriate accounting, operating, and administrative controls governing the financial aspects of the Facility, such controls to be consistent with professionally accepted accounting practices 598 PAYROLL BANK ACCOUNTS. The Manager shall establish a payroll account in the Manager’s or its affiliates’ name, at a banking institution or institutions, utilizing the federal tax identification number of Manager or its affiliated entity (the "Payroll Account"). ACCOUNT FUNDING. Subject to the Manager's written notices to Owner as herein, Owner acknowledges that it is solely responsible for all Operating Expenses and capital expenditures required for or on behalf of the Facility provided that such Operating Expenses and capital improvements are made in accordance with the terms of this Agreement. 599 EXHIBIT B MANAGER COMPENSATION During the Term of this Agreement, Manager shall receive compensation from the Owner according to the following: 1. Pre-Opening Monthly Fee; 2. Base Management Fee; 3. Deferred Management Incentive Fee; 4. Sponsorship & Advertising Compensation; 5. Employee Compensation; and 6. Reimbursed Expenses 1. Pre-Opening Fee. Owner will pay to Manager $180,000 for its services during the pre-opening period, from the Effective Date to the Commencement Date. The fee shall be paid to Manager as follows: May 1 2026 - $45,000 October 1 2026 - $45,000 May 1 2027 - $45,000 October 1 - 2027 -$45,000 2. Base Management Fee. Beginning on May 1, 2028 and then continuing on the first day of each month thereafter throughout the remaining Term, Owner shall pay to Manager a monthly Base Management Fee of Twenty-Five Thousand Dollars ($25,000) per month. On the fifth anniversary of the first Base Management Monthly Payment, and on each such anniversary thereafter, the annual base management fee shall increase by five (5%) percent. The foregoing monthly payment shall be pro- rated for any partial month. 2. Deferred Management Incentive Fees. To encourage Manager to grow financial performance responsibly, Owner agrees to pay to Manager a Deferred Management Incentive fee in addition to the Base Management Fee identified above. This Incentive Fee is equal to the amount of One (1%) percent of the Facility’s Revenue. Such calculations shall be made by Manager within thirty (30) days of the ending of each quarter and paid to the Manager within thirty (30) days of such calculation. 3. Sponsorship and Advertising Compensation. Due to the role that Manager will play in organizing the programs, negotiating agreements and pricing, and providing confidence to sponsors and advertisers, Manager will receive thirty percent (30%) of the gross revenue for sponsorship and advertising, including facility naming rights for all sponsorship and advertising sourced, procured, sold and contracted throughout the life of the Manager's service. In the event that Owner sources/introduces sponsor to Manager, Manager will receive fifteen percent (15%) of the gross revenue for sponsorship and advertising. Payments for Sponsorship and Advertising Compensation will be made to Manager within thirty (30) days of the time when a sponsor/advertiser makes payment. Sponsorship and advertising agreements from Twin Cities Orthopedics and Southwest Christian High School are considered part of the capital funding of the Facility and will not be included in the Sponsorship and Advertising 600 Compensation. Additional capital funding partners can be added as an addendum to this Agreement if approved by Owner and Manager. 4. Employee Compensation. Beginning on the Commencement Date, Owner shall pay to Manager in equal monthly installments (“pro-rated for any partial months), the Employment Costs for all employees at the Facility (collectively, the “Employee Compensation”). Manager will compensate all of its employees on a bi- weekly basis and therefore each Employee Compensation payment will become due and payable on the first (1st) day of each successive month. For purposes of this Agreement, the term “Employment Costs” shall mean the total salary and compensation for the Management Employees plus any fringe benefits including health insurance, etc., as well as any annual bonus to be paid. 5. Reimbursed Expenses. Beginning on the Commencement Date, Manager shall be reimbursed with prior written approval by the Owner, for travel and other expenses directly related to the Management Services. All travel reimbursement will be based on receipts to be furnished by Manager to the Owner. Travel expenses may include but are not limited to airfare, rental cars, parking fees, lodging and meals. All fees and reimbursements shall be paid to Manager within thirty (30) calendar days of invoicing. Manager will make a good-faith effort to keep these travel expenses to a minimum. 601 EXHIBIT C FACILITY 602 D D D D D D D D U P P P COCO P P U U U PP U P P P U P P U P U P XXX X X X X XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X X X X X X BIT. TRAIL BIT. TRAIL BIT. TRAIL BIT. TRAIL BIT. TRAIL BIT. TRAIL BIT. TR A I L BIT. TRAIL BIT. TRAIL CONC. PED BIT. TRAIL BIT. TRAIL BIT. TRAI L D D D D D D GRAVEL PILE EDGE OF WATER MARCH, 2025 EDGE OF WATER MARCH, 2025 EDGE OF WATER MARCH, 2025 CONC. PED (TYP.)CONC. PED (TYP.) CONC. PED FENCE: CHAIN LINK FENCE: CHAIN LINK FENCE: BARBED WIRE S S S S S o o o o o o o o o o o o o o o o o o o o o o o 10 FT DRAINAGE AND UTILITY EASEMENT 10 FT DRAINAGE AND UTILITY EASEMENT 25 42 36 30 28 18 19 40 36 22 21 44 28 21 206 102 93 G CT T T CB GB 30 SOUTHEAST PARKING (30 STALLS) NORTH PARKING (117 STALLS) COMMUNITY ROOM 118 COMMUNITY ROOM 119 KITCHEN 112 BO H C I R C . / S T O R . 11 5 ELEV. 116 DANCE STUDIO / MULTI USE 109 DANCE STUDIO / MULTI USE 108 CONCESSIONS 102 ELEV. 105 INDOOR PLAYGROUND 127 FAMILY RR 131 PARTY ROOM 129 PARTY ROOM 128 VESTIBULE 100 LEVEL 1 CIRCULATION 101 ICE VIEWING BOX 121 RINK 1 VIEWING DECK 122 ICE VIEWING BOX 123 RINK 1 VIEWING DECK 124 RINK 2 VIEWING DECK 125 ICE VIEWING BOX 126 FAMILY RR 130 JAN. 113 BOH CONCESSIONS 103 OFFICE 104 RINK 2 077 TECH / AV 140 WELCOME DESK 101A ELECTRICAL 141 Not Enclosed PLAZA 114 STORAGE 106 10 0 A 10 0 B 10 0 C 10 2 103 10 4 106 113 112A 11 5 A 11 5 B 112B 141 140 109 108 126 125B 125A 124B 124A 121 122A 122B 122C 077 123 11 9 B 13 3 A 13 3 B 127A 129A 129B 128B 127B 178A 17 8 B 10 1 130 119B 118B 119A WOMEN'S RR 008 00 7 00 8 MEN'S RR 007 UP TURF 087 COURTS 086 MECH. 029 STORAGE 010 VESTIBULE 031 HALLWAY 025 FITNESS 013 TENANT 012 ELEV. 011 CIRCULATION 052 PARTIAL MAINTENANCE EQUIP. 042 MECH 079 ICE PLANT 082 STORAGE 084 ZAMBONI 083 SKATE RENTAL 009B ELEV. 024 WOM. RR 003 STAIR 078 UP LOCKER 061 LOCKER 060 JV 070 VARSITY 068 LOCKER 059 LOCKER 058 LOCKER 057 LOCKER 056 LOCKER 055 WET 069 VARSITY 067 WET 066 JV 065 PLAYER FLEX 063 LOCKER 054 REF 053 RINK 2 077 PLAYER FLEX 041 JV 039 WET 038 VARSITY 037 WET 035 JV 034 COACH 033 PLAYER FLEX 032 STORAGE 044 STOR 046 LOWER LEVEL CIRCULATION 001 SKATE STORAGE 009C PLAYER FLEX 072 THE HUB 009A TRASH AND RECYCLING 030B JAN. 024C RINK 1 047 SUMP 011B MAIN ELEC. 092 TECH / AV 091 EM E R G E N C Y E L E C . 09 0 ELEC 029A TECH / AV 029B SUMP 024B TECH / AV / ELEC. 009D COACH 040 COACH 064 COACH 043 REF 044 VARSITY 036 HOCKEY EQUIP. 051 STAGE EQUIP. 050 STORAGE 049 BROOMS / MOPS MAINT. 048 STOR. 076 STOR. 074 C.R. 3 018 C.R. 7 022 C.R. 8 023 C.R. 5 020 C.R. 6 021 WOMEN'S 014 MEN'S 015 C.R. 2 017 C.R. 4 019 C.R. 1 016 STORAGE 088 C.R.10 026 CIRCULATION 043 MECH 009E STOR. 009F OFFICE 025E OFFICE 025D OFFICE 025B OFFICE 025A STOR. 025C MEN'S RR 004 C.R. 005 C.R. 006 SENSORY ROOM 007 PROPOSED BUILDING REFER TO ARCHITECTURAL PLANS FOR DIMENSIONS AND LAYOUT NORTHWEST PARKING (208 STALLS) NORTHEAST PARKING (93 STALLS) SOUTH PARKING (21 STALLS) 29 © 2025 BKV Group SHEET NUMBER SHEET TITLE DRAWN BY CHECKED BY COMMISSION NUMBER 2612.03 ISSUE #DATE DESCRIPTION CERTIFICATION 222 North Second Street Long & Kees Bldg Suite 101 Minneapolis, MN 55401 612.339.3752 www.bkvgroup.com G Architecture Interior Design Landscape Architecture Engineering B K V R O U P I hereby certify that this plan, specification, or report was prepared by me or under my direct supervision and that I am a duly Licensed Professional Engineer under the laws of the State of Minnesota. Date _____________ Reg. No.__________ Signed: 59532 _______________________________________________ William J. Diede PROJECT TITLE: CHANHASSEN BLUFFS COMMUNITY CENTER 11/20/2025 3300 FERNBROOK LANE NORTH, SUITE 300 PLYMOUTH, MN 55447 Phone: (763) 544-7129 Email: plymouth@bolton-menk.com www.bolton-menk.com WJD MET 12/18/2025 DD SET FEETSCALE 0 HORZ. 40 80 R C1.01 FINISHING PLAN PROPOSED PARKING COUNTS (469 TOTAL CAR STALLS): NORTHWEST PARKING = 208 STALLS NORTH PARKING = 117 STALLS NORTHEAST PARKING = 93 STALLS SOUTH PARKING = 21 STALLS SOUTHEAST PARKING = 30 STALLS ACCESSIBLE PARKING STALL REQUIREMENTS = 19 STALLS ACCESSIBLE PARKING STALLS PROVIDED = 19 STALLS SITE STATISTICS 60 3 3 A401 1 A401 2 A401 4 A401 1 A501 1 A501 3 A501 3 A501 5 A501 5 A501 1 A502 1 A502 TURF 087COURTS 086 MECH. 029 STORAGE 010 VESTIBULE 031 HALLWAY 025 FITNESS 013 TENANT 012 ELEV. 011 CIRCULATION 052 PARTIAL MAINTENANCE EQUIP. 042 MECH 079 ICE PLANT 082 STORAGE 081 ZAMBONI 083 SKATE RENTAL 009B ELEV. 024 WOM. RR 003 4 4 5 5 C D EE AA BB 81 ' - 0 " 47 ' - 6 " 77 ' - 6 " 78 ' - 0 " 28 4 ' - 0 " 12 8 ' - 6 " 15 5 ' - 6 " 20 6 ' - 0 " 78 ' - 0 " 28 4 ' - 0 " STAIR 078 UP LOCKER 061LOCKER 060 JV 070 VARSITY 068 LOCKER 059 LOCKER 058 LOCKER 057 LOCKER 056 LOCKER 055 WET 069 VARSITY 067 WET 066 JV 065 PLAYER FLEX 063 LOCKER 054 REF 053 RINK 2 077 PLAYER FLEX 041 JV 039 WET 038 VARSITY 037 WET 035 JV 034 COACH 033 PLAYER FLEX 032 STORAGE 044 STOR 046 LOWER LEVEL CIRCULATION 001 SKATE STORAGE 009C PLAYER FLEX 072 THE HUB 009A TRASH AND RECYCLING 030B JAN. 024C RINK 1 047 SUMP 011B MAIN ELEC. 084 TECH / AV 080 EMERGENCY ELEC. 085 ELEC 029A TECH / AV 029B SUMP 024B 1 A451 TECH / AV / ELEC. 009D 2 A502 2 A502 3 A502 3 A502 6 A501 6 A501 2 A501 2 A501 4 A501 4 A501 COACH 040 COACH 064 COACH 043 REF 045 VARSITY 036 HOCKEY EQUIP. 051 STAGE EQUIP. 050 STORAGE 049 BROOMS / MOPS MAINT. 048 STOR. 076 STOR. 074 C.R. 3 018 C.R. 7 022 C.R. 8 023 C.R. 5 020 C.R. 6 021 WOMEN'S 014 MEN'S 015 C.R. 2 017 C.R. 4 019 C.R. 1 016 00 9 D 009B 01 3 A STORAGE 088 023B 030B OH-23 03 0 C 024B 024C 02 3 C 02 9 029A 029B 087K 08 7 J OH-9G OH-9H 011B 015 016 017 018 019 020 021 022 023 02 6 C.R.10 026 087L CIRCULATION 090 3 3 2 2 1 1 04 6 B 04 6 A 04 4 B 04 4 A 03 2 03 4 035A035B 03 6 03 7 038A038B 03 9 04 1 04 0 A 04 0 B 06 0 05 9 052D 05 1 B 05 1 A 05 0 B 05 8 06 1 043A 04 3 B 05 7 05 6 04 9 B 05 0 A 04 9 A 04 8 05 5 05 4 05 2 B 05 3 A 04 5 A 04 5 B 06 3 06 5 07 4 B 06 7 052G 05 2 C 06 8 069A069B 07 0 07 6 A 07 2 07 6 B 052H 08 3 A 08 4 A OH - 8 3 D 07 9 B 085 084B 091 04 2 03 3 A 03 3 B 09 0 B 090A OH-83B OH - 8 1 05 3 B 052A 052E 052F 066A 066B MECH 009E STOR. 009F 00 9 E 00 9 F 09 0 D 079A 047A 047B OFFICE 025E OFFICE 025D OFFICE 025B OFFICE 025A 07 4 A 06 4 A 06 4 B 02 5 D 02 5 E 025C 02 5 B 02 5 A 025 STOR. 025C 08 8 077A 077B 07 8 A 08 7 A 08 7 B 08 7 C 090C MEN'S RR 004 009A C.R. 005 005 00 3 006 004 014 SENSORY ROOM 007 00 7 08 7 G 03 1 A 03 1 B 03 1 C 03 1 D 08 7 D 08 7 F 083E OH - 8 3 F 083C OH-82 013B 04 7 C 3' - 8 5 / 8 " JAN 008A 078B 077C 08 7 H 08 7 E STOR. 008B 2' - 8 " 2' - 8 " 2' - 8 " WEST STAIR 092 ALCOVE 089 00 8 A 012 528' - 0" 336' - 7 1/8"191' - 4 7/8" 30' - 0"222' - 0"72' - 0"204' - 0" 528' - 0" 294' - 0"204' - 0" 6' - 4"3' - 8 5/8"6' - 4"3' - 8 5/8"6' - 4"53' - 11 3/4"6' - 4"3' - 8 5/8"6' - 4"3' - 8 5/8"6' - 4"41' - 1 1/8"2' - 0"16' - 0"12' - 4"8' - 0"35' - 8" Architecture Interior Design Landscape Architecture Engineering 222 North Second Street Long & Kees Bldg Suite 101 Minneapolis, MN 55401 612.339.3752 www.bkvgroup.com © 2025 BKV Group SHEET NUMBER SHEET TITLE DRAWN BY CHECKED BY COMMISSION NUMBER PROJECT TITLE CONSULTANTS NOT F O R CONS T R U C T I O N CERTIFICATION PLAN NORTH TRUE NORTH Au t o d e s k D o c s : / / 2 6 1 2 . 0 3 C h a n h a s s e n B l u f f s C C / 2 6 1 2 . 0 3 _ C B - C C _ A I _ 2 02 5 . r v t 12 / 1 9 / 2 0 2 5 3 : 0 0 : 3 4 P M Author Checker 2612.03 A100 LOWER LEVEL OVERALL FLOOR PLAN CHANHASSEN BLUFFS COMMUNITY CENTER A100 1/16" = 1'-0" 1 OVERALL FLOOR PLAN - LOWER LEVEL B A C D ISSUE #DATE DESCRIPTION 09/18/2025 SCHEMATIC DESIGN 10/30/2025 60% DD 12/18/2025 DESIGN DEVELOPMENT 604 1 A501 1 A501 3 A501 5 A501 5 A501 1 A502 1 A502 COMMUNITY ROOM 118 COMMUNITY ROOM 119 KITCHEN 112 BOH CIRC. / STOR. 115 ELEV. 116 DANCE STUDIO / MULTI USE 109B DANCE STUDIO / MULTI USE 109A CONCESSIONS 102 ELEV. 105 INDOOR PLAYGROUND 127 FAMILY RR 131 PARTY ROOM 129 PARTY ROOM 128 VESTIBULE 100 MAIN LEVEL CIRCULATION 101 ICE VIEWING BOX 121 RINK 1 VIEWING DECK 122 ICE VIEWING BOX 123 RINK 1 VIEWING DECK 124 RINK 2 VIEWING DECK 125 ICE VIEWING BOX 126 4 4 5 5 C D EE AA BB 90' - 7" 81 ' - 0 " 47 ' - 6 " 77 ' - 6 " 78 ' - 0 " 28 4 ' - 0 " 28 4 ' - 0 " FAMILY RR 130 JAN. 113 BOH CONCESSIONS 103 OFFICE 104 RINK 2 077 31 ' - 3 1 / 2 " 21 ' - 1 1 1 / 4 " EQ EQ EQ WELCOME DESK 101A 2 A502 2 A502 3 A502 3 A502 5' - 0 " 6 A501 6 A501 Not Enclosed PLAZA 114 2 A501 2 A501 4 A501 4 A501 1' - 3 1/2" 3' - 8"3' - 8" 20 6 ' - 0 " 33 ' - 3 3 / 1 6 " STORAGE 106 10 0 A SL-100B 10 0 C 10 2 103 10 4 106 113 112A 11 5 A 11 5 B 112B 3 3 2 2 1 1 109B 13 3 A 13 3 B 127B 178A 17 8 B 221' - 0" 130 498' - 0" WOMEN'S RR 107 00 7 00 8 MEN'S RR 108 3' - 4" 10' - 1 1/4" 123 121 124A 124B 125A 125B 126 122A 122B 10 1 C 11 8 A 10 0 D 10 0 F 6' - 6"43' - 4 3/4" 112C 12' - 0" SL-100E 11 9 A 12' - 10" STAIR 078 128A 127A 129A 129B 128B 131 112D 124C RINK 1 047 TRACK LOOP 133 OPEN TO BELOW 99 ' - 1 1 1 3 / 1 6 " 043L 109A 222' - 0"276' - 0" 528' - 0" 30' - 0"222' - 0"72' - 0"204' - 0" 20 6 ' - 0 " 78 ' - 0 " Architecture Interior Design Landscape Architecture Engineering 222 North Second Street Long & Kees Bldg Suite 101 Minneapolis, MN 55401 612.339.3752 www.bkvgroup.com © 2025 BKV Group SHEET NUMBER SHEET TITLE DRAWN BY CHECKED BY COMMISSION NUMBER PROJECT TITLE CONSULTANTS NOT F O R CONS T R U C T I O N CERTIFICATION PLAN NORTH TRUE NORTH Au t o d e s k D o c s : / / 2 6 1 2 . 0 3 C h a n h a s s e n B l u f f s C C / 2 6 1 2 . 0 3 _ C B - C C _ A I _ 2 02 5 . r v t 12 / 1 9 / 2 0 2 5 3 : 0 1 : 5 2 P M Author Checker 2612.03 A101 MAIN LEVEL - OVERALL FLOOR PLAN CHANHASSEN BLUFFS COMMUNITY CENTER A101 1/16" = 1'-0" 1 OVERALL FLOOR PLAN - LEVEL 1 B A C D ISSUE #DATE DESCRIPTION 09/18/2025 SCHEMATIC DESIGN 10/30/2025 60% DD 12/18/2025 DESIGN DEVELOPMENT 605 City Council Item April 27, 2026 Item Report on City Manager's Annual Performance Review File No.Item No: I.1 Agenda Section COUNCIL PRESENTATIONS Prepared By Laurie Hokkanen, City Manager Reviewed By SUGGESTED ACTION Mayor provide summary of review held on March 23, 2026 Motion Type N/A Strategic Priority Communications SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION ATTACHMENTS 606 City Council Item April 27, 2026 Item First Quarter 2026 Communications Update File No.Item No: J.1 Agenda Section ADMINISTRATIVE PRESENTATIONS Prepared By Jenny Potter, City Clerk Reviewed By SUGGESTED ACTION N/A Motion Type N/A Strategic Priority Communications SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION ATTACHMENTS Impact Insights Q1 2026 607 Chanhassen Communications: Impact Insights Q1 2026 608 Email Newsletters Total Subscribers: 16,330 (+.49%growth over Q4 2025) Most popular email lists: 2 •Message from the Mayor – 11,689 subscribers (-.4%over Q4 2025) •Park and Recreation Programs – 6,725 subscribers (-1.85 %over Q4 2025) •Chan-Happenings – 6,575 subscribers (+1.75%increase over Q4 2025) •Special Events – 6,154 subscribers (+1.62%increase over Q4 2025) •Emergency Alerts – 5,808 subscribers (+1.43%increase over Q4 2025) •Senior Center Programming & Events Newsletter – 5,318 subscribers (+1.98%over Q4 2025) Number of newsletters sent during the quarter: 96 (+4.35% from Q4 2025) 609 Email Newsletters Top Five Open Rates (% of emails opened): 3 •Proposed Development Projects (60%) •2026 City Pavement Rehab Project Update (59%) •2025 Stormwater Pond Maintenance Project Update (59%) Pleasantview Road Project (58%) •Proposed Developments (58%) 610 Social Media, Q1 2026 v Q4 2025 4 611 Social Media, Q1 2026 v Q4 2025 5 612 Social Media, Q1 2026 v Q4 2025 6 613 Social Media, Most Popular Posts: Facebook (likes) 7 614 Social Media, Most Popular Posts: Facebook (views) 8 615 Social Media, Most Popular Posts: LinkedIn (likes) 9 616 Social Media, Most Popular Posts: Instagram (likes) 10 617 Social Media, Most Popular Posts: TikTok (likes) 11 618 Social Media, Most Popular Posts: Twitter/X (likes) 12 619 Social Media, Most Popular Posts: YouTube (likes) 13 620 Social Media, Most Popular Posts: Threads (likes) 14 621 Most watched Facebook videos 15 Chanhassen Community Center 11,822 views Rick Rice Day 8,148 views Snow Plow Tribute 7,377 views Snow Removal PSA 7,088 views Phase 2 Construction Update 6,121 views 622 ChanhassenMN.gov: Q1 2026 v Q4 2025 16 “Active Visitors”: The total number of people who visited our website. Each person is counted once, no matter how many times they visit. “Sessions”: The total visits to our website. Each time someone comes to the site, it starts a new session, even if they’re a returning visitor. “Page Views”: The total number of pages viewed. Every time a page loads, it counts as one view, including repeat views of the same page. 623 ChanhassenMN.gov: Q1 2026 v Q4 2025:Top Pages 17 “Active Visitors”: The total number of people who visited our website. Each person is counted once, no matter how many times they visit. “Sessions”: The total visits to our website. Each time someone comes to the site, it starts a new session, even if they’re a returning visitor. “Page Views”: The total number of pages viewed. Every time a page loads, it counts as one view, including repeat views of the same page. 624 City Council Item April 27, 2026 Item Letter to the Metropolitan Council regarding Comprehensive Plan Amendment Policy File No.Item No: K.1 Agenda Section CORRESPONDENCE DISCUSSION Prepared By Eric Maass, Community Development Director Reviewed By SUGGESTED ACTION No action necessary. Motion Type N/A Strategic Priority Development & Redevelopment SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION ATTACHMENTS 625 Letter to Metropolitan Council Representative 626 April 9th, 2026 Dr. Tyronne Carter Council Member, District 3 Metropolitan Council 390 Robert Street, St Paul, MN 55101 RE: Comprehensive Plan Amendment Requirements Dear Council Member Carter. The City of Chanhassen has been made aware of a letter sent by the City of Cottage Grove Mayor, Myron Bailey, dated March 4th, 2026, to Council Member Jenkins (District 12), and a letter from City of Waconia Community Development Director, Lane Braaten, dated March 25, 2026 to Council Member Barber (District 4), echoing the problematic impacts of a recent change in interpretation of Metropolitan Council policy. Metropolitan Council staff have begun implementation of a new interpretation of a preexisting policy. This new interpretation requires cities to address Comprehensive Plan Amendments for developments that modify the location of residential densities within a parcel, even when the development still meets affordability and density requirements, aligns with average density requirements, and meets city sewer capacity and trip generation requirements, all consistent with the overall implementation of their Comprehensive Plans. The City of Chanhassen has large parcels with a mix of residential land-use designations. The City has been prudent in allocating densities across large parcels, anticipating how development would occur. It remains likely that, with an actual development application, the allocation of housing types and densities would not align exactly with what is displayed in the City’s 2040 Future Land Use Map and, with the current policy interpretation, would require a Comprehensive Plan Amendment for a development project that would fall within the density range permitted in our Comprehensive Plan. This additional process for development projects continues to be time-consuming and costly, creates opportunities for public opposition to diverse housing projects, and ultimately makes it difficult to support affordability requirements. While the City of Chanhassen has not had a development project occur on a parcel with a mixed land use designation that generated a Comprehensive Plan Amendment which is the specific issue at hand, the City of Chanhassen would like to extend our support to the City of Cottage Grove, and other communities who are being significantly impacted by a change of policy, or interpretation of policy, requiring Comprehensive Plan Amendments in comparable situations. 627 For these reasons, the City of Chanhassen urges you to draw back and revise the Metropolitan Council policies that require Comprehensive Plan Amendments for development projects that align with the high-level land use lines and overall density of their land use designations within their guiding Comprehensive Plans. We ask for your support in resolving this situation so we can continue to deliver the necessary housing across our region in an efficient and timely manner. Thank you for your consideration. Sincerely, Eric Maass, AICP, EDFP Community Development Director, City of Chanhassen CC: Robin Hutcheson, Chair Lisa Barajas, Community Development Director MacKenzie Young- Walters, Senior Planner, Sector Representative Laurie Hokkanen, Chanhassen City Manager City of Chanhassen Mayor and City Council 628 City Council Item April 27, 2026 Item Follow-Up: Chanhassen Citizen Action Request File No.Item No: K.2 Agenda Section CORRESPONDENCE DISCUSSION Prepared By Jenny Potter, City Clerk Reviewed By SUGGESTED ACTION N/A Motion Type N/A Strategic Priority N/A SUMMARY BACKGROUND DISCUSSION BUDGET RECOMMENDATION ATTACHMENTS Email Follow-up Chanhassen Citizen Action Request 629 From:Hokkanen, Laurie Subject:Follow-up: Chanhassen Citizen Action Request Date:Wednesday, April 15, 2026 11:23:04 AM Good morning, Thank you for submitting a citizen action request. The City Council holds its roundtable discussions quarterly during the work session, providing an opportunity for councilmembers to raise topics of interest, ask questions and identify potential items for future consideration. While no formal action is taken during roundtable discussions, they help inform future Council direction and priorities. As part of the April 13 roundtable, several Citizen Action Requests were discussed, along with updates on previously raised topics. A citizen request related to immigration enforcement policies and city cooperation with federal authorities prompted discussion about recent outreach to federal officials. Mayor Elise Ryan noted that the city remains in regular communication with Congressman Tom Emmer’s office regarding ICE-related matters, but there was no consensus to move forward with a resolution or to pursue the establishment of a Human Rights Commission. Regarding participation in the Safe & Stable Cities Coalition, the mayor noted that the city is an ally but not a formal, dues-paying member, participating in periodic updates but not contributing financially or taking formal policy positions. Activity within the coalition has been minimal and no additional action was recommended at this time. A request to explore tree planting and native landscaping efforts along 78th Street is moving forward, with a resident working directly with city staff on potential opportunities and coordination. Council expressed general support for continued collaboration on these efforts. The roundtable also included discussion of traffic concerns related to a recent highway closure, with staff actively coordinating with Carver County on signage, enforcement, and other mitigation efforts. We appreciate you bringing a request forward and your engagement in the community. Thank you, Laurie Hokkanen City Manager City of Chanhassen 952-227-1119 630 631