Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
CAS-01_PLANNING CASE NO. 2020-01
Notice of Public Hearing Chanhassen Planning Commission Meeting Date & Time•' Tuesday, January 21; 2020 at 7:00 P.M. This hearing may not start until later in the evening, depending on the order of theagenda. Location: City Hall Council Chambeit, 7700 Market Blvd. Consider a request for an Interim Use Permit (IUP) for the Proposal: purpose of repairing landslides along a portion of the Minnesota Bluffs LRT Regional Trail. Zoned Agricultural Estate District (A2). Applicant: Jessica Galatz, Hennepin County Regional Railroad Authority Property Minnesota Bluffs LRT Regional Trail Location: A location map is on the reverse side of this nol 4irill purpose of this public hearing is to inform you about the applicant's request and to phtain input from the neighborhood about this "rdect. During the meeting, the Chair will lead the publiii'Fing through the following What Happens steps: at the Meeting: 1. Staff will give an overview of the proposed project. 2. The applicant will present plans on the project. 3. Comments are received from the public. 4. Public hearing is closed and the Commission discusses the project. If you want to see the plans before the meeting, please visit the City's projects web page at: www.ci.chanhassen.mn.us/2020-01. If you wish to talk to someone about this project, please contact Bob Generous Questions & by email at baenerousCDci.chanhassen.mn.us or by phone Comments: at 952-227-1131. If you choose to submit written comments, please send one copy to staff in advance of the meeting. Staff will provide copies to the Commission. The staff report for this item will be available online on the project web site listed above the Thursday prior to the Planning Commission meeting. NEWI Sign up to receive email and/or text notifications when meeting agendas, packets, minutes and videos are uploaded to the city's website. Go to www.ci.chanhassen.mn.us/notifyme to sign up! City Review Procedure: • Subdivisions, Planned unit Developments, Site Plan Reviews, Conditional and Itaedm Uses, Welland Alterations, Rezonings, Comprehensive Plan Amendments and Code Amendments require a pudic hearing before the Planning Commission. City ordinances require all property within 500 feel of dre subject site to be n rod of the owicelim in writing. Any interested party is invited to attend the meeting. • Staff prepares a report on the subject application that includes all pertinent information and a recommendation. These reports are available by request Al the Planning Commission meeting, staff will give a verbal overview of the report and a recommendation. The item will be opened for the public to speak about the proposal as a Part of the hearing process. The Commission will Gose the public hearing and discuss the item and make a recommendation to the City Council. The City Counal may reverse, affirm or modify wholly or partly the Planning Commission s recommendation. Rezomngs, land use and code amendments take a simple majority vote of the City Council except rezomngs and land use amendments from residential to commemiallindustrial. • Minnesota State Statute 519.99 requires all applications to be processed within 60 clays unless the applicant waives this standard Some applications clue to their complexity may take several months to complete. Any person wishing to follow an item through the process should! check with the Planning Department regarding its status and scheduling for the City Council meeting • A neighborhood spokespersonlrepretientanve is encouraged to provide a contactfor the city. Often developers are encouraged to meet w,M lre neighborhood regarding their proposal. Staff is also available to review the project with any interested person(s). • Because the Planning Commission holds to Public hearing, the City Council toes not Minutes are taken and any corespaWerae regarding the application will be i o uded in tyre report ro Me CityCmnal If yon wish to have something tobe included in Me report please contact Me Planning Staff named on the notification I3 Fr'dnW'ii_i q,, ykVSIS PQST'M L rf•BO vrrwev Bowes 02 IP $ 000.500 *' 0003195036 JAN 09 2020 MAILED FROM ZIP CODE 55317 City of Chanhassen 7700 Market Boulevard PO Box 147 Chanhassen, MN 55317 553Kim FE 1 N t0 �t TOeK O R KNtiN ATTnt ABLEBTO FORwAoO�.'.,r j_@y_:.1 t tttll.�147 This map is neither a legally recorded map nor a survey and is not inte 'y , t' ' "I t„1y; 00'jt,iij`l l't r as one. This map is a compilation of records, information and data locate ;lith jj tl county, state and federal offices and other sources regarding the area s be used for reference purposes only. The City does not warrant that t Information System (GIS) Data used to prepare this map are errorfree, an,_ •„z amity does not represent that the GIS Data can be used for navigational, tracking or any other purpose requiring exacting measurement of distance or direction or precision in the depiction of geographic features. The preceding disclaimer is provided pursuant to Minnesota Statutes §400.03, Subd. 21 (2000), and the user of this map acknowledges that the City shall not be liable for any damages, and expressly waives alftbiins, and agrees to defend, indemnify, and hold harmless the City frog P� ught by User, its employees or agents, or third parties ^ _ _ ss or use of data provided. nH• IF•r: SETTLERS WEST HO ASSOC - COMMUNITY DEV INC 7100 MADISON AVE W GOLDEN VALLEY MN 55427 IIII! I i lllllllrfl-iiillllllllllllhu-hlllrllrrnl Inllrr • Documeember. A691744 Filed and/or Recorded on Feb 26, 2020 3:59 PM Office of the County Recorder/Registrar of Titles Carver County, Minnesota Kaaren Lewis, County Recorder Deputy KL Pkg ID: 7129125 Document Recording Fees $ 46.00 Document Total $ 46.00 Requesting Party: CAMPBELL KNUTSON PA Pages: 4 SU°S W—M, This cover page has been added to this document by Carver County Land Records and is now an official part of this recorded document CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES INTERIM USE PERMIT #2020-01 1. Permit. Subject to the terms and conditions set forth herein, the City of Chanhassen hereby grants an interim use to permit for grading, excavation and slope restoration on the Minnesota Bluff LRT Regional trail within the Hennepin County Regional Railroad Authority (HCRRA) on the north and south side of the trail per plans prepared by Barr Engineering Co., dated December 13, 2019. 2. Proverty. The permit is for the following described property ("subject property") in the City of Chanhassen, Carver County, Minnesota: Hennepin County Regional Railroad Authority (HCRRA) right-of-way for Minnesota River Bluffs LRT Regional Trail in Sections 25, 34, 35 and 36, Twsp 116, Range 23, Carver County, Minnesota. 3. Conditions. The permit is issued subject to the following conditions: a) The interim use permit shall be approved for a period of two (2) years from the date of City Council approval. The applicant will need to request a formal extension 60 days prior to the expiration date of the interim use permit. b) Permits from the appropriate regulatory agency must be obtained; including but not limited to the Minnesota Pollution Control Agency, Lower Minnesota River Watershed District and Carver County. c) The applicant must provide the city with a cash escrow or letter of credit in the amount of 110% of the construction costs for the appropriate phase of the grading operations to guarantee erosion control measures, site restoration, and compliance with the interim use permit. d) Documentation and/or load tickets from the approved waste disposal facility where contaminated soils will be disposed of shall be provided to the city. e) All required Right -of -Way (ROW) permits, access agreements, and temporary construction easements shall be secured prior to the commencement of any construction activities. I) All oversize/overweight (OS/OW) loads leaving the site to the east must apply for County Transportation OS/OW trip permits. g) Permitted hours of operation will be 7:00 a.m. to 6:00 p.m., Monday through Friday, and 9:00 a.m. to 5:00 p.m. on Saturday with no work permitted on Sunday or legal holidays. 0 0 h) If any excess material is hauled to another site in Chanhassen, a separate grading permit will be required for the other property. i) The applicant shall schedule a walk-through of the site with city staff to review boundary staking and removals of edge trees prior to any activity commencing. j) The applicant shall identify conservation easement boundary on site. Vegetation within the easement may not be irrevocably damaged by construction activities. If irrevocable damage is caused, the applicant shall be responsible for replacement plantings at a rate of 2:1 diameter inches. k) Applicant shall report tree removal quantities to the city. 1) Upon completion of the installation of initial erosion control measures, the contractor shall contact the city's Engineering Department (Ryan Pinkalla, 952- 227-1173) for an initial erosion control inspection prior to grading operations. m) HDPE pipe installed shall be furnished with tracer wire meeting the City of Chanhassen's Standard Specifications. n) The applicant shall submit hydraulic design calculations and follow-up analysis for the newly proposed stormwater conveyance system, including analysis for riprap stilling basins and rock check dams as energy dissipaters. o) One hundred percent (100%) construction plans shall be provided for review and approval prior to commencement of any construction activities. p) The applicant shall enter into maintenance agreements with the city and/or Lower Minnesota River Watershed District to ensure maintenance responsibilities and ownership are the responsibility of the HCRRA or their designee, in perpetuity, prior to commencement of any construction activities. q) The applicant shall provide further justification to the wetlands being impacted being incidental. This can be accomplished through the WCA permit process that is currently underway. 4. Termination of Permit. The city may revoke the permit following a public hearing for violation of the terms of this permit. 5. Lapse. If within one year of the issuance of this permit the authorized construction has not been substantially completed or the use commenced, this permit shall lapse, unless an extension is granted in accordance with the Chanhassen Zoning Ordinance. 6. Criminal Penalty. Violation of the terms of this Interim Use Permit is a criminal misdemeanor. Dated: February 10, 2020 STATE OF MINNESOTA (ss. COUNTY OF CARVER n u CITY OF CHANHASSEN By: LJ l i p� Mayor Q By: ,�'^6 City Manager W The foregoing instrument was acknowledged before me this I q "day of true f- 200, 200, by Elise Ryan, Mayor, and Todd Gerhardt, City Manager, of the City of Chanhassen, a Minnesota municipal corporation, on behalf of the corporation and pursuant to authority granted by its City Council. DRAFTED BY: City of Chanhassen 7700 Market Boulevard P.O. Box 147 Chanhassen, MN 55317 (952)227-1100 1 Notary Public KIM T. MEUWISSEN Notary Public -Minnesota My �p,y, Expires Je{{ 31 PC_ aoDo-v� CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA FINDINGS OF FACT AND RECOMMENDATION Application of Hennepin County Regional Railroad Authority (HCRRA) for an Interim Use Permit to permit grading, excavation and slope restoration. On January 21, 2020, the Chanhassen Planning Commission met at its regularly scheduled meeting to consider the application of Hennepin County Regional Rail Authority for an Interim Use Permit for the property located north of 220 Flying Cloud Drive within the right- of-way for the Minnesota River Bluffs LRT Regional Trail. The Planning Commission conducted a public hearing on the proposed interim use which was preceded by published and mailed notice. The Planning Commission heard testimony from all interested persons wishing to speak and now makes the following: FINDINGS OF FACT 1. The property is currently zoned Agricultural Estate District (A2). 2. The property is guided by the Land Use Plan for Residential High Density use. 3. The legal description of the property is: Hennepin County Regional Railroad Authority (HCRRA) right-of-way for Minnesota River Bluffs LRT Regional Trail in Sections 25, 34, 35 and 36, Twsp 116, Range 23, Carver County, Minnesota 4. When approving an Interim Use Permit, the city must determine the capability of a proposed development with existing and proposed uses. The general issuance standards of the conditional use Section 20-232, include the following 12 items: a. The mining operation will not be detrimental to or endanger the public health, safety, comfort, convenience or general welfare of the neighborhood or the city. The site work will result in the stabilization and re -vegetation of the slope and the reduction in site erosion. b. The slope restoration and stormwater improvements will be consistent with the objectives of the city's comprehensive plan and the zoning code by the protection and stabilization of the slopes. c. The slope restoration and stormwater improvements will be designed, constructed, operated and maintained so to be compatible in appearance with the existing or intended SCANNSD character of the general vicinity and will not change the essential character of that area because the site will be re -vegetated and the slopes stabilized reducing site erosion. The aesthetics of the site will be enhanced with the elimination of the slope sluffing, gullies/ravines in the site and the establishment of site vegetation. d. The slope restoration and stormwater improvements will not be hazardous or disturbing to existing or planned neighboring uses because the grading and drainage will be contained within the site perimeters. Additionally, hours of operation are limited and specific conditions of approval will be in place and enforced by the city. e. The slope restoration and stormwater improvements will be served adequately by essential public facilities and services, including streets, police and fire protection, drainage structures, refuse disposal, water and sewer systems and schools; or will be served adequately by such facilities and services provided by the persons or agencies responsible for the establishment of the proposed use. The use is temporary which does not need to be served by public facilities and services. The proposed grading will reduce or eliminate erosion on the slope. f. The slope restoration and stormwater improvements will not create excessive requirements for public facilities and services and will not be detrimental to the economic welfare of the community since this is a temporary use. The repair of the slope will reopen a regional trail corridor, which is heavily used. g. The slope restoration and stormwater improvements will not involve uses, activities, processes, materials, equipment and conditions of operation that will be detrimental to any persons, property or the general welfare due to excessive production of traffic, noise, smoke, fumes, glare, odors, rodents, or trash. The proposed grading could result in a temporary increase in traffic, noise and fumes. The conditions of the approval will provide standards by which the activities should be minimized. h. The slope restoration and stormwater improvements will have vehicular approaches to the property which do not create traffic congestion or interfere with traffic or surrounding public thoroughfares. Through the use of signage, limits on the hours of operation, and if traffic becomes congested, additional limits on the hours of hauling operation could be instituted and potential traffic problems will be mitigated. L The slope restoration and stormwater improvements will not result in the destruction, loss or damage of solar access, natural, scenic or historic features of major significance. The proposal will result in the removal of some existing canopy. However, the site will be re - vegetated and there will be less bluff impact. j. The slope restoration and stormwater improvements will be aesthetically compatible with the area since the grading and re -vegetation of the site will improve the site aesthetics. E 0 k. The slope restoration and stormwater improvements will not depreciate surrounding property values since the plan will improve the site and its impacts on the surrounding properties. 1. The slope restoration and stormwater improvements will meet standards prescribed for certain uses as provided in Chapter 7, Article III of the Chanhassen City Code. 5. The planning report #2020-01 dated January 21, 2020, prepared by Erik Henricksen, et al, is incorporated herein. The Planning Commission recommends that the City Council approve the Interim Use Permit to permit grading, excavation and slope restoration subject to the conditions of the staff report. ADOPTED by the Chanhassen Planning Commission this 21' day of January, 2020. COMMISSION M Steven gAplan\2020 planning cases\20-01 chanhassen slope failure project iup\findings of fact.docx PLANNING COMMISSION STAFF REPORT Tuesday, January 21, 2020 Subject Consider a Request for an Interim Use Permit (IUP) and Wetland Alteration Permit (WAP) for the Purpose of Repairing Landslides Along a Portion of the Minnesota Bluffs LRT Regional Trail Section PUBLIC HEARINGS Item No: B. I. Prepared By Bob Generous. Senior Planner File No: Planning Case No. 2020-0I PROPOSED MOTION, The Chanhassen Planning Commission recommends City Council approve the Interim Use Permit, Planning Case #2020-01, to permit grading, excavation and slope restoration as proposed on the plans prepared by Bar Engineering Co., dated 12/132019, subject to the Conditions of Approval, and adopt the Findings of Fact and Recommendation. SUMMARY OF REQUEST The project includes landslide repairs on the Minnesota Bluff LRT Regional trail within the Hennepin County Regional Railroad Authority (HCRRA) on the not and south side of the trail. APPI___ 1-�C M Hennepin County Regional Railroad Authority SITE INFORMATION PRESENT ZONING: Agricultural Estate District (A2) LAND USE: Hennepin County Regional Railroad Authority Right -of -Way ACREAGE: 7.22 acres DENSITY: NA APPLICATION RF( n TION Chapter 7, Article IB. Excavating, Mining, Filling and Grading Chapter 20, Sections 20-231 through 20-237, Conditional Use Permits (Interim Use Permits are processed in the same manner as Conditional Use Permits) Chapter 20, Article X, "A -T', Agricultural Estate District BACKGROUND The trail ran on the embankment for 22 years; railroad cars ran on the embankment for almost 100 years before that. In July 2014, several areas of the HCRRA's corridor in Chanhassen were damaged by the storm events grouped as Presidential Disaster 4182. The most significant damage was an 80 -foot slope failure that required total closure of the trail between Pioneer Trail and Highway 101. Staff recommends approval of the Interim Use Peri[ to permit grading, excavation and slope restoration as proposed on the plans prepared by Barr Engineering Co., dated 12/132019, subject to the Conditions of Approval in the staff report and adoption of the Findings of Fact and Recommendation. o Staff Report a Findings of Fact and Recommendation o Development Review Application D Application Narrative D Plan Sheets a Wetland Conservation Act Notice of Application o Affidavit of Mailing CITY OF CHANHASSEN 7700 MARKET BLVD. P.O. BOX 147 CHANHASSEN, MN 55317 (952) 227-1100 PROPOSED MOTION STAFF REPORT Prepared for the Planning Commission Meeting Date. City Council Date: 60 -Day Review Deadline: Case #: Prepared By: Phone: Email: January 21, 2020 February 10, 2020 February 18, 2020 2020-01 RG, EH, RP, JS (952)227-1131 bgenerous@ci.chanhassen. mn.us "The Chanhassen Planning Commission recommends City Council approve the Interim Use Permit, Planning Case #2020-01, to permit grading, excavation and slope restoration as proposed on the plans prepared by Barr Engineering Co., dated 12/13/2019, subject to the Conditions of Approval and adopt the Findings of Fact and Recommendation." GENERAL INFORMATION Request: A request for an Interim Use Permit (IUP) for the purpose of repairing landslides along a portion of the Minnesota Bluffs LRT Regional Trail. Site Address: North of 220 Flying Cloud Drive (CSAH 61) (within the right-of-way for the regional trail) PID: 259990600 Legal Description: In Sections 25, 34, 35 and 36, Twsp 116, Range 23, Carver County, Minnesota Applicant Info: Hennepin County Regional Rail Owner Hennepin County Regional Rail Authority Info: Authority Present Zoning: Agricultural Estate District (A2) Acreage: 7.22 Location Map: 2020 Land Use Plan: Residential High Density Density: NA Planning Commission Interim Use Permit, Planning Case No. 2020-01 January 21, 2020 Page 2 Level of City Discretion in Decision -Making: The city has limited discretion in approving or denying Interim Use Permits for grading, based on whether or not the proposal meets the standards outlined in the Zoning Ordinance and Chapter 7 of the City Code. If the city finds that all of the applicable standards are met, the permit must be approved. This is a quasi-judicial decision. Notice of this public hearing has been mailed to all property ow ners within 500 feet. PROPOSAL/SUMMARY The project includes landslide repairs on the Minnesota Bluff LRT Regional trail within the Hennepin County Regional Railroad Authority (HCRRA) on the north and south side of the trail. Landslide repair on the south side will include stabilizing the south slope, repairing the south culvert outlet area and constructing a new storm sewer and drainage ditch to direct water into the repaired area. Existing trail profile grades will be reduced with the embankment slopes regraded to less steep grades and finished with turf reinforcement mats. The existing damage concrete headwall will be removed and existing riprap will be salvaged for reuse. The south culvert outlet area will be repaired with riprap, boulder cross vanes and a stilling basin. Work in the north area will include removal of existing pipe debris, placement of riprap fill on the north slope and abandonment of the existing pipe crossing beneath the trail. Drainage will be rerouted from the north pipe area via a new buried storm sewer and lined drainage channel, which will discharge to the south culvert outlet area. APPLICABLE REGULATIONS Chapter 7, Article III, Excavating, Mining, Filling and Grading Chapter 20, Sections 20-231 through 20-237, Conditional Use Permits (Interim Use Permits are processed in the same manner as Conditional Use Permits) Chapter 20, Article X, "A-2", Agricultural Estate District SITE CONSTRAINTS Wetland Protection There is a wetland located on the property. The proposed grading does not directly impact the wetlands. Bluff Protection There are bluffs on the property. The proposed improvements are to eliminate erosion of the bluff. Shoreland Management The property is not located within the Shoreland Overlay District for Rice Lake. Floodplain Overlay This property is not within a floodplain. Planning Commission Interim Use Permit, Planning Case No. 2020-01 January 21, 2020 Page 3 BACKGROUND The trail ran on the embankment for 22 years; railroad cars ran on the embankment for almost 100 years before that. In July 2014, several areas of the HCRRA's corridor in Chanhassen were damaged by the storm events grouped as Presidential Disaster 4182. The most significant damage was an 80 -foot slope failure that required total closure of the trail between Pioneer Trail and Highway 101. This trail is a well -used segment of a large regional network that serves recreational and commuter users. Its closure requires a six -mile detour. The HCRRA had worked with Federal Emergency Management Agency (FEMA) and State of Minnesota staff since June 2014 to restore the slope and reopen the trail. The HCRRA planned to restore the slope in the summer of 2016 before receiving notice from FEMA that their application for public assistance had been denied. The denial was appealed in 2016, but public assistance was again denied. GRADING The Hennepin County Regional Railroad Authority (HCRRA) has submitted an application to excavate up to approximately 24,800 cubic yards (Cl) on a portion of the Minnesota Bluffs LRT Regional Trail located just northwest of 220 Flying Cloud Drive (Moon Valley Aggregate). The purpose of this work is to repair damage due to landslides that occurred after a high intensity rain event in June of 2014. Two repair areas will require grading and excavation as part of the proposed permit — the north repair area and the south repair area. Figure I - Comimcdon Area Landslide repairs in the south repair area, seen in Figure 1, will include: stabilizing the slope south of the existing regional trail; repairing the south culvert outlet area by removing the existing damaged concrete headwall, regrading, and installing a new pipe apron; constructing a new storm sewer and drainage ditch to direct water into the repaired area; and reducing trait profile grades where the landslide occurred by regrading the embankment slopes to less steep grades, coupled with the installation of turf reinforcement mats. This area includes the rehabilitation of the stream bed. Planning Commission Interim Use Permit, Planning Case No. 2020-01 January 21, 2020 Page 4 Work in the north repair area, seen in Figure 2, will include: removal of existing pipe debris; placement of riprap fill on the slope north of the existing trail; and abandonment of the existing pipe crossing beneath the trail. Drainage will be rerouted from the north pipe area via a new horizontal directional drilled storm sewer pipe to a lined drainage channel, which will discharge to the south culvert outlet area. Plans for redirecting the water were provided to the Lower Minnesota River Watershed District for review and comment on December 12, 2019. Stockpile areas have been identified to be located in staging areas. Due to the limited areas to stockpile material on site, the applicant has expressed that the contractor wt ll I'tk I choose to utanexcavated 1] LVERQ SLGREPM MMWTI09. SE..ET J p y . «IRET material directly in trucks to export. Figure z - south Repair area Excavated material will include soil and unsalvageable riprap. The total estimated quantity provided by the applicant of excavated material is 22,814 CY, with 19,990 CY being common (non -contaminated) and 2,824 CY being special (contaminated material). The contaminated soils were limited to shallow soils on or near the trail and are attributed to the fact that the trail was a past railroad line. The applicant has indicated that all contaminated soils will be exported offsite to an approved waste disposal facility as recommended by the Environmental Soil Investigation provided on April 4, 2018 by Kevin Eisen, PE, PMP, a Senior Geological Engineer with BARR. The applicant is proposing two separate accesses to the repair areas. Access to the north repair area will be from Highview Drive along the trail, located in Eden Prairie, while access to the south repair area is tentatively planned to be from Flying Cloud Drive via the Moon Valley Aggregate property. Both accesses will require permissions from each entity: a right-of-way (ROW) permit from the City of Eden Prairie, and a private access agreement with Moon Valley Aggregate and the landowner. Along with applicable ROW permits and access agreements, any work that encroaches into adjacent properties outside HCRRA's property will require temporary construction easement(s). Planning Commission Interim Use Permit, Planning Case No. 2020-01 January 21, 2020 Page 5 The equipment that will utilize the access routes will include a backhoe (or similar excavator), small bulldozers, light bobcat(s) and trucks to transport personnel, equipment and material. It is proposed that construction - related traffic and haul routes will utilize Hennepin County Highway 1 (Pioneer Trail) and Carver County Highway 61 (Flying Cloud Drive) to get to and from the sites. Flying Cloud Drive will be rated for a 10 -ton per axle road. All oversize/overweight loads leaving the site to the east must apply for County Transportation OS/OW trip permits. Although there are no residential, commercial or industrial developments immediately adjacent to the areas where construction will be taking place, construction traffic will be utilizing the trail which does run near residential areas. The applicant is proposing M that the work is anticipated to occur between the months of February and December of 2020. Figure 3 - Noah Repair Area Due to the period of construction and the proximity of residential areas near the trail, construction hours will be limited to those hours listed in Sec. 13-52.c of City Ordinance which pertain to construction activities in conjunction with improvement projects (7:00 a.m. to 6:00 p.m. on weekdays and 9:00 a.m. to 5:00 p.m. on Saturdays with no work on Sundays or public holidays). Any requests to work beyond those hours shall be made to the Public Works Director/City Engineer for review and approval. The applicant should be aware that if excess material is transported to another site in Chanhassen, a separate grading permit will be required for the other property. The applicant has submitted plans showing tree removal and restoration to be done as part of the trail repairs. On either side of the trail are non-developed areas that are fully wooded with native species, such as maples, lindens, oaks, elms, cottonwoods, etc. On the south side of the trail there is an outlot of Settlers West, owned by the city and covered by a Conservation Easement. The construction plans show no impact to this area, but construction limits are directly adjacent to the outlot so staff will be monitoring to ensure there is no encroachment. Tree removal will occur along the trail in the repair areas shown in the plans. City Code requires trees 6" and larger to be shown on plans. However, due to the density of trees, it was recommended to the applicant that a field inventory during the project will be better suited to the conditions. Therefore, restoration quantities are not available with the application. Staff will be monitoring and confirming the tree removal for the project and the applicant is required to plant replacements at a rate of 1:1 for all trees 6and larger. Replacement trees will be selections of native overstory and understory species. IYJ� l tl Planning Commission Interim Use Permit, Planning Case No. 2020-01 January 21, 2020 Page 6 Erosion control has been shown on the plan in general conformance with City Ordinance Sec. 19-145 (Erosion and Sediment Control) and industry best management practices. Efforts shall be made by the applicant to ensure erosion control practices remain up to date with city standards, ordinances, and best management practices. If erosion control measures installed in conjunction with this IUP are deemed by the city to be ineffective, the city will inform the applicant in writing of any deficiencies. The applicant will be required to remedy the deficiencies prior to continuing construction operations. Furthermore, upon completion of the installation of initial erosion control measures as illustrated on the Erosion Control Plan and SWPPP, the contractor shall contact the city for an initial erosion control inspection prior to grading operations. Silt fence shall be furnished in accordance with MnDOT Construction Standards, Section 3886. Machine sliced (MS) or hand installed (HI) woven geotextile silt fence must be installed in all areas specified in the Erosion Control Plan. MS or HI woven geotextile silt fence must be reinforced using sediment logs, wire backing, or other effective Best Management Practice. Phasing is a very important management tool for erosion control, thus one repair area should be stabilized prior to grading and construction operations of the next repair area. Stabilization of the slope north of the repaired culvert in the south repair area is needed immediately upon final grading. Stabilization should continue to be done in phases. Large portions of the site should not be left exposed over weekends or during forecasted heavy rains. Due to the steep slopes and long runs of the slopes, bio -rolls may be needed to aid in stabilization. Bio - rolls would help break up the length of slope and minimize erosion potential of the slope with the erosion control blankets. Six-inch bio -rolls are needed every 15 to 20 feet on steep slopes with exposed soils. Proper blanket application is crucial for this site. The blankets must make 100% contact with the soil and stapled according to manufacturer's specifications. The staple pattern is vital to proper blanket function. The blankets should be head trenched as well. Geotextile and riprap or geogrids or other approved stabilization is needed to provide toe protection; there is a chance the toe of the 2:1 slope may start head cutting without toe protection. Depending on the final soil -used blanket, application may be difficult. For example if the soil is too sandy, stapling the blanket over long runs will not be successful. `Terracing' blankets or using strips of blankets with a heavy application of seed mix (20 pounds per acre) and hydromulch may be needed. Exposed, unworked soils must continue to be stabilized with temporary or permanent stabilization BMPs in accordance with the construction sequencing as stated in the Erosion Control Plan and the SWPPP. Additionally, unworked erodible soils with positive slopes must continue to be stabilized using erosion control blanket or alternate effective BMPs. Subsurface stormwater movement should be considered with surface movement of stormwater. The applicant provided figures of ground water elevations from the County Atlas Series, Carver County, Atlas C-21, Part B, Plate 6. When considering stormwater management, installation of draintile at the toe should be considered to reduce any future possibility of sloughing due to saturation from ground water or slope seepage. DRAINAGE In conjunction with the landslide repairs in the north area, the applicant is proposing to abandon an existing 18" ductile iron stormwater pipe that is located under the Minnesota Bluffs LRT Regional Trail. The existing stormwater pipe to be abandoned conveys treated stormwater from the neighboring subdivision, known as "Settlers West". In order to re-route the treated stormwater, the applicant has proposed to install a 24" HDPE Planning Commission Interim Use Permit, Planning Case No. 2020-01 January 21, 2020 Page 7 storm sewer pipe via horizontal directional drilling (HDD) to the west, replacing the abandoned conveyance system to the north (under the Regional Trail), as seen from Figure 4. To ensure the HDD HDPE pipe can be located in the future, it shall be furnished with tracer wire meeting the City of Chanhassen's Standard Specifications. Furthermore, HDD specifications should conform to the city's Standard Specifications. Rather than stormwater being conveyed under the trail and discharged to the north, the HDD pipe will discharge drainage from the subdivision to the west into a proposed drainage channel, as seen from Figure 5. The drainage channel will be constructed of a flexible concrete geogrid with rock checks installed approximately every 50 feet. Additionally, a riprap stilling basin will be installed near the outlet of the HDD pipe to further assist with energy dissipation and minimization of downstream scouring of the stream bed. While it appears best practices and proper techniques were utilized in the design of these conveyance systems (size of HDPE pipe, stilling basins, check dam spacing, etc.) the applicant did not provide hydraulic calculations or a drainage report for review. The applicant shall submit hydraulic design calculations and follow-up analysis for the newly proposed stormwater conveyance system, including analysis for riprap stilling basins and rock check dams as energy dissipaters for a 100 -year event. Upon submittal of this analysis, 100% plans shall be provided as the applicant provided 90% plans with their IUP application. � • -- �_:: J9 T,e9s. ii ji � �G�=ell :s.`. PMCELLIE Figure 5 - Proposed Drainage Channel 1 1 1 ro\enwrcffu.pne �_ (P I 1 f 1' ,�.�i � v TRII TPE_ ' i-ecma eWFBL y'SW • •—.�— • 1. a�� \ � W9/NO fBIR I \ \\ 1 'FU_ MMO.YIM = ��A 1 srts�rcne �� I I ...^ \ POfEMIK.CCf89 NUllE Figure 4 - North Area Stormwater Conveyance Reconfiguration Rather than stormwater being conveyed under the trail and discharged to the north, the HDD pipe will discharge drainage from the subdivision to the west into a proposed drainage channel, as seen from Figure 5. The drainage channel will be constructed of a flexible concrete geogrid with rock checks installed approximately every 50 feet. Additionally, a riprap stilling basin will be installed near the outlet of the HDD pipe to further assist with energy dissipation and minimization of downstream scouring of the stream bed. While it appears best practices and proper techniques were utilized in the design of these conveyance systems (size of HDPE pipe, stilling basins, check dam spacing, etc.) the applicant did not provide hydraulic calculations or a drainage report for review. The applicant shall submit hydraulic design calculations and follow-up analysis for the newly proposed stormwater conveyance system, including analysis for riprap stilling basins and rock check dams as energy dissipaters for a 100 -year event. Upon submittal of this analysis, 100% plans shall be provided as the applicant provided 90% plans with their IUP application. � • -- �_:: J9 T,e9s. ii ji � �G�=ell :s.`. PMCELLIE Figure 5 - Proposed Drainage Channel Planning Commission Interim Use Permit, Planning Case No. 2020-01 January 21, 2020 Page 8 Lastly, stormwater infrastructure and appurtenances will eventually require maintenance, repairs, and potential upgrades. As these improvements will not be owned and maintained by the City of Chanhassen, the applicant shall enter into maintenance agreements with the city and/or Lower Minnesota River Watershed District to ensure maintenance responsibilities and ownership are the responsibility of the HCRRA or their designee, in perpetuity. WETLANDS The applicant is proposing 0.06 acres of temporary impact to WCA jurisdictional wetlands (Sheet G-05 and G-06). The applicant has claimed that these wetlands are manmade ditch wetlands and should be considered incidental, and thus not regulated under WCA. The applicant did not provide any evidence as to why these should be considered incidental (as-builts, soils data, topography, historical aerials, etc.). While initial in-house desktop review likely supports this claim, any evidence that might show these are in fact incidental wetlands needs to be provided by the applicant. This can be accomplished through the WCA permit process that is currently underway, in which a Notice of Decision on whether the wetlands being impacted are incidental or not can be issued. Staff recommends approval of the Interim Use Permit to permit grading, excavation and slope restoration as proposed on the plans prepared by Barr Engineering Co., dated 12/13/2019, subject to the Conditions of Approval and adoption the Findings of Fact and Recommendation. 1. The interim use permit shall be approved for a period of two (2) years from the date of City Council approval. The applicant will need to request a formal extension 60 days prior to the expiration date of the interim use permit. 2. Permits from the appropriate regulatory agency must be obtained; including but not limited to the Minnesota Pollution Control Agency, Lower Minnesota River Watershed District and Carver County. 3. The applicant must provide the city with a cash escrow or letter of credit in the amount of 110% of the construction costs for the appropriate phase of the grading operations to guarantee erosion control measures, site restoration, and compliance with the interim use permit. 4. Documentation and/or load tickets from the approved waste disposal facility where contaminated soils will be disposed of shall be provided to the city. 5. All required ROW permits, access agreements, and temporary construction easements shall be secured prior to the commencement of any construction activities. 6. All oversize/overweight loads leaving the site to the east must apply for County Transportation OS/OW trip permits. 7. Permitted hours of operation will be 7:00 a.m. to 6:00 p.m., Monday through Friday, and 9:00 a.m. to 5:00 p.m. on Saturday with no work permitted on Sunday or legal holidays. Planning Commission Interim Use Permit, Planning Case No. 2020-01 January 21, 2020 Page 9 8. If any excess material is hauled to another site in Chanhassen, a separate grading permit will be required for the other property. 9. The applicant shall schedule a walk-through of the site with city staff to review boundary staking and removals of edge trees prior to any activity commencing. 10. The applicant shall identify conservation easement boundary on site. Vegetation within the easement may not be irrevocably damaged by construction activities. If irrevocable damage is caused, the applicant shall be responsible for replacement plantings at a rate of 2:1 diameter inches. 11. Applicant shall report tree removal quantities to the city. 12. Upon completion of the installation of initial erosion control measures, the contractor shall contact the city's Engineering Department (Ryan Pinkalla, 952-227-1173) for an initial erosion control inspection prior to grading operations. 13. HDPE pipe installed shall be furnished with tracer wire meeting the City of Chanhassen's Standard Specifications. 14. The applicant shall submit hydraulic design calculations and follow-up analysis for the newly proposed stormwater conveyance system, including analysis for riprap stilling basins and rock check dams as energy dissipaters. 15. One hundred percent (100%) construction plans shall be provided for review and approval prior to commencement of any construction activities. 16. The applicant shall enter into maintenance agreements with the city and/or Lower Minnesota River Watershed District to ensure maintenance responsibilities and ownership are the responsibility of the HCRRA or their designee, in perpetuity, prior to commencement of any construction activities. 17. The applicant shall provide further justification to the wetlands being impacted being incidental. This can be accomplished through the WCA permit process that is currently underway. ATTACHMENTS 1. Findings of Fact 2. Development Review Application 3. Application Narrative 4. Minnesota Bluffs LRT Regional Trail Landslide Repairs plans Sheets G-01 through R-04 5. Minnesota Wetland Conservation Act Notice of Application 6. Public Hearing Notice and Mailing List 9:\plan12020 planning casest20-0l chanhassen slope failure project iup\staff report.docx CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA FINDINGS OF FACT AND RECOMMENDATION IN RE: Application of Hennepin County Regional Railroad Authority (HCRRA) for an Interim Use Permit to permit grading, excavation and slope restoration. On January 21, 2020, the Chanhassen Planning Commission met at its regularly scheduled meeting to consider the application of Hennepin County Regional Rail Authority for an Interim Use Permit for the property located north of 220 Flying Cloud Drive within the right- of-way for the Minnesota River Bluffs LRT Regional Trail. The Planning Commission conducted a public hearing on the proposed interim use which was preceded by published and mailed notice. The Planning Commission heard testimony from all interested persons wishing to speak and now makes the following: FINDINGS OF FACT 1. The property is currently zoned Agricultural Estate District (A2). 2. The property is guided by the Land Use Plan for Residential High Density use. 3. The legal description of the property is: Hennepin County Regional Railroad Authority (HCRRA) right-of-way for Minnesota River Bluffs LRT Regional Trail in Sections 25, 34, 35 and 36, Twsp 116, Range 23, Carver County, Minnesota 4. When approving an Interim Use Permit, the city must determine the capability of a proposed development with existing and proposed uses. The general issuance standards of the conditional use Section 20-232, include the following 12 items: a. The mining operation will not be detrimental to or endanger the public health, safety, comfort, convenience or general welfare of the neighborhood or the city. The site work will result in the stabilization and re -vegetation of the slope and the reduction in site erosion. b. The slope restoration and stormwater improvements will be consistent with the objectives of the city's comprehensive plan and the zoning code by the protection and stabilization of the slopes. c. The slope restoration and stormwater improvements will be designed, constructed, operated and maintained so to be compatible in appearance with the existing or intended character of the general vicinity and will not change the essential character of that area because the site will be re -vegetated and the slopes stabilized reducing site erosion. The aesthetics of the site will be enhanced with the elimination of the slope sluffing, gullies/ravines in the site and the establishment of site vegetation. d. The slope restoration and stormwater improvements will not be hazardous or disturbing to existing or planned neighboring uses because the grading and drainage will be contained within the site perimeters. Additionally, hours of operation are limited and specific conditions of approval will be in place and enforced by the city. e. The slope restoration and stormwater improvements will be served adequately by essential public facilities and services, including streets, police and fire protection, drainage structures, refuse disposal, water and sewer systems and schools; or will be served adequately by such facilities and services provided by the persons or agencies responsible for the establishment of the proposed use. The use is temporary which does not need to be served by public facilities and services. The proposed grading will reduce or eliminate erosion on the slope. f. The slope restoration and stormwater improvements will not create excessive requirements for public facilities and services and will not be detrimental to the economic welfare of the community since this is a temporary use. The repair of the slope will reopen a regional trail corridor, which is heavily used. g. The slope restoration and stormwater improvements will not involve uses, activities, processes, materials, equipment and conditions of operation that will be detrimental to any persons, property or the general welfare due to excessive production of traffic, noise, smoke, fumes, glare, odors, rodents, or trash. The proposed grading could result in a temporary increase in traffic, noise and fumes. The conditions of the approval will provide standards by which the activities should be minimized. h. The slope restoration and stormwater improvements will have vehicular approaches to the property which do not create traffic congestion or interfere with traffic or surrounding public thoroughfares. Through the use of signage, limits on the hours of operation, and if traffic becomes congested, additional limits on the hours of hauling operation could be instituted and potential traffic problems will be mitigated. L The slope restoration and stormwater improvements will not result in the destruction, loss or damage of solar access, natural, scenic or historic features of major significance. The proposal will result in the removal of some existing canopy. However, the site will be re - vegetated and there will be less bluff impact. j. The slope restoration and stormwater improvements will be aesthetically compatible with the area since the grading and re -vegetation of the site will improve the site aesthetics. k. The slope restoration and stormwater improvements will not depreciate surrounding property values since the plan will improve the site and its impacts on the surrounding properties. 1. The slope restoration and stormwater improvements will meet standards prescribed for certain uses as provided in Chapter 7, Article III of the Chanhassen City Code. 5. The planning report #2020-01 dated January 21, 2020, prepared by Erik Henricksen, et al, is incorporated herein. RECOMMENDATION The Planning Commission recommends that the City Council approve the Interim Use Permit to permit grading, excavation and slope restoration subject to the conditions of the staff report. ADOPTED by the Chanhassen Planning Commission this 21' day of January, 2020. CHANHASSEN PLANNING COMMISSION 1m Steven Weick, Chairman gAplant2020 planning cases\20-01 chanhassen slope failure project iupTindings of fact.docx COMMUNITY DEVELOPMENT DEPARTMENT Planning Division — 7700 Market Boulevard CITY OF CHANHASSEN Mailing Address — P.O. Box 147, Chanhassen, MN 55317 Phone: (952) 227-1300 / Fax: (952) 227-1110 0 APPLICATION FOR DEVELOPMENT REVIEW Submittal Date: PC Date: CC Date: 60 -Day Review Date: Section 1: Application Type (check all that apply) (Refer to the appropriate Application Checklist for required submittal information that must accompany this application) ❑ Comprehensive Plan Amendment ......................... $600 ❑ Minor MUSA line for failing on-site sewers ..... $100 ❑ Conditional Use Permit (CUP) ❑ Single -Family Residence ................................ $325 ❑ All Others......................................................... $425 ❑� Interim Use Permit (IUP) ❑ In conjunction with Single -Family Residence.. $325 ❑ All Others......................................................... $425 ❑ Rezoning (REZ) ❑ Planned Unit Development (PUD) .................. $750 ❑ Minor Amendment to existing PUD ................. $100 ❑ All Others......................................................... $500 ❑ Sign Plan Review ................................................... $150 ❑ Site Plan Review (SPR) ❑ Administrative ..................................................$100 ❑ Commercial/Industrial Districts' ......................$500 Plus $10 per 1,000 square feet of building area: ( thousand square feet) `Include number of existin employees: 'Include number of new employees: ❑ Residential Districts ......................................... $500 Plus $5 per dwelling unit (_ units) ❑ Subdivision (SUB) NOTE: When multiple applications are processed concurrently, the appropriate fee shall be charged for each application. 0 Notification Sign (City to install and remove)...................................................................................................................... $200 ❑ Property Owners' List within 500' (City to generate after pre -application meeting) .................................................. $3 per address (_ addresses) Escrow for Recording Documents (check all that apply)....................................................................... $50 per document El Conditional Use Permit ❑� Interim Use Permit ❑ Site Plan Agreement ❑ Vacation ❑ Variance ❑ Wetland Alteration Permit ❑ Metes & Bounds Subdivision (3 docs.) ❑ Easements ( easements) ❑ Deeds TOTAL FEE: $1,032.00 Section 2: Required Information Description of Proposal: The purpose of the planned work is to repair landslides along a portion of the Minnesota Bluffs LRT Regional Trail that occurred in 2014. Property Address or Location: _ Parcel #: 259990600 Total Acreage: 7.22 Minnesota Bluffs LRT Regional Trail Legal Description: Sections 34, 35, 36 and 25, T116, R23, Carver County, Minnesota Wetlands Present? ® Yes ❑ No Present Zoning: Select One Requested Zoning: Not Applicable Present Land Use Designation: Select One Requested Land Use Designation: Not Applicable Existing Use of Property: Minnesota Bluffs LRT Regional Trail RICheck box if separate narrative is attached. Interim Use Permit Application Attached. ❑ Create 3 lots or less ........................................ $300 ❑ Create over 3 lots.......................$600 + $15 per lot ( lots) ❑ Metes & Bounds (2 lots)..................................$300 ❑ Consolidate Lots..............................................$150 ❑ Lot Line Adjustment.........................................$150 ❑ Final Plat ..........................................................$700 (Includes $450 escrow for attomey costs)` Additional escrow may be required for other applications through the development contract. ❑ Vacation of Easements/Right-of-way (VAC)........ $300 (Additional recording fees may apply) ❑ Variance (VAR) .................................................... $200 ❑ Wetland Alteration Permit (WAP) ❑ Single -Family Residence ............................... $150 ❑ All Others ....................................................... $275 ❑ Zoning Appeal ...................................................... $100 ❑ Zoning Ordinance Amendment (ZOA)................. $500 NOTE: When multiple applications are processed concurrently, the appropriate fee shall be charged for each application. 0 Notification Sign (City to install and remove)...................................................................................................................... $200 ❑ Property Owners' List within 500' (City to generate after pre -application meeting) .................................................. $3 per address (_ addresses) Escrow for Recording Documents (check all that apply)....................................................................... $50 per document El Conditional Use Permit ❑� Interim Use Permit ❑ Site Plan Agreement ❑ Vacation ❑ Variance ❑ Wetland Alteration Permit ❑ Metes & Bounds Subdivision (3 docs.) ❑ Easements ( easements) ❑ Deeds TOTAL FEE: $1,032.00 Section 2: Required Information Description of Proposal: The purpose of the planned work is to repair landslides along a portion of the Minnesota Bluffs LRT Regional Trail that occurred in 2014. Property Address or Location: _ Parcel #: 259990600 Total Acreage: 7.22 Minnesota Bluffs LRT Regional Trail Legal Description: Sections 34, 35, 36 and 25, T116, R23, Carver County, Minnesota Wetlands Present? ® Yes ❑ No Present Zoning: Select One Requested Zoning: Not Applicable Present Land Use Designation: Select One Requested Land Use Designation: Not Applicable Existing Use of Property: Minnesota Bluffs LRT Regional Trail RICheck box if separate narrative is attached. Interim Use Permit Application Attached. Section 3: Property APPLICANT OTHER THAN PROPERTY OWNER: In signing this application, I, as applicant, represent to have obtained authorization from the property owner to file this application. I agree to be bound by conditions of approval, subject only to the right to object at the hearings on the application or during the appeal period. If this application has not been signed by the property owner, I have attached separate documentation of full legal capacity to file the application. This application should be processed in my name and I am the party whom the City should contact regarding any matter pertaining to this application. I will keep myself informed of the deadlines for submission of material and the progress of this application. I further understand that additional fees may be charged for consulting fees, feasibility studies, etc. with an estimate prior to any authorization to proceed with the study. I certify that the information and exhibits submitted are true and correct. Name: Hennepin County Regional Railroad Authority Contact: Jessica Galatz Address. 701 4th Ave. South, Suite 400 Phone: (612) 348-2691 City/State/Zip: Minneapolis/MN/55415 Cell: Email: jessica.galatz@hennepin.us Fax: Signature Q Date: 12/13 119 PROPERTY OWNER: In signing this application, 1, as property owner, have full legal capacity to, and hereby do, authorize the filing of this application. I understand that conditions of approval are binding and agree to be bound by those conditions, subject only to the right to object at the hearings or during the appeal periods. I will keep myself informed of the deadlines for submission of material and the progress of this application 1 further understand that additional fees may be charged for consulting fees, feasibility studies, etc with an estimate prior to any authorization to proceed with the study. I certify that the information and exhibits submitted are true and correct Name: Contact: Address: Phone: City/State/Zip: Cell: Email: Fax: Signature: Date: This application must be completed in full and must be accompanied by all information and plans required by applicable City Ordinance provisions. Before filing this application, refer to the appropriate Application Checklist and confer with the Planning Department to determine the specific ordinance and applicable procedural requirements and fees. A determination of completeness of the application shall be made within 15 business days of application submittal. A written notice of application deficiencies shall be mailed to the applicant within 15 business days of application. PROJECT ENGINEER (if applicable) Name: Contact: Address: Phone: City/State/Zip: Cell Email: Fax: Section 4: Notification Information Who should receive copies of staff reports? 'Other Contact Information: ❑ Property Owner Via: ❑ Email ❑ Mailed Paper Copy Name: Applicant Via: ® Email ❑ Mailed Paper Copy Address: Engineer Via: ❑ Email ❑ Mailed Paper Copy City/State/Zip: ❑ Other' Via ❑ Email ❑ Mailed Paper Copy Email: INSTRUCTIONS TO APPLICANT: Complete all necessary form fields, then select SAVE FORM to save a copy to your device. PRINT FORM and deliver•to city along with required documents and payment. SUBMIT ECRM to send a digital Copy to the city for processing. SAVE FORM PRINT FORM SUBMIT FORM Chanhassen Landslide Repair Project Interim Use Permit Application Prepared on behalf of Hennepin County Regional Railroad Authority Prepared for City of Chanhassen December 2019 Chanhassen Landslide Repair Project Interim Use Permit Application Prepared on behalf of Hennepin County Regional Railroad Authority Prepared for City of Chanhassen December 2019 Chanhassen Landslide Repair - Interim Use Permit Application List of Figures Figure 1 Site Location Figure 2 UDAR Map Figure 3 National Wetlands Inventory Map Figure 4 Wetland Delineation Map Figure 5 FEMA Floodplain Map Figure 6 Public Water Inventory Map Figure 7 Water Table Depth Figure 8 Water Table Elevation Figure 9 Well Locations List of Attachments Attachment 1 Proof of Ownership Attachment 2 Landowner List Attachment 3 Construction Design Plans Attachment 4 Draft Specifications for Horizontal Directional Drilling Attachment 5 Joint Application Form for Activities Affecting Water Resources in Minnesota I Introduction This application is prepared to fulfill the City of Chanhassen Interim Use Permit requirements as outlined in the City Code Chapter 7, Article III, Section 7-35. The application is organized to correspond to each numbered item under Section 7-35 (b). Project Description The scope of the project includes landslide repairs on a portion of the Minnesota Bluffs LRT Regional Trail in Chanhassen, MN owned by the Hennepin County Regional Railroad Authority (HCRRA). Two areas will be repaired as part of this project — the north repair area and the south repair area. Project access will be from Highview Drive in Eden Prairie, proceeding southwest along the trail to the site, and also from Flying Cloud Drive through the Moon Valley Aggregate operated property (final access route through Moon Valley Aggregate operated property pending property owner authorization). Landslide repairs in the south repair area will include stabilizing the south slope, repairing the south culvert outlet area and constructing a new storm sewer and drainage ditch to direct water into the repaired area. Plans for redirecting the water were provided to the Lower Minnesota River Watershed District for review and comment on December 12, 2019. The response from the watershed district will be provided to the City upon receipt. Existing trail profile grades will be reduced with the embankment slopes regraded to less steep grades and finished with turf reinforcement mats. The existing damaged concrete headwall will be removed and existing riprap will be salvaged for reuse. The south culvert outlet area will be repaired with riprap, boulder cross vanes, and a stilling basin. Work in the north area will include removal of existing pipe debris, placement of riprap fill on north slope, and abandonment of the existing pipe crossing beneath the trail. Drainage will be rerouted from north pipe area via new buried storm sewer and lined drainage channel, which will discharge to the south culvert outlet area. 2 Interim Use Permit Application Item 1: The name and address of the operator and owner of the land, together with proof of ownership. If the operator and owner are different, both must sign the application. Contact Information Owner. Hennepin County Regional Railroad Authority Mailing Address: 701 4" Ave. S, Suite 400, Minneapolis MN 55415 Contact Person: Jessica Galatz, Project Manager Phone Number: (612) 348-2691 Email: iessicaa. alatzPhgnneoin us Alternate Contact Person: Kristine Stehly, Project Engineer Phone Number. (612) 348-6370 Email: kristine.stehly hennepin us Proof of ownership is provide in Attachment 1. Item 2: The correct legal description of the property where the activity is proposed to occur. All that part of a variable width strip of land in Sections 34, 35,36 and 25, Township 116, Range 23, Carver County, Minnesota, being former railroad right of way. Subject to existing public roads and highways, and easements of record, if any. Item 3: A certified abstract listing the names of all landowners owning property within 500 feet of the boundary of the property described above. The City of Chanhassen provided the applicant with a list of landowners located within 500 feet of the property boundary on December 2, 2019. Refer to Attachment 2. Item 4: Specifications of the following, using appropriate maps, photographs and surveys: Full project specifications are provided in the construction design plans as Attachment 3. Draft specifications for horizontal directional drilling (HDD) are provided as Attachment 4. Once a final copy of the HDD specifications is available it will be provided to the city. a. Proposed grading plan Refer to the attached construction design plans, sheet G-08 (Attachment 3). b. Proposed stockpile sites Stockpiling will occur in the areas identified as staging areas on plan sheet G-05 (Attachment 3). There is limited space for stockpiling material on the site. The contractor will likely choose to put any excavated material directly in trucks to export from the site and stockpile temporarily stripped topsoil on site. It is likely that material will also need to be imported and stockpiled at the site within the staging areas on plan sheet G-05 (Attachment 3). Imported material will include riprap, granular filter, and topsoil. C. The physical relationship of the proposed designated site to the community and existing development. The project site is located on a portion of the Minnesota Bluffs LRT Regional Trail in the Rice Lake area just north of Flying Cloud Drive. The project will take place on Hennepin County Regional Railroad Authority property. Two repair areas are part of this project — north repair area and south repair area. A gravel pit owned by Moon Valley Aggregate is located southeast of the south repair area. There are no other residential, commercial or industrial developments immediately adjacent to the north and south repair areas. Residential areas are located on either side of the trail in the northeast portion of the project area (Figure 1). The northeast portion of the trail will be used for construction access only. d. site topography and natural features including location of watercourses and waterbodies. The trail slopes down from the northeast towards the southwest with an approximate elevation of 880 feet at the northeast access point coming down to 830 feet at the south repair area. Topography on either side of the trail is variable but generally downward sloping. Refer to sheet G-08 (Attachment 3) and Figure 2 for elevation contours within the project area. Wetlands are located on either side of the trail along the access with a small percentage located within the construction limits (Figure 3 and 4; sheets G-05 and G- 06, Attachment 3). A small wetland is located northeast of the north repair area outside of the construction limits (Figure 4). A stream channel runs adjacent to the trail from the northeast. The stream channel is outside of the construction limits at the north repair area and flows under the trail via the south culvert in the south repair area (Figure 4). No other waterbodies are located within the project footprint. The site is not within a designated floodplain (Figure 5). A Public Water Inventory basin (unnamed) is located northwest of the access at Highview Drive but is not within project limits and will not be impacted by construction activities (Figure 6). e. The description and quantity of material to be excavated. Excavated material will include soil and riprap. The total estimated quantity of excavated material is: • Excavation —common (non -contaminated material): 19,990 cubic yards • Excavation — special (contaminated soil): 2824 cubic yards The trail lowering portion of the project will require extensive excavation and some of the material on the surface is contaminated. Contaminated soil will be exported offsite to an approved waste disposal facility. No new soil will be needed as the finished grade is much lower than existing grade. f. The depth of water tables throughout the area. Refer to Figures 7 and 8 for water table depths/elevations. Depth to water table is approximately 0 to 25 feet in most of the south repair area, 25 to 75 feet along the trail and, 0 to 25 feet in the north repair area. g. The location and depth of wells and buried garbage, water and fill. There are no public or domestic wells within the project footprint, refer to Figure 8. No buried garbage or fill was identified at the site. Item 5: The purpose of the operation. The purpose of the planned work is to repair landslides along a portion of the Minnesota Bluffs LRT Regional Trail that occurred in 2014. In addition to the landslide repairs, a new storm sewer and drainage channel are proposed to be constructed on the south side of the trail that will drain to the south culvert area. The south culvert will also undergo repairs. The culvert located in the north repair area will be filled and abandoned in place. 3 Item 6: The estimated time required to compete operation. Tree clearing will occur prior to the work required to complete the repairs. In total, construction time is expected to be no greater than ten months. Item 7: Hours and months of operation Work will occur within regular hours, starting no earlier than 7:00 a.m. and finishing no later than 6:00 p.m. on a daily basis. Work is anticipated to occur between the months of February and December of 2020. Item 8: A tree survey indicating the location and type of all trees over six inches in caliper. In a heavily wooded area only the boundaries of the tree areas must be indicated on the survey. A tree survey was conducted to identify trees over 6 inches in diameter at breast height (dbh). The area within the construction limits is heavily wooded. Collecting individual tree locations was not feasible given that the area is heavily wooded. Instead, a square measuring 2,500 square feet was surveyed in three different locations along the south repair area. On average, about 7 trees at or above 6 inches dbh were identified within the surveyed squares. Tree clearing will take place in areas as necessary within the limits of construction (Attachment 3) and will be avoided to the extent practicable. Trees over 6 inches dbh that are removed during construction will be counted and replanted at a 1:1 ratio within the construction limits during restoration as space allows. Some areas where trees will be removed will not be replanted due to new features being constructed. Refer to sheet R-03 (Attachment 3) for the tree replacement plan. Item 9: An end use landscape plan and interim screening plan for the operation period. The restoration plan is provided in Attachment 3, sheets R-01 through R-04. An interim screening plan is not applicable to this project. Item 10: The plan of operation, including processing, nature of the processing and equipment, location of the plant source of water, disposal of water and reuse of water. Not applicable. Item 11: Travel routes to and from the site and the number and type of trucks that will be used. Access to the north repair area will be from Highview Drive along the trail. An access road will be constructed from Highview Drive for truck and equipment access. An application for a right-of-way permit will be submitted to the City of Eden Prairie once the contractor has been selected and construction dates are finalized. The City of Eden Prairie permit is required to obtained authorization for constructing a temporary access route in the City of Eden Prairie right-of-way. The timeline for submitting the application in late winter/spring of 2020 and the application requirements have been discussed with the City of Eden Prairie. Access to the south repair area will be from Flying Cloud Drive via Moon Valley Aggregate property (pending owner approval). Equipment used will include a backhoe or similar excavator, small bulldozers, light bobcat(s), and trucks to transport personnel, equipment and material. Beyond the direct access routes into the project area, it is anticipated that most construction related traffic would use County Highway 1 and County Highway 61. Item 12: Plans for drainage, erosion and sediment control and dust control. No drainage will occur as part of this project. Erosion and sediment control best management practices (BMPs) are outlined in the storm water pollution prevention plan (SWPPP) included in Attachment 3, sheets C-05 and C-06. Item 13: A restoration plan providing for the orderly and continuing restoration of all disturbed land to a condition equal to or better than that which existed prior to the earth work. Such plan shall illustrate, using photographs, maps and surveys where appropriate, the following: a. The contour of the land prior to excavation and proposed contours after completion of excavation and after completion of restoration. Refer to Figure 2 for current topographic contours and refer to Attachment 3, sheet G-08 for topographic contours after project completion (regraded area along trail modifications). b. Those areas of the site to be used for storage of topsoil and overburden. The site does not currently contain much topsoil. It is anticipated that the contractor will strip what topsoil they can and stockpile it in the staging areas, but most of the topsoil used in site restoration will likely need to be imported. c. A schedule setting forth the timetable for excavation of land lying within the extraction facility. Refer to items 6 and 7 for a schedule of the proposed activities. d. The grade of all slopes after restoration, based upon proposed land uses, and description of the type and quantity of plantings where revegetation is to be conducted. Refer to Attachment 3, sheets G-08 for area that will be regraded and sheets R-01 through R-03 for the restoration plans. The construction area will be re -seeded using MnDOT approved seed mixes. Types of seed mixes are outlined on the restoration plan (sheet R-01, Attachment 3) with a total area to be seeded of up to 7.41 acres. e. The criteria and standards to be used to achieve final restoration as well as intermittent stabilization. Intermittent stabilization will be achieved with the use of erosion and sediment control BMPs. Final restoration will be achieved per the restoration plan (sheet R-01 through R-03, Attachment 3). For further information refer to the SWPPP on sheets C-05 and C-06 (Attachment 3). Item 14: A statement identifying the applicant's program to insure compliance with the permit conditions, method of response to complaints and resolving conflicts that may arise as a result of complaints. HCRRA will obtain coverage under the Minnesota Pollution Control Agency's General Permit for Construction Stormwater. As such, required inspections under that coverage will be completed and will serve as means to oversee compliance with the permit conditions. Conflicts that are brought to the Citys attention can be directed to Jessica Galatz (612) 348-2691. Item 15: Unless exempt under Minnesota Rules, an environmental assessment worksheet, if required by the city. Not applicable. Item 16: A wetland alteration permit, if required by the City Code, which shall be processed concurrently with the excavation permit application. Ajoint application form for activities affecting water resources in Minnesota was submitted to the U.S. Army Corps of Engineers and serves to fulfill the city's wetland alteration requirement. It is provided as Attachment 5 for reference. The application materials are supported by field delineations completed in 2015 and 2019. Delineation work was confirmed by the City of Chanhassen's technical evaluation panel, as noted in the attached application materials. Y _ ' o � •. •i �• t- , � .-7 r v� r '- ta.• r �{` wM4�t� � �z..�6r2�� deft c„r•.,,. • .� .+ t Rw,: j+a a. 8 +a. iu. E `1 y v Y"u' 7.`" ,: VITT dole`" •� •M1 •�•'' rc'�';i� �. $ • ���' �: "'.•�' . �? � la `a'SEdR� r •�t' �= `~•SRS �.� ;+iy,.e - _�� � 1 �•_, r- 1 t, �.. ,.-.; Is.=_ � •r irR-;F:•. , BMW « t,„ .. }. •� .r ,:t .,e '�"`... ���'� Its t" �y 41 x � 3 Y < ' , f •� 6 � Q�1 f�Qifl3 r &G� OV Olt M1Y i of i ' i J 4v`'�9IX�'J• 7 '� � :•1 ' <F ,a �J 1. '{ I Lci�f�i,l a c�a Minnesota Bluff Rivers �j Municipal Boundary ^� LRT Regional Trail public Land OConstruction Limits Survey Section County Boundary 0 0 700 Feet Imagery Source, NeorMap, ApM 2079 PEMCd J e.s • �1i e� v, PUBFd .a � Pioneer Tri, w1�1y�• V Q ` ya '�\ y" ��x•�'•"•t �C•1 1 ' ,�4aq A. fit'=•Y' Ohrbru�k r PEMCd 't: • A�y�1P .iS' cs�o I r Pr N 0 700 O Feet Construction Limits K Freshwater Forested/Shrub Wetland OPublic Land Survey Section Freshwater Pond L-1 County Boundary Lake Wetlands (National Wetlands Inventory) MFreshwater Emergent Wetland imagery Source, Near Map, April 2019 Bum M"s 9N L1UBH PFOIC PEMF _y�., All zz r � _ f _ Cf 2r I r. Construction Limits O ■�� Approximate Stream Channel rpt 0 100 LRR w Delineated Wetlands Feet Imagery Source, NeorMop, Apn12019 1 4 -k i� 5' 1*41 � e ir or ,�- At IP ~ ' ♦\tit Y. .,il. 1 qw 12 ib QConstruction Limits N 10, Approximate Stream Channel OMinnesota - K Delineated Wetlands 0 100 ' • .. .. - Bluffs .. SOONER:::=1 Chanhassen, Minnesota Feet Imagery Source; NeorMop, April 2019 FIGURE 4 r; a.. `y'�F.t Y Construction Limits O • —► Approximate stream Channel 0 100 •-. , ..- .. = BARR C�3 Delineated WetlandsChanhassen,Minnesota Feet Imagery Source; NearMap, April 2019 4 Y b / V F i r.� �i.�!a. � ,a � � "• u '' ' K,'y� 4, `�� � iice, �' � �• Y. ti sew ti - or it Y O Construction Limits O WETLAND DELINEATI • N MA Approximate Stream Channel NMinnesota River Culvert Pipe o 100 • • • • • , • • .. K Delineated Wetlands Feet Imagery Source, NearMap, Aprd 2019 � ZIP _�. '� "� vim, k• r. .s ate:` •�� .. �j vI t�� M. a ••ny , K z ��. '; •`.: � fir, V �}' ,�t�f' '� '� , " - t � 4 r LJ Construction Limits ` O D R • - Approximate Stream Channel . . 0 100 '•.. ..- .. BARR —♦ Culvert PipeChanhassen, Minnesota Feet ZFIGURE 4 Imagery Source, NeorMap, Aprd 2019 ( i - ; + ♦ � ,', f lig + ®' t'-• -. ' '. x" fes• =. r1 77, .i - ' ' ■ - Y .1 fir"' �� / . ti tly?yS1+9-+' � w r:1 f i y MM t � r M Carver Henn pine~ County C-ounty L) Construction Limits Public Land Survey Section Fr: County Boundary ^+�♦•`— Public Water Inventory Watercourses f Public Water Inventory Basins MP 116W RNG ON SEC 22 O 0 1,000 Feet Imagery Source; NearMop, Aprd 2019 v - 900--- `aeo B ❑r Por V, II f © I! / Note: N 0 700 G Water table elevation data is from the County Atlas Series, Feet MCarver County, Atlas C-21, Part B, Plate 6, Minnesota DNR OConstruction Limits hllllllllllllll > 10 t0 25 Imagery Source; NearMap, April 2019 WATER Public Land Survey Section >25 to 50•MinnesotaTABLE River Bluffs ELARRI___- County Boundary >50 to 75 Coun Bounda Reg • •'•StAilizatiti Depth to Water Table (ft) Surface Elevation (Carver Co., 2011) Chanhassen, Minnesota = 0 to 10 ",� 10 -foot Contour FIGURE 7 Attachment of Ownership - Hopkins 57 54384 Authorization No. 7246 �I DEED t10. 86511 7 f Page 1 of 4 Pages THE GRANTOR, CHICAGO AND NORTH WESTERN TRANSPORTATION a Delaware corporation, whose principal offic9 is located at 0 \ inCOMPANY, 0 0 165 N. Canal Street, Chicago, Illinois, for the consideration of HENNEPf 1) o O c G o TEN AND ;i0/100 (E]O.`'Jj DOLLARS, conveys and quitclaims to subdivision ' 1 Y COUNTY REGIONAL RAILROAD AUTHORITY, a Minnesota political 2400-A Government �• N 'q��jand local government unit of the State of Minnesota, interest in the Center, Minneapolis, Minnesota 55487, GRANTEE, all Counties of Hennepir owing scribed real est .te situated in the de r� r�foil h eland Carver, and the State of Minnesota, to wit: 1 1 1 HENNEPIN COUNTY, MINNESOTA 1 N Strips of land of varying widths be1n0 part of Grantor's located 1n the O o"f railroad right of way frons Hopkins tc Chaska including :11 of !I n' o Cou'ItY of Hennepin, State of Minnesota, other real property associated i� S Grantor's rights of way and ith, not previously conveyed and not excluded and -tl:e r ew the h located over, Begicnnisng at tlo n the following described)) laands, to Excelsior Avenue in the Southwest Quarter of Section line of 19, Township 117 North, Range 21 Hest of the Fifth Principal Southwesterly and continuing 0C Meridian; thence extending the following described sections: o`•1 across p vl 117 NORTH, RANGE 21 WEST OF THE FIFTH PRINCIPAL MERIDIAN TOWNSHIP c' G l,r Section 19 - Southwest Quarter 141 TOWNSHIP 117 NORTH RANGE 22 WEST OF THE FIFTH PRINCI?AL MERIDIAN �30� ^ 13 0 j9 Section 24 - South Half of the Southeast Quarter the Northeast Quarter; (�4� o o 11 G 4• Section 25 - Northwest Quarter of Half of the Northwest Quarter G 1 i North Sect l or. 26 - East Half of the Northeast Quarter; Government Lot 2; tl. N Lot 4; Government Lot 3; Government d Government I -OC 1 Section 27 - Southeast Quarter of the Southeast Quarter the Southeast !\ Section 34 - Northeast Quarter; West Half of Half of the Southwest Quarter D. Quarter; East t] • TOWN SII IP 116 NORTH RANGE 22 WEST OF THE FIFTH PRINCIPAL MERIDIAN ti- P•( m Vf r `} tv N e4M Section 3 - Northwest Quarter the Northeast Quarter part \Sect ion 4 - Southeast Quarter of is described in Certificate of Title of which •,>. +» No. 49402; East Hal fWestthe t he Qua Ha HalfSoutheast Southeast N Section 9' - Northeast i g souQuarter; Quarter; thwest Quarter Section 16 - Northwest Quarter East Half of the Northeast Quarter; Southeast ! d. Section 17 - Quarter; Southeast Quarter Of the Southwest _u,;, M quarter _ 0 0 0 0 Section 20 - Northwest Quarter - Quarter of the NortheastQuarter; 0 0 0 0 O o o Section 19 Southeast nt North Half of the Southeast Quarter; Go i M r}�rst l N Lot 3 •� Section 30 - Government Lot 1; Government Lot 2; Northwest i N Quarter of the Southwest Quarter. � N N CARVER COUNTY, MINNESOTA v '. Strips of land of varying width being part of Grantor's Chaska located in the I railroad right of way from Hopkins to Minnesota, including all of M µ 6` 91` County of Carver, State of OGO�- 7 f Page 1 of 4 Pages DEED NO. 86511 Authorization No. 7246 Grantor's rights of way and other real property associated therewith, not previ,,-sly conveyed and not excluded and excepted herein, a'1 as ''gated over, across and upon the following described lands, to wit: TOWNSHIP 116 NORTH, RANGE 23 NEST OF THE FIFTH PRINCIPAL MERIDIAN Section 25 - Government Lot 3: Southeast Quarter Section 36 - Northwest Querter of the Northeast Quarter; Northeast Quarter of the Northwest Quarter; Government Lot 3; Government Lot 4 Section 35 - South Half of t,e Northeast Quarter; South Half of the Northwest Quarter; Northwest Quarter of the Southwest Quarter Section 34 - Northeast Quarter of the Southeast Quarter; Northwest Quarter of the Southeast Quarter i thence continuing Southwesterly across the Southwest Quarter of the Southeast Quarter of said Section 34, Township 116 North, Range 23 West of the Fifth Principal Meridian to Grantor's Milepost 32, '-ation 1157+40, being a line drawn at right angles to Grantor s original main track center 11 n at a point thereon distant 1,245 feet Southwesterly from its intersection with the North line of the Southwest Quarter of the Southeast Quarter of said Section 34. All according to the Government Survey thereof. Together with and including all of Grantor's right, title and interest in "as is" condition as of the date of this deed, in and to all bridges and culverts (but not trackage, signal and communication facilities) situated upon said real estate. Subject to: (1) Roads and highways, if any. (2) Covenants, easements, conditions, and restrictions of record. (3) Rights of any government agency, public or quasi -public utilities to occupy said premises for the use and main- tenance of existing cnnduits, sewers, drains, water mains, gas lines, electri, power lir^s, and other utilities, whether or not of record. By the acceptance of this conveyance, the Grantee, for itself and/or its heirs, successors, transferees and assigns, hereby agrees Page 2 of 4 Pages DEED NO. 86511 Authorization No. 7246 to, at its sale cost and expense to take all steps necessary to comply with any and all governmental requirements relating to the conveyance of said real estate, including land suodivision or use requirements and payments for any a..d all transfer taxes or other taxes and fees inci- dc.:tal to the recordation of the deed, except for documentary stamps. In the event Grantee fa 11s .o comply with any such requirement. and Grantor is obligated so to comply, then Grantee shall be liable for all torts, fees, expenses, interests and judnments against Grantor, and the same shall constitute a lien against said real estate until full pay- ment by Grantee. Further, this conveyance is made upon the express condition that the Grrator, its successors and assigns, shall ha:c the right t enter upon the above described real estate, for a period of ninety (90) days (weather permitting) from the date of this conveyance or until June 30, 1991, whichever is later, within which to remove all railroad tracks and appurtenances thereto, or any signal and communication facilities from said real estate and adjoining real estate. After said removal, Grantor will make the necessary repair of street, road and highway crossing surfaces. The Seller certif l es that the Seller does not know of any wells on the descrlbud real property.______.. .. .. _ ..�._,'....n __. .._ FTATI' DEED Tu DUE mluox ��� AND PRIOR TARES PAID KPI Of VaOHnttUCarf.UlltaeaMios C, V. FILED NOT REQ, 0 TRANGFER ENTERCD �-/ pzyE}ty :,L\ry FiDFiBT" r1' ]C= Fig 27 1491 1 FEB p! , 1991 Iq DEmO rl:: 're 02/29ril 6:5i4M 1-A'.0 tr;: 'n. 33 mppm/w "jury MINN. �V(PUn' DATED this 20th day of December 1990 . Signed, Sealed and Delivered in CHICAGO AND TRANSPORTATION NORTH RCOM WESTERN Presence of: ,(Lc4Yf y�Ehl r � B y kiik Ly Attest 0'r, .. �a3�Jf iTlt�.• Page 3 of 4 Pages STATE OF ILLINOIS) COUNTY OF C 0 0 K SS 1, RICHARD S. KENNERLEY, a Notary Public duly commissioned and qualified in and for the County and State aforesaid, DO HERCBY CERTIFY that RICHARD 0. TAYLOR an^ ANNE E. KEATING , to me personally known and known to me to be, respectively, Vice President. and Assistant Speretary of CHICAGO AND NORTH WESTERN TRA14SPORTATION COMPANY, a Delaware cnrporation, and the identical persons whose names are subscrib,;d to the foregoing instrument, appeared before me this day in person, and being first duly sworn by me, severally acknowledged to me that they are, respectively, Vice President and Assistant Secretary of said corporation; that as such officers they signed, sealed and delivered said instrument in behalf of said corporation by authority and order of its Board of Directors, as the free and voluntary act and deed of said corporation, and as them own free and voluntary act; that the seal affixed to said instrument is the seal of said corporation; and that said corporation executed said instrument for the uses and purposes therein set forth. IN WITNESS WHEREOF, 1 have hereunto set my hand and affixed my official seal as such Notary Public, at Chicago, Illinois, this 20th day of December orla.Ls L wcK s. WeNuY "Tr wsac"AT1orn1"M M' o mol W. sou, a. I", , 1990. Noty Pub in and for the of look, In the Stat of 11 nois RICHARD S. K NERLEY My Commission Expires: November 8, 1992 CC A ,/•' v:: a,; Icrit snuuel NCnneP.7 (ovw ii ,C�eg�eo� % .a:•; / ora/.0.. {/re rr'r/y Sou//ra�eaf S{�cef Lare/ MP/s, r/ ss467 oa/k (1,Yi,/. -We 763 This instrument was prepared by ,Chicago and North Western Transporta- tion Company, 165 North Canal Street, Chicago, Illinois 60606. L-101-17 Page 4 of 4 Pages jCl 5754381 ,-SFES9115 39 C5754384 coN $5.00 26FEB9115:39 C5754364 DOC $10.00 1 crit L'iL(A;Alw P. I. CEA177flrL;N9 CQ 51 FEB 28 FM 3: U ".-u�N��754u8�1 U ,r4M� U..FLUSCIN Attachment Landowner Chanhassen Landslide Repair—Interim Use Permit Application LANDOWNER LIST- provided by City of Chanhassen 12-2-19 PIN TAX—NAME TAX_ADD_Ll TAX — ADD _L2 SITEADD 254090030 MATTHEW 1 CHRISTENSEN 10 PIONEER TRL CHANHASSEN, MN 553178627 30 PIONEER TRL 257560410 JOE MORRISON 100 8TH AVE S UNIT 106 HOPKINS, MN 55343- 10029 TRAILS END RD 253350020 SUSAN V RECH 1000 HESSE FARM RD CHASKA, MN 553189520 1000 HESSE FARM RD 257560390 TINA RISCH 10005 TRAILS END RD CHANHASSEN, MN 553174594 10005 TRAILS END RD 253350030 JOHN D & BARBARA 1 FORCE 1001 HESSE FARM RD CHASKA, MN 553189527 1001 HESSE FARM RD 257560130 CHRISTOPHER & MICHELE AJ FAZI 10012 TRAILS END RD CHANHASSEN, MN 553174594 10012 TRAILS END RD 257560400 DANIEL JOSE 10017 TRAILS END RD CHANHASSEN, MN 553174594 10017 TRAILS END RD 253350010 PAUL W & SUSAN M ALLEN 1002 HESSE FARM RD CHASKA, MN 553189520 1002 HESSE FARM RD 257560140 JUDY E MANEY TRUST 10024 TRAILS END RD CHANHASSEN, MN 553174594 10024 TRAILS END RD 257560150 STACEY M BURROUGHS REV TRUST 10036 TRAILS END RD CHANHASSEN, MN 55317 10036 TRAILS END RD 257560160 MICHAEL KANE 10048 TRAILS END RD CHANHASSEN, MN 553174594 10048 TRAILS END RD 257560420 HEATHER HOLLAND NEUBAUER 10053 TRAILS END RD CHANHASSEN, MN 55317 10053 TRAILS END RD 257560170 MATTHEW T KEEN 10060 TRAILS END RUN CHANHASSEN, MN 55317 10060 TRAILS END RD 257560430 WILLIAM & ELIZABETH PETA 10065 TRAILS END RD CHANHASSEN, MN 553174594 10065 TRAILS END RD 257560180 CHRISTOPHER & ERIN WETMORE TRUSTS 10072 TRAILS END RD CHANHASSEN, MN 553174594 10072 TRAILS END RD 257560440 PAUL A & SHERYL A CARLSON 10077 TRAILS END RD CHANHASSEN, MN 553174594 10077 TRAILS END RD 257560190 SCOTT ANSETH 10084 TRAILS END RD CHANHASSEN, MN 553174594 10084 TRAILS END RD 257560200 DANIEL W ABERCROMBIE 10096 TRAILS END RD CHANHASSEN, MN 553174594 10096 TRAILS END RD 257560500 SETTLERS WEST LP 10096 TRAILS END RD CHANHASSEN, MN 553174594 9841 TRAILS END RD 257560210 PHILIPPE 0 SCHWOB 10112 TRAILS END RD CHANHASSEN, MN 553174593 10112 TRAILS END RD 253300100 RUSSELL A LEIGHTON 1R 1025 HESSE FARM RD CHASKA, MN 553189527 1025 HESSE FARM RD 253320160 MARY E BRIOL 10377 HEIDI LN CHASKA, MN 553189516 10377 HEIDI LN 253320270 MICHAEL PARADIS REV TRUST 10421 BLUFF OR CHASKA, MN 553189534 10421 BLUFF CIR 253320230 BEVERLY J ZIMMER 10440 BLUFF CIR CHASKA, MN 55318 10440 BLUFF CIR 253320250 SCOTT A LINDBLAD 10441 BLUFF CIR CHASKA, MN 553189534 10441 BLUFF CIR 253320240 WILLIAM N DECOULOS 10460 BLUFF CIR CHASKA, MN 553189534 10460 BLUFF CIR 257420120 ELIZABETH M VOGEL REV TRUST 105 PIONEER TR CHANHASSEN, MN 553178660 105 PIONEER TRL 253300110 KEVIN E & JANET S WINTER 1075 HESSE FARM RD CHASKA, MN 553189527 1075 HESSE FARM RD 254090010 BRYAN & ANGELA MALONEY LIV TRUST 108 PIONEER TRL CHANHASSEN, MN 553178659 108 PIONEER TRL 253300120 NANCY MADSEN REV TRUST 1101 HESSE FARM RD CHASKA, MN 553189526 1101 HESSE FARM RD 250360700 BEATRICE I ZWIERS IRREV TRUST 11111 DEUCE RD ELKO, MN 55020-9591 220 FLYING CLOUD DR 250360200 MOON VALLEY AGGREGATES INC 11111 DEUCE RD ELKO, MN 55020 100 FLYING CLOUD DR 250350800 GORAN PUDIC 1161 BLUFF CREEK DR CHASKA, MN 55318 1161 BLUFF CREEK DR 250350700 ALAN LJONGERIUS 1190 BLUFF CREEK DR CHASKA, MN 553189515 1190 BLUFF CREEK DR 253300140 LEO RICHARD DEE & KAREN COUGHLIN DEE TRS 1201 HESSE FARM CIR CHASKA, MN 553189518 1201 HESSE FARM OR 253320260 MAREN DVORAK 1221 BLUFF CREEK DR CHASKA, MN 553189515 1221 BLUFF CREEK DR 253300150 BRIAN JAY BIELKE 1225 HESSE FARM CIR CHASKA, MN 55318 11225 HESSE FARM CIR 253250050 JEFFREY M GOOD 1231 BLUFF CREEK DR CHASKA, MN 553189515 1231 BLUFF CREEK DR 253250040 THOMAS GNANAPRAGASAM 1251 BLUFF CREEK DR CHASKA, MN 55318 11251 BLUFF CREEK DR Chanhassen Landslide Repair—Interim Use Permit Application LANDOWNER LIST - provided by City of Chanhassen 12-2-19 253300160 MAUREEN ANN GRAllINI TRUST 1251 HESSE FARM CIR CHASKA, MN 55318 1251 HESSE FARM CIR 253250030 NICHOLAS WARITZ 1271 BLUFF CREEK DR CHASKA, MN 553189515 1271 BLUFF CREEK DR 257980010 P R KELLY PROPERTIES LLC 13991 KENSINGTON AVE NE PRIOR LAKE, MN 55372- 550 FLYING CLOUD DR 250350500 HEIDI R MOE 1425 BLUFF CREEK DR CHASKA, MN 553189515 1201 BLUFF CREEK DR 3.01162E+12 JOSH & JULIE TAYLOR 1510 MIDWAY LN GLENVIEW IL 60026-7792 19018 VOGEL FARM TR 250351810 SKIP S COOK 15506 VILLAGE WOODS DR EDEN PRAIRIE, MN 55347-1439 10551 GREAT PLAINS BLVD 250250800 WILLIAM C GRIFFITH 185 PIONEER TRL CHANHASSEN, MN 553178660 185 PIONEER TRL 250360100 RILEY PURGATORY BLIP CRK WS 18681 LAKE DR E CHANHASSEN, MN 55317 3.01162E+12 RYAN & HEATHER ZICK 18936 EXPLORER TR EDEN PRAIRIE MN 55347 18936 EXPLORER TR 3.01162E+12 WESTON T & LARUA K ROPER 18945 EXPLORER TR EDEN PRAIRIE MN 55347 18945 EXPLORER TR 3.01162E+12 GREGORY & COLLEEN WEBER 18948 EXPLORER TR EDEN PRAIRIE MN 55347 18948 EXPLORER TR 3.01162E+12 MICHAEL & CARIN VIERTEL 18957 EXPLORER TR EDEN PRAIRIE MN 55347 18957 EXPLORER TR 3.01162E+12 RANIA DOUBAL BACHOUR 19042 VOGEL FARM TR EDEN PRAIRIE MN 55347 19042 VOGEL FARM TR 3.01162E+12 JEFFREY V & JENNIFER I JIOVANAllO 19066 VOGEL FARM TR EDEN PRAIRIE MN 55347 19066 VOGEL FARM TR 3.01162E+12 RICHARD J & SUSAN 1 LANAHAN 19090 VOGEL FARM TR EDEN PRAIRIE MN 55347 19090 VOGEL FARM TR 3.01162E+12 WILLIAM & PATRICIA BARTRAM 19114 VOGEL FARM TR EDEN PRAIRIE MN 55347 19114 VOGEL FARM TR 250362500 RUSSELL BARTO II 1969 WOODSTONE LN VICTORIA, MN 55386.9639 410 LAKOTA LN 250362900 DAN & VALERIE TESTER 230 FLYING CLOUD DR CHASKA, MN 55318-9532 230 FLYING CLOUD DR 250363300 STEVEN JON & ANGELA S SMITH 240 FLYING CLOUD DR CHASKA, MN 553189532 240 FLYING CLOUD DR 250363200 MAX LAUREANO 250 FLYING CLOUD DR CHASKA, MN 55318 250 FLYING CLOUD DR 259990600 HENNEPIN CO REG RR AUTHORITY 300 6TH ST S SW STREET LEVEL MINNEAPOLIS, MN 55487-0999 Null 250362020 RUSSELL & YVONNE BARTO 400 LAKOTA LN CHASKA, MN 553189452 2503624001 RUSSELL J & YVONNE L BARTO TRUST 400 LAKOTA LN CHASKA, MN 553189452 400 LAKOTA LN 250363800 MATHEW JOHNSON 415 LAKOTA LN CHASKA, MN 553189457 415 LAKOTA LN 251300050 KEVIN FALCONER 425 LAKOTA LN CHASKA, MN 55318 425 LAKOTA LN 251300040 WANDA SYNSTELIEN 445 LAKOTA LN CHASKA, MN 553189457 445 LAKOTA LN 250360710 CHARLIE D HAZZARD 450 FLYING CLOUD DR CHASKA, MN 553189533 450 FLYING CLOUD DR 250363100 ALVIN R LEBENS 460 FLYING CLOUD DR CHASKA, MN 55318 460 FLYING CLOUD DR 250362800 MICHAEL S SPIESS 470 FLYING CLOUD DR CHASKA, MN 553189533 470 FLYING CLOUD DR 251300030 DONAVON GLOUDE 495 LAKOTA LN CHASKA, MN 55318 495 LAKOTA LN 250350111 STATE OF MINNESOTA- DNR 500 LAFAYETTE RD ST PAUL, MN 55155-4045 251300020 ECO REAL ESTATE HOLDINGS LLC 510 PLEASANTVIEW RD CHANHASSEN, MN 55317 535 LAKOTA LN 258490010 MARTIN K & KATHLEEN M SCHUTROP 540 LAKOTA LN CHASKA, MN 553189453 540 LAKOTA LN 251300010 HEATHER LYNN SILVA 565 LAKOTA LN CHASKA, MN 55318 565 LAKOTA LN 250362210 CHRISTOPHER R KNUTSON 575 LAKOTA LN CHASKA, MN 553189455 575 LAKOTA LN 250362200 JOHN C SCHWANKE 595 LAKOTA LN CHASKA, MN 553189456 595 LAKOTA LN 250361300 608 FLYING CLOUD LLC 608 FLYING CLOUD DR CHASKA, MN 553189502 608 FLYING CLOUD DR 250362220 JAMES A & BONNIE B SWANSEN 615 LAKOTA LN CHASKA, MN 553189455 615 LAKOTA LN 3.01162E+12 HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY 7014TH AVE S SUITE 400 MINNEAPOLIS MN 55415 61 ADDRESS UNASSIGNED 3.01162E+12 SETTLERS WEST HO ASSOC - COMMUNITY DEV INC 7100 MADISON AVE W GOLDEN VALLEY MN 55427 61 ADDRESS UNASSIGNED Chanhassen Landslide Repair — Interim Use Permit Application LANDOWNER LIST - provided by City of Chanhassen 12-2-19 3.01162E+12 CITY OF EDEN PRAIRIE 8080 MITCHELL RD EDEN PRAIRIE MN 55344 61 ADDRESS UNASSIGNED 250351710 HAGEN LAWN & LANDSCAPE LLC 850 FLYING CLOUD DR CHASKA, MN 553189503 850 FLYING CLOUD DR 3.01162E+12 MARK W & SUZAN R KAMMER 9600 HIGHVIEW DR EDEN PRAIRIE MN 55347 9600 HIGHVIEW DR 257420110 JONATHAN P & JOANN DIMINO 9751 MEADOWLARK LN CHANHASSEN, MN 553178826 9751 MEADOWLARK LN 3.01162E+12 KARL REYNOLDS & CHRISTI HART 9800 TRAILS END RD EDEN PRAIRIE MN 55347 9800 TRAILS END RD 3.01162E+12 THOMAS A & KELLY A HOPPER 9805 TRAILS END RD EDEN PRAIRIE MN 55347 9805 TRAILS END RD 3.01162E+12 KRISTA A HAYEK & PETER N WHITE IV 9812 TRAILS END RD EDEN PRAIRIE MN 55347 9812 TRAILS END RD 3.01162E+12 MICHAEL & AMY RUETZ 9817 TRAILS END RD EDEN PRAIRIE MN 55347 9817 TRAILS END RD 252640160 NATHAN H GRIFFITHS 9821 DEERBROOK DR CHANHASSEN, MN 553178550 9821 DEERBROOK DR 3.01162E+12 JEFFREY HOLM & JENNIFER EKEREN-HOLM 9824 TRAILS END RD EDEN PRAIRIE MN 55347 9824 TRAILS END RD 257560010 MICHAEL & CHRISTINE M MANNO 9836 TRAILS END RD CHANHASSEN, MN 553174591 9836 TRAILS END RD 252640150 TRUST AGREEMENT OF RICHARD & CATHERINE M 9841 DEERBROOK CHANHASSEN, MN 553178550 9841 DEERBROOK DR 257560020 DANIELS LAUN 9848 TRAILS END RD CHANHASSEN, MN 553174591 9848 TRAILS END RD 257560300 SCOTT LAUERMAN 9853 TRAILS END RD CHANHASSEN, MN 553174591 9853 TRAILS END RD 257560030 SARAH J BREIT 9860 TRAILS END RD CHANHASSEN, MN 55317 9860 TRAILS END RD 252640140 ANN K LONSTEIN REVOCABLE TRUST 9861 DEERBROOK DR CHANHASSEN, MN 553178550 9861 DEERBROOK DR 257560040 JASON BURLAGE 9872 TRAILS END RD CHANHASSEN, MN 55317 9872 TRAILS END RD 252640130 JOHN M & LINDA 1 REVIER 9881 DEERBROOK DR CHANHASSEN, MN 553178550 9881 DEERBROOK DR 252640120 RYAN & COURTNEY DUNLAY 9901 DEERBROOK DR CHANHASSEN, MN 553178552 9901 DEERBROOK DR 257560310 A JEFFREY KARSCHNIK 9905 TRAILS END RD CHANHASSEN, MN 55317 9905 TRAILS END RD 257560050 JARED JOHN GRUNIG 9912 TRAILS END RD CHANHASSEN, 1N 55317 9912 TRAILS END RD 257560320 ELIZABETH A FARRELL 9917 TRAILS END RD CHANHASSEN, MN 55317 9917 TRAILS END RD 252640110 KIRK D HEISSEL 9921 DEERBROOK DR CHANHASSEN, MN 55317 9921 DEERBROOK DR 257560060 JASON EMMETT 9924 TRAILS END RD CHANHASSEN, MN 55317 9924 TRAILS END RD 257560330 LENNART J JOHNSON 9929 TRAILS END RD CHANHASSEN, MN 553174592 9929 TRAILS END RD 257560070 WILLIAM J ROUSE 9936 TRAILS END RD CHANHASSEN, MN 553174592 9936 TRAILS END RD 252640100 ROSS L HABBEN 9941 DEERBROOK DR CHANHASSEN, MN 55317 9941 DEERBROOK DR 257560340 JON FRANSWAY 9941 TRAILS END RD CHANHASSEN, MN 553174592 9941 TRAILS END RD 257560080 STEVEN C KIMES 9948 TRAILS END RD CHANHASSEN, MN 553174592 9948 TRAILS END RD 257560350 ROBERT G DAUB REV TRUST 9953 TRAILS END RD CHANHASSEN, MN 553174592 9953 TRAILS END RD 257560090 XIANGDONG LIN 9960 TRAILS END RD CHANHASSEN, MN 553174592 9960 TRAILS END RD 252640090 JENNIFER M PALMQUIST 9961 DEERBROOK DR CHANHASSEN, MN 553178552 9961 DEERBROOK DR 257560360 CHRISTOPHER C ATTERBERRY 9965 TRAILS END RD CHANHASSEN, MN 553174592 9965 TRAILS END RD 257560100 JAMES DOBCHUK 9972 TRAILS END RD CHANHASSEN, MN 553174592 9972 TRAILS END RD 257560370 STEVEN R PASCHKE 9977 TRAILS END RD CHANHASSEN, MN 553174592 9977 TRAILS END RD 252640070 PAUL TAUNTON 9980 DEERBROOK DR CHANHASSEN, MN 553178551 9980 DEERBROOK DR 252640080 JIMMY M & MARY E ROANE 9981 DEERBROOK DR CHANHASSEN, MN 55317 9981 DEERBROOK DR 257560110 RANDALLS & MELODEE D BROOKS 9984 TRAILS END RD CHANHASSEN, MN 553174592 9984 TRAILS END RD 257560380 MATTHEW J WILLIAMS 9989 TRAILS END RD CHANHASSEN, 122E9 TRAILS END RD 257560120 RICHARD BARBARI 9996 TRAILS END RD CHANHASSEN, MN 553174592 9996 TRAILS END RD Chanhassen Landslide Repair— Interim Use Permit Application LANDOWNER LIST - provided by City of Chanhassen 12-2-19 256010020 PCH DEVELOPMENT LLC PO BOX 94 ISHAKOPEE, MN 55379 110520 GREAT PLAINS BLVD MINNESOTA BLUFFS LRT REGIONAL TRAIL LANDSLIDE REPAIRS HENNEPIN COUNTY REGIONAL RAILROAD -Riii,FT wt �HTL S�_o9IMry Li. 1 PLAN PR E L LOCATION HCRRn =E --is RN -1 1 MINNEAPOLIS. MN (HCRRA) .41 TRLE SHEET. RLWELi LOCATION, AND SKEET IN. D. LEGEND NOTES. MOREVIATIdiS ANDALIONL£NTCONIROLMTA Od STATEMENT OF ESTIMATED ODAMITIES . SUE ACCESS, STAGING, AND 1MFFIC LOMRW OVERALL PIANO NOTES ODS SITE ACCESS...". ANO TRAFFICWMROL� PLANS GM SITE ACCESS, STAGI NGAHOIRAFFICCOMROL-PI.W ANDOETMLB So TRAIL CLO&HIR E MONAOE EAST OF LANE RILEV G40 PROJEOT IAYOOT PLAN CM FASTHO CONDRIONSPIAN CM "I CONDITIONS PHOTOS CN REMOVALS AND TEMPORARY ER OSION COMROL PL CM TEMPORARY EROSION CONTROL DETAILS CN STORM WATER POLLUTION PREVENTIOH PVN IEWR"II Op STORM WATER POULTON PREVENTION PIAN ISWPFPI Cdi ....TRAIL MODIFICATIONS - PVN AND PROFILE SAS TRAIL MODIFICATIONS - CROS. SELTION9 Cd TRAIL MODIFICATIONS LROSS RECTIONE 610 TRAIL MODIFIWTION9-T FTCA-SECPON9 411 SOIRNAILEA SLOPE REPAIR -PVN 41] SWM AREA SLOPE REPAIRSECTIONS 419 SIXTH AREA COLVEM DOTLET.WO STREAM9AKK REPAIR PVN 41A SOUTH AREA CONVEY OUTLET REPAIR � PROFILE ANO SECTICN4 415 SOUTH AREA CULV W WRIST REP.MR, SECTIONS AND DETAILS C.I. 9TREAMSWH REPAIR - DETAIL 411 NORTH MU MOPE REPAIR-PLW C.I. NORTHARU MOPE REPAIR P.ZU SECTION, ANCCETAIL GIS STORM SEWER AND ORAWAGE CHANNEL � PLAN AND PROFILE MID STORM SEWER AND ORAINAOE CN.VNNEL SECTIONS ANO OETARS UV STORM9EWERANODRAINAOECHANN.I.-SECTIONSANG DETAILS no SEEDING PVN p42 EROSION CONTROL SVNNET AND MULCH PIAN R40TREE F VNTINO PVN So REST.. ON DETAILS GENERA NOTES. DATA FRLN�MJRVEV CWDYCTE BV SOUPMgINEERIWE COEIN MSUAM]OIL,OUV EUSVEV DONSOCTED SV STONERROTE IN JAMMRV NH9 AND MOLAR MI UDAR TOPOORAMY 9 IMMERV,COW5 RCIOMETIV INRRINTWMLCM ANONENXLFNCW111V. MNNESONA MIB. J. IKR2WNAI DANNMIOLCMOXAtEEVSTEM. EMVERLWNIVCR'RIMNRTG. N9MNARN UR RURYLV fEEi. l VERMALMTUN MVDA PROJECT MN — IW — EMIBTXGMRFCMOJR RANTNG INTEMECATECdROUR — - - -- E%WTNG PMCEL LME —« Ew¢nHNBTONMRELKR — W FF45TIp FlRERCpTF — � M."', RXCE MHE ® MIRTIMOWIBENVATONEMEMENT — E%RYAN STREPMTNLNEO --'—'—. ES SO NO STN EPM EMTENTS —W— EIBSTNONEILPXO IRM C4NSTRUCTM MMrte —RD— PRYSdEDINDRRCO?WR PppCiER NTERIJEWTECNTOM —«— RRMCSE.SOMMSENER —a MWSEDRXCE CI-EARINOLIMrtB YTiEXCE MN, MIdCBECRNR•P MONS. RI41Lp MG CRY' I. wNRO 0-, I.STACHS. ETM 0 «L xCMEOLECRNO GRT.T AM SM EMIXO ABBREVIATIONS CE COM BREW CATER., CLEM CpRRg1EDLPVeIRCMOfXMATERMN OMP CVMAL.M.METALNF! CLNC. !L CYICRETE ItEVRT KY RES PLMIOwDRECTON I . INVERT ILORATIOX W ttC PROM RM LI... DEPARTMENT OR TRAMPoMATCEN XMMAL NNRR LML RCP REINFORCED CONCRCR NPE IRM NRR REMEOLCIMENT WT CNPA LM1... 1PIPE •RCN SYMBOLS LIY?R PI RRTM1W M�� ANSY x laxrnl� RME�� s SECTION VIEW CALL OUT EA1Nx /aRIIIR (nP.J SCALE` I RECTION: GRAPHICS STANDARDS �x gym) SECTION VIEW TITLE ARIL /aMl!(YR 1 carA�:iwe.s DETAIL NEW CALL OUT wars IaR/nM tool CETNL ORMNIGB BTANOM05 RMinR/vu nnu.ur (MA) GENERAL NOTES. I. CCMRA'TM SHALL LCGR AND MLD VCRRY ALL EAIBTR LTRU1E3 PRIM TO ABBY ALL EMBITHO ROAM, PMRRR LOTS. TRAILS. BORE, OR SIMILAR SHALL NOT ME OISNRKDDUPIMCagiRUCTM CONTL MSHA11000RDINATESUMEYS MAIHTHE ENOMEER T] DOCUMENT PREtMST1UCTON ERIBTIW CMDrtICM ISSUES S CONTRACTOR SHALL INSTALL AND MAINTAIN ALL EPoSIM CMTROL SAM PRIM TO COMPRENCEMENTOFORAM'S FOR EACH LOCATION DURINOWAATRUCMN EROSION CMTip PLAw B MWICEOIXSIDETME PROJfCi STMMIMrtR WLVTNMI PREVENTd PLAN ISVNPPI 4 COEINUCCTON USIMRSMNM ME MMpXRMTE FIXNCOYAIEEIa1LIMLBTJ BE N RDVAMME DINNER MOSTANDDINTHE MELD. NUCdw TOa PERFO MEDONLY ANTRIM M• SN0UMRB AND .1. ROUTES UNLESS OTHERNESS MINCTED R EMINEEP OEESBECLEA UMLLBENMMEDIXTIERELOBYEIRINEER. ALLTREa+•S'M q T H EM LSXALLBEPROf ED. TREES OEMIFlED BY ENOINEER PM AC A. PROTECTOR SHALL BE PROTECTED SONNET ROM COMPACTION, DAMAGE AND CAROMEMENT IN AGCdOWCE NTN AMOCO PEC ER PROTECTGNMTREESIRFIMWIFIEDTOBEREM DSNMIR INUDENTAL S CYITIACTMSNALLTMEPREUIRCNSTOMINIMEETIETUN I"IAOUTAND TERRfRRIAL I.. Sap. T) ME MABLE M ERC. PMSRE NJGNMEWCONTROLDATA TRAIL MODIFICATIONS CONTROL DATA -ALK IMENT T T116TR RMTEMOB B RMRNgRMWI rtMfCYFTNR CIMIN] LCXTM RKCM "A. RRArI MRRAIIOM ENDRORfXNB EN)WTW YTRN HS MN, HEIRS. SIMM. HISTRY -1.1 MONS. ISINAL. MA pA YqTENNNAI 1.11WRIM MY 80UTH MFACl1LVERT OUTLET AND STREAEIBANK REPAIR CONTROL DATA - ALIGNMENT'L" TFEMG R.WfrcRTYN RMETNORfMIp rcAReMY1O CCMnM L[MTM NAMM, PosmOvi RRATRN SIGNATOR eMDKRINR EMDwnW BORDEN AREA SLOPE REPAIR CONTROL DATA - ALIGNMENT" TYPLW. rtAR RRTq R•R NATIRID 1 RMI EbTN]OCAIIRR LEIRTM RAd.N PC OTATMN RRATRN eNDRATRM exowRXMG eMoeNnXO M+ m DRAINAGE CHANNEL AND STORM EEMR CONTROL DATA -ALIGNMENT VY TYPEIR. RARRATI ..RMTN]RMW RMTIMTM CCMNJ 11. RADME PCRATION RCT.. WDRA}IM! REM. IND. NNED. .11i MRSERAMS m. .11LI inA MANS 90% DESIGN 3 maw A HAPHNIN _ MUM � PDX2 HCRRA LHANHABSEN MN V D310T01R.0 Iw er • R C o 0 T Wlftfl m MINNEMOLIS. MN LEGEND, NOTES. ASBRENATIONS, RRNRRx DESCRIPnoN AND ALL CONTROL DATA STATEMENT ESTIMATED OUAMITIE• EO%DESIGN NOTEORCONSTRUCTON bVLnl M(MNOAIKN LIAV SIM 1 MINI .1.1. W1M WM 1 ]mtlm OGMYc ALR P!0 zmum GIIWXG AOX an ]lM.3m RMOhmxcPRE xFAOWNL EAa 1 iIa.39x RMovE PIEzaMEIG EKx x ]IOL.mI LIVAOEBEXN EAOI l i1MlYi RMYIEWWYPE]ANIHO WNL YNR Il ]IM.nI RMm2CXNNYXRiFME INR ]W ]NE,Sq MMWESEWMIIIF SioRM11NCXrX%PEI Y11R ) ]IGm] G4VMi NN00MMMPP NYII IN ]ml RMOVEMXELWIE0U50FMO1xPIMPNF GMN31 LYW 3UM 1 Ig xms.sa GmM11N 3xERIc sroEs nro uu ]IG.MI OFWPIFPNG LUMSUM 1 "NN,mI CONSIRY()KRS5PW0 IUMPSVM 1 L]IISM) PUVPTOX-SIECIN M. MIN ]IM.m) MYLPNYgSPOSF OF<gRNAIM)FDmX NYO 3m1 vmnl GuvAnox.canMox Nro M,RG ]IM.sb <OMMOH EMMNWENIiW NSO InF ]LN.W3 WBG400EPREPYIAtnN lNR ml] ]llp,n) ACLREMtESYRHIxONVIRN55PLO/1 Nro n NnSb WKMOUS3 COXIRIXI MfiN ff KAPEMRMYILVILIASSs NM In ]111301 COMSEAGYRW)E ROOIX41LV1 NVD E inf.ml 93'SPAX GS %RNXX NIWN [NN 1 3nI nI N'<ASPIRRMG! DCII 3 ]alms ]exME%N SEWEAaRRwxN•Num INR 9m 2..lP RLL.WOIBRNKNP•ENWMI INSr ll5 xsmml Llxlxc NLVFm PIRN3'YAMAEOLL IIXR 1 ]mLnE GEOIIXIILF RRE0. RNE SOro m .I'...I'..MX00MPIPIW [VSS 31[ON6NVAOD NSO N) ]SILm] M Gm]SENLM]% NYO 1M 331I.Sm MIEOCII MnMw(um NECuu1MfN SEO bu.n) MN00MPIMNR/SSN aro m ]Sfln] MN00M PIPWV CWSN NY0 Ib HI].501 MKIYMPRItER NYD ml nff.n) MMVGRxOMMWIMI aro ms 21U..PLKFBWmM EAN m .1.IMTMIMXIXYXRiEXCF INR Im illiW, Si)&LQm[OXSMU[M1X FVf lVK3VM ] ]S1S.m3 SILL RX[E,1WEM5 IINR IOA]] l52574,W? <OMMOX)OPSpI WNWN30 Isn 31]5.X4 FPONLX f.ONIRMMWRRGILOGM3X M5T N'Ml xsls.sN EMNNEcaxcPErE aFGGU MIr sero un ]315.'YM 1MEMMMCFREM Wr GiEOORI SOro ]•m n. sssN 33Rsm MWIXG I 1 h I 3 „ lo 7"T® vx GE9GNRIGX _ = _ _ _ _ A• C 0 1]� m H_ RA 7MINNEAPOLIS. MN LANDSUDE REPAIRS s3mmfa Ga GXANHASBEN, MN STATEMEMO ESTIMATED QUANTITIES G-03 D WLCN MMERML]rRl nro KR m,9w 1At xorwaRu xxsn,xm�u,aes w,.oEo..�c.uE.e w�xwxem f` 4375 vmrtlivea���n�nrt mun712 TWFC SIGNS .EBr`w. s w. A.I %1\ PIANOVERM I RCCESS PLW m R7COESIGN .w AVTPoR CMMS7RL " ------LANDSLIDE REPAIRS ]3,OIDu.w NC.RRA CHANHASSEN. MN M,,,p • 0 c '6EaEll MINNEMOIIS. MN SREACCESS. STAGNG. PNDTRMTIC CONTROL RENBox c[ m OVERALLFLNJ AND NOTES Ga D .EBr`w. s w. A.I %1\ PIANOVERM I RCCESS PLW m R7COESIGN .w AVTPoR CMMS7RL " ------LANDSLIDE REPAIRS ]3,OIDu.w NC.RRA CHANHASSEN. MN M,,,p • 0 c '6EaEll MINNEMOIIS. MN SREACCESS. STAGNG. PNDTRMTIC CONTROL RENBox c[ m OVERALLFLNJ AND NOTES Ga D Z.--� ' \7' F�i ' I � � M . A~�• I / vfn \ tory � -� A •'>M I ^. • y � .rs:y �11 PLAN $IEACCESS I STAGING- "�em�woncwo cae wser� 2 111T -111—- _ _ ®L mm�mcrcx �wmam�v�cKxem 0 NA `newvwwuomomn�iti✓Re 0 � nmruEcwa�m[an ewe Adv MPtltARY T >e^01T .H FI JNIG6 z vuvvix[ f'ewcr[vb-vat TABlf1 w+ I `�¢OnwmuwP I O 1 eRW m ova 0 u �m ej4 RAi RIIFjTUMINOU3 TRAIL RESTORATION �. �FfgRY v��reawce wrtxw u aaEc rro yr ovaEn HCRRA cNANNAMN ... MINNEAPOLIS, MN SITE ACCESS, STAGING,G, AND TRAFFIC CONTROL PMEN PWA AND DETAILS \ j ITTIL -1 1-1 ----------- --- - -- --- --- // --I MEN, - aznmrcE r M1ER9p1 IRREV iPYei -- f..Pcn.wem.r Y---- l /� h. MJCM VALIEV i MitlllNR PLAN�� PLAN P� � u iIITT. NCRRA MINNEMOLIB. MN LANDSLIDE REPAIRS CHANT WEN. MN PROJECT LAYOUT PLAN W% DEEM 'I - »TIP.E,,,NF" iii �•`P \ \.���.� I:. _ `Pan aznmrcE r M1ER9p1 IRREV iPYei -- f..Pcn.wem.r Y---- l /� h. MJCM VALIEV i MitlllNR PLAN�� PLAN P� � u iIITT. NCRRA MINNEMOLIB. MN LANDSLIDE REPAIRS CHANT WEN. MN PROJECT LAYOUT PLAN W% DEEM 'I carRperuurw Xvo� ' 0 n. 4 1 crurxux. ienruevrcX rMMNE9TP 11K Rf IM PEGILNN 1Mrl �(\ fy M - vunxo�vnr \ [aienrcneax renccirelf �n em %IEEtwamanoE[rcml `Eivdrtwxonxflxwec vqu �arr /• .. cmnwcreuruxxe / HSEPSM rxavv iPllei j ' Q[XERI1 hTFd ee X �/ r[rnMwi[oer [wound wrtuownu / MSIII VIrLIEV / IOWfMR r / n / / 1 FIAM BOES WBeINONOITI NDT GpRIGY If CONSiR1,CipN LANDSLIDE REPAIRS231010AM CHANHASSEN, AN EXISTING CONDITIONS A e o aPLAN C-01 O EVIS]N R6 RITI[M r, y PHOTO T EXISTING SOUTH PIPE OUTLE 101X40191 pryOTO 5. EXISTING NORTH PIPE DOWNSTREAM OUTLET (LOOKING DOWNSTREAM) PHOTOS EXISTING S0UTH PIPE OUTLET I1W192919) yi e� }:✓ .ice. I� 1 PHOTO EXISTING S0UTH PIPE OUTLET(4OS10191 PHOTOO'.EXIETING SOUTH PIPE OUTLET 110298019) PHOTO 6MSTING NORTH PIPE UPSTREAM INLET)X/16"119) I51F11 i DESnN NOi WRO0.45MTRIN LANDSLIDE REPAIRS �3lmma-W HCRRA CHPNH455EN, MN .,. 1.1, 3 0 MINNE UL15, MN EXISTING CONDITIONS neWgXCf9LgIPIMXI PHoios w1 D' BLWI Ll gEWpULTRMt� 3 TO, 7 -'FO '1 1 \ II i i I >� '- -Ar�- _ - / ®M mexmw,wxrtxcs 1 a -om D, x �\ ; — .,IF, -- — —_ IF rru- F.een 1 IF DIE°mo w 1. FAx ,.D..tx, O.,. / ---- FIF—vwvvs mmem CHANHRSSEN.MN 11-03 xe MINNEAPOLIS. MN REMOVALS CENTEMPORARY 9 E C 0 ] EflOSION CONTROL PLPN C-03 D / / / Mopr vnLlEr j A�oPewTE P N. MOVA ANDTEMP R RY EROSION CONTROL auaL..Em Q mmem CHANHRSSEN.MN 11-03 xe MINNEAPOLIS. MN REMOVALS CENTEMPORARY 9 E C 0 ] EflOSION CONTROL PLPN C-03 D .,o.,HT.,,,, u iMueniq} awv /y noxorzc�u J DOWNSTREAM VIEW ' ro,u SECTION VEW • DIED PEOPMENT BLE, IP � TO � HENDE EDBEDIF ELB BIT HENCE SHOULD BE ETHADDID OTT A BEFFIBB PH I I E IDE I'D HILL DO DIDTHEDI THE EVIDTIT T� 111 • DBEHED BEDDED BEI NEFEETEEP BIBI BEEDHE AT TWIT APEOPETIO TO TILDE FETAL P� THE TIED 101T OF THE SECOBTO NEOLIT NUID THI — TOTT OF THI FRIT PENCE /l\DETAIL SILT FE E -MACHINE SLICED T MOTION VIEW TITER ILI' DEPTOID—L IF IL-11 TME( \ DETAILINLET PROTECTON-SEDIMENT LOG rT I,OTI.LE "EMENT LOT VIET TO DIDE, It. y� ROAD PEI SIDE NEW ON SLOPE FRONT VIEW NM SIDENEW FIAT imausmmsx— FILDEDoxIaxms is PIEVEEWD— TOP VIEW / w.wW BE euimmw. °)4/ E�RIAILSTAMLIIEO CONSTRUCTION EXIT eirE HCRAA MINNEAPOLIS. AN ETFFOTEFDEI .�.o sTnaw.,..E...dw�oedEnddoon,,,o �m..dEwo.nE wruauaITw,d, nolmeEnE BE VOT THEN ONE WE. _—DIDINDETHIPFE.P.—D—METHEETTING LANDSLIDE REPAIRS CHANHASSEN, MN TEMPORARY EROSION CONTROL CETAILS M oEsm PMLi N 10 lR,ET POPE, AND R - THIS 9TORMMTER PoLLMdJ PREVENIWI PLAN TEMPPI IRB YEN PREPARED IN COMIJA1Cf N1MTNE MMNE50TJKNERRL FLEW REDFNTVRE $NEU NUMB SigIMNAT A PERMIT FOR CONSTRUCTION ACT11 M MMMXQSEENERAL PERNRI. M REWIRED BY THE MINNESOTA FPdER LOCJ.TCH ANO CONSTRUCTION LINKS DM POLLUTION CONTROL AGENCY NAME) UNDER THE NATIONAL POLLUTANT NSC MARIE ELIMINATOR SYMNESTATE COMBAT EXI DEG AND OETHIC F DUDES AND ALL FINAL OWNER LOLLING CRESTA AS EEA EMPOWER DR1. LEAVING RBTEME 55W)4M,41AUI9 SYSTEM IXPMPRWPAM ITS 0. ENTERING A SURFACE WATER THE PROJECT 15 LOCATED IN THE CITY OF CHANHASSEN CAREER COJNTY. MINNESOTA PROPOSES CONSTRUCTION ACTIVITIES BOIL TYPES AT THE BXE OW PILL TAKE PLACE ALONG MD JUST SWIM OF ME MINNESOTA BLUFFS REGIONAL TRAIL REPSYSEN FLYING CLAS ROM MO • LRADOME OFIMPNVWB SURFACES CGE,DIRLIR LARYNX LANE. THE DISSONANCE CEMRpDCF THE P O WDI HIM A LATITUDE M 4 SIpWJ AND A LOXdTUY OF M WINES MIS PROJECT IXWLUES ERCEXM CONT Q -REPAIR AND A,.W 64NLBUCE DAMNED MULES. REPAIR CF DAWYD CULUhR21MTALLATMM6idLN9EVhP MOMAXMOfB MOBRE RE9TMATFFI TXEPROJERMMOPMEDNMATONAL MTURNACEARFPCF7RACMI EP091ON PPEVENIKKL MO9EOIMEMURJTRIX MENVRl9M[REDVNESIOMININW RECRUNINT FROM BRITD (X101 WFF CREEK, VMICN RAN IM ANSONNTER REFERS MdEtT DIA'M EST PoR NRMfR YCSWPERMIT PAR I11 81ZE AE_UNUUTVE IMPNV TES BV,RFML. gXIIGIPATEOMNCi DISN0.NNCEVA`P=AUATELV ]S] ACRES THE EA OF ME LCNSTR UCTM W NVI W S APIA 16 APPROX IIMRLV 0 A ACRES ME TOTAL AREA OF FVSTCWBTRUCTON IMKRNWB AREA IS ARMOKIMADELYO M ACRES THE TOTAL NEW IMFERVW9 AREA 19 APPROXIMATELY S ACRES MTESOFCd9MUCfKN. •MICIFAECXTAT.% TW AWYQPATES EXO NTE: TWO 19.�4MR i XFMWTOX' AGAMETE.XENMPX THATH RIONM'K MILRMDANXMITV CORING APERSON OD AMAVE. B. FYA ACIPEP9 MINUMI TELE MdECi MANAGER PHONEAMT:IelLMASOi1 EMAIL PROJECT. JESSICA.MLA1ZgXEWEPIN US XALTERNATE ONEM MC TILT PERSON NNTM SiEMv TITLE . FXOICCi BARNETT BER'. M12]3MEITI EMOILIODREES TNESTENLYINEXSPMW CPEMTDI IGEHERALCMTRALL W CT RTMfRYEMIRIMESgTKNM NNE SN9PR. TBD MAILMOAOMESS CONTACT PHONE NUMBER TRE. HMILMOREM. PASTY REB%N61BLE FOR LCRDTER M CPENTIOH AS IMIXIEMAHCE M IS P!R MMEM 9T NIMW TER MANAGEMENT SYSTEM. XENMPX COUNTY REGIONAL RESPOND AUTHORITY .11. ACCAESS. Al AM AVE. S REST CONTACT PERSON JENIG MUTZ TTE. PRdCCIwMERM PIQUE NUMBER: IRY W]O1 ENA, ILMEN: JESICA.GPUAZ EMAPR.U3 ]0 PCCIMMVMTEP9. WA. RRTLMNIXMEMIYINWESTRMOMUNEDBiAN OTIMETMELIMLYMRECEIMSTMMWOFRRUNOFTMCNTM PROJECT 9REIC9W PfRNR IDM S. HE INCWR. BRIDAL IMFAWEO WEEK WATER MIT WON _nI WATERINA OIn WAI II MATEP>w ELUP MEEK QUARK ' .NC ED YFa XD REI CAKE uY M.M NO XO O 111 EA EXHISERE. ..X PHO..11M.CKCANNOWDS. IAXZ. EY. RNER \Y 1]I R 60VMH OW, NMT NOT Y gVELABLE FLRALLWAHIS POWER USE THE SPECIAL AND IWAIREO MAYOR SPARCNTCIX AT MrtP91ANWJfSA.9TATl MH Y&WARR9TRWNTERSRGKAMDIMPAIREDVMRRBdNRCM OR REFERTOOSYMPERI9ESTCE 9.IIMEPCO VMTERFMME KlIL1NNG N.LVTE191M BMEBdIDT PHOSPHORUS ON AQIEHT EPCCXAQUATIC FACTA � d ICA INMCIMTCNBLUSIC �RBI S[98MEE,SXCEDMIJOSIHNSI ANDAWATC ANCR WERTENATEMroIX, BINE6EERAOST EMD FEES IN E D WATERS WITINME MILE jEW ML RADN9 MEASUREMENT) OF ME PROJE IMPOSE 3 AMOUT AND IMPAIR ED MATERS ECT SHE IS fi GRE EX IW ANED TO SPECIAL EPA MAWE01WAMNS IT RR TU RMCM AN D REX MOTA MESE IMPERMEMrt ME CONSIDERED CONSTRUCTOR RELATED ANDR 0 IRE PEMIONAL MST ]AMBCTW]]I�CTICES ESSEX ON PLAN REVIEWM iCOMPLIANCE MYTH ME OEMML TpHMAI BMP9 M OMCR ePFCIFIC CMSMN CTKN RELATES IMFLFNEEATON ACTVITET IR MTIFDS I N AN ARTOSLO TOTAL UM DAL M(IM%IIMUVYIMWT:ZC9iXDLVATNRI OFEKPORI AREARMDCMSMUICFKKI CRA TE.PMAPVA6EDMEMATKNNSILAFMWM MMNMELOCATIONTMIMVf MARNNTMEMMMEAME9.IWW PER Mi OENE131 om[Boig T-TMPRYJECTREBNTINCWMVAMPINNI WSTEM.IMW PIRWTRENTIII ACE'MISPROJECTD NOTmcLUMNETWHDIMPMT9 PEMRMM24IM210,MDSg T Nnl jA IMARONNEEALRMIWMOOMERREWIPED RPWErEgN RMAgRR N,X,W,X MEASURES ARE NT REWIREDMA NRURMtW.ON OMERHLOCAL, STAIR, ON FEDfYLLRR EVER CON QUOTE D FOR TRE PROSECT . IECTV CIESPER NET TIED 29100ICAL 2 AND .1, ]a KSSTMEASR pE MNOYMTEN eK WNWEMEE MEM: MN ANCESCT DOES NOT INCLUDE MV XAMTON MMKNIOMMTER SORRY HMNMEH.4MMCM ICdW GNMR IrtM91S1P, IEA, MOIEIq LOCATIONS CE ARES NOT BE Y DETERRED IE O.. SUPER]pJES WEI ETCI ODIU.N.0 LOCATIONS OF AT BAR OF STEEP SLOPES GIX,4dL1. 0 D"NECONTRpH NEXT LIXATEMS OF NEAR VAIN E CONSTRUCTION LOLLY PM9ED TO MINIYOU WMTCX ME A PIXL umTuxP ........ wnlnw rv.c.�c.vv...v.. .........,.....��.... ....�..�� MORE INRWANCE REQUIREMENT INSTALL ADMpXAL UPoRATEM BEDIMCMCONI 9glg PORTIONSOF XHE SITE OPEN TO A WTH ENR WORK IN VASTER N[ PRECTV BMM TO THE OWALOADNO AND AMEND THE BWTPP TO MO NED YEPUBN SWATER RESTRICTIONS ETHAT LOCATION CF ALL TEMPORARYAND PERMANENT VERNON M08EDMEMCANTRM CSE SS TIRE [ 9dLe RE PERIMETER COMROL9 TEMPORARY SGL LITOD E9 .1 BER WRRWXR00T P'IIME SEES ASW0H T9 AND IEMROVIX IB B VEOETATVEM NMNFOELATVE BTqdIPATWMPYINONUICXMOTxER WXNEYTAIivE M9YDISMPV.MIMME BREACH. MEA RI SEDIMENT ROk MEASURES eW.LLXMYPdG[D MI.NSILT OF EPEPNR 9.1 TUR• Ib REOYIREDIHFPERNrtS11EN 17 D0 Cd.41AGN VuiENGR MLEFOR IN MI BUFRR60PeV WRESB.Iq OE POTENTIAL MkLUTNOENERATINO ACTMTIES IYNIIPES 1. I'M' LOCATNNY IC CCE.G1441p > STORE H MAIN INLET PROTECTION (CITY FIRST RES B T AND B BI ET PROTECTOR BMP WILL BE INSTALLED AROUND ALL STMN MAN IMUI WAMMIREM6 9ECTIO11] NOR ERMAN AND SEDIMENT CORRIX&ARE TO Y INET ' CQE WLBTRUCTIORACTIVITIES. SMTMN MAIN IXLE .1S PROTECTED UNTIL ALL BWYEB WTI PONS. BOR DBGMAQNQ ATNDARDT THE EDETNLS OIROSA A RPPACIHS N1LlYWEOiONIxIMIZEOEROBNM PT[MNL. MCMLETMVEMEXSTAIOSEO IXLETMCTECTIONEENS LLf BEOPENTCDrtACLUCH RLRRBOW. MEWIVAICM •EASEEMETH NNACYCES TREND "AACpNG MST l YEPOLE IMPS: MAX PERMIT RES B I I AND B I]) ARES TO BE NETWE SWRMO CONTROL M,S TSOR TLE9NILl MEASUNP£D WRX ALCM ISUCXS9TRAW NULM, ERCENM S. TEMPORA RNMETS LE EONVgLENT MNSMEB TEMPORARY TE STOCKPILES DEFOUDONEAST CDCAWT CENTS TCUV,OR dMANCCp1PCNE END THE CLEMI NOWEQUATEKIT KITESBASE COMLES ONENTS OF EXAMS. PA KIND STOCKPILER SURFACES ES ME FROM MNE STABIIYATOXPOREOUREMENTS PAR KIND Ld3, AND MUSEUM BUREALE3ARE EXEMPT R. E STANIPATMMDTCXANDS LEMS EDPERIMETSR9.ICAWPERMITEMRRTHEREC 41 1 BTEe V OXIFTH CHANNELEROSION CCMRIX TOMMY,EFMR NXF REINFTHEYEALLBE ORCEMENT .1 OR PE OUTLETS WILL K MOM£0 WITH DIAMOND, M EQUIVALENT MEASURE. A al, Lwln•vvvrvvv.. e..v........ �.�. ... ....______._._..__ LMRBOILERSI(MI VMfHEVERRMCAN9MVCTNMI ICTIVIn MABKRMRMXRVMTENRRM[V ON MY PORTON W THE ERE AND WILL XII RESVME WR A PCMOO EXCECDMS H p. USE OF SEDINEATXMi0.EAMENi MCNIGW E.O., EIGPAED M PART CE M E P. ICI 10EN PERMIT 1. C]] AND 9181 CEASED CARMAR MK S. IF ME IMPOSED SOIL MEAS MAIN TOXd3CXARR PONT THAT R LMIMM M[ MILE ISRIAL RADIUS 0 'HE PROJECT WILL NOT INCLUDE TOM NOW g FIDE OF D18NRY06OL DEMAND TOA WMWN YN OR E OR ME ACRES OFFERING TO A CdMOLLOCATICH PADEN I ARE CIA A SPECIAL ON 'OCATOM NPERMWATERMNEFMEiEMPORMYeEDMEHT IASIS MEXd REOURE.INWFERNrt REME MEMURENEEIOFAMECIALM IWAMEONVTER(ACCO BECTON CIO. STANLWTIOM OF EXFp[O 90, MNBIIHCLVDNB BTOCNPLE9IPILLBE IXITATEIMMEOIAIELYiOLINRBdL ER08XNl 91AMDRIOANOBERIONE, WHEREAS ANY CONSTRUCTION ACTNT A FEPMMENM1Y OR TEMPORARILY CEIAN M MY PMTCHOPTHE SITE ANDINLL NTRESUY FOR ANNE. EMCEEDINO]CFEPNWH MVS. IM TIEPIN ANN ¢SM OPEHINO. RWATMISMBMIX OYAINIIq W1LLIXCVRMPARi CETXB MEFIXL0.N TNIT1ESU 8B TANEXNIN.IATI.Tg.L.TEH PREPPMOTHEECILFOR , dECi 1WW RR RBECTON IYAXO FLEMISH VEOETATVEM NMNFOELATVE BTqdIPATWMPYINONUICXMOTxER WXNEYTAIivE M9YDISMPV.MIMME BREACH. MEA EH DESIGN FARMS'. MEFIXLPNS BYP SEEMSEEMFACTORS NAVE YWN6IYRNMY3gNING111 PXWUCITOMEEXPo9E09dLMF.A NOTIONAL EROSION MR NTCN IRESURN. ME FIXL[MMO ACgTNRUL EROSION PREVERWH BE RUSTMENRD AT MS SITE DURING CMBTFI KW.IEW PERMIT DISKS 63, 0], AND TVI AN09EdMEE<GTFO.BME 1. XMECTE�NUCTNT' FREQUENCY, MINORITY AND DURATION FPRECIRTATNON. OTMM PILL METHODS 1019X5 tlBiUPBAxCE NILLXMHNQEOMMIFEVER PM9IME LOAIOIH CRO BION EFUENHON R EVER POSSIBLE TO L I Mrt NFW WeDL MOMV9 ]. ATURE ATERUNMFANDRUHd ATME6RE WGNOFSTWSBLOMXSEXRCTED R0.VIROM INPERVpU88URFACM ROPER M09R[DMMMEFEANRNE PEAKU9�TRFAMBW TOIATEN IM E EONPIVEOETAESITUTE MFFERB SCENE LFPMEO TMMURPANDiOEM NIMIEE AHX[LMAND ANDCSCYJR IN MI RESEEM FOLL E IL OH STEEP ELDERS x:IV1'MLL Y TABR¢ED VATS REDEEM CprtRIX CANARDS ESI DISCHARGE FRMS A. RMI M EDL PAPTWE HOUR CXRCTEOTO Y MOMENT OTEEdN3. xMIZOEAL SLLBE OMDS ARL BE STUNTO OMTENTIAERWNM fOTEHTIAL. OIROSA A RPPACIHS N1LlYWEOiONIxIMIZEOEROBNM PT[MNL. HCRRA MINNEAPOLIS. MN CHANTAMSEN. MN 9XIDESIGN AP US VEPEM 6idINAMTER w W.OEMEM eV8)EN O RfOYIREO IF LM! PRdfCi RfBVL)B IN dl! PORE OR MMf Cf SA IURSSURJ60VRFXCTAO11 THE BIXPNEi WAST OF A.,A FLA. GWCe,,MN, ION, MMOW TEN 15 3) 9VRFPCEBIN LOi4GIFT1! gRdCttlelMiOFP1Al10CP MXCFOEKLCPMIM.ICBW RRMR 12M 16)1 VAfSUNN IM BidNN.LTE I TE...eYBR MIR. RCWIREOM .I. M. N, REBIS, tENER AND Oj THE IB IMG LESS. RldItt NRX ACNP Rp,M WE.Y. ICBW MOST, RCM 1Efl UTHIS MdECT GOEA NOT GROSSNESS TOP TROUT REDEEM GO P TRIWTPRY TOP MOUT IT [AND HORAN MRMR TME 1 Sn �NR[[Cib PNor�X•wE Pow` IXIB WTN REOU REOTM XgNO TMIKOIHONdML9 MCLVR THO E PEAYES RESMNSIBLE FM INSTPLLIXO, BYPFRNBIEq, pE>PIRII INSPECTING ANOwINTNMOG EROSKKI PREVEMEX ANDS OMEM CWTR MMATTHESrt TRAINUDINDOIDULAISAIREMLOO FOXeIBLE AGE IMRMW R fMEATTHE MON" PCO/PHISHOMMOND ERHP DEENESTP HEO.ANOANOTICERATH OE GENERAL MOSTVOIIL RMINLTENIIDTXAR..XABUWITTEDTHE INSTRUCTION ACTINS AREMlElD H ERNKRNRRELtl 5.M SN ANGITISPNOeECTW )II THESE W48 WILL BE TRAINED X ACCORGHCE MY THE PEW REMENIB M ME GENERAL FERMR, R.L.. THE REQUIREMENT THAT THE CprtEM AND RUDEST OF TRPMNGWLL BE COMMENSURATE WFX THE NDV DML'S JM WTUS AND RESFIXA B Li ES MI ILET OFMORE FRAGMENT FOR MM PRUNI WE ME XXTNEIXiGNE AND ERRERIENCED IN ?INS APR ICN PREVENTION AND ANDREW CONTROL WM �yfY {j ORA xCplryp'ylpy�AL oe ME MEAN, UNwm.. �MII TEDD MEdCNN OKRNEHI CE 5NST,MPLEKMA TBD TOO ION. REV SON, ANDAMNExOMEM TEO FEREOPMPNCE OF SVNFPNSRCTNTM TBD TOO TOD KRFRMMANU OR OUNERVISICN OF TED GRY M ICN, MNNTEMANCE MO REPAIR CC CAMPS TANNIN) DOCUMENT. AVNLALLE UPON ..DO T $OVIXCY NOPEC GNB. ATRAHEDRBMWLLRONNELYMBPECTMEff TRf CpJBTpVCICN . T M T o—rloa uI PE • ATLMETON EEKRY)MRWR GKTNECOFO IIOH • WMNNWRSATRARMNF4LEVEXTWGTERMW05XCHEe NNMWRS NBFDQTM FREWI MAY BE PdUETE 0 UNMOOR ME EM LOANING ORCU MSiP�fS. *RE PARTS OF THE WNSTRUCTOEA NANe XPVEPERMNENiCWEP, WMXRIwINSOXdHMMUTS OF THE BRE, SPECT MS CF TME AREM WM PEPNANENi CtMEq wvBE RF WCEDTI pICI PCRNMH. MERE CWTRUCTION AREAS HAVE PERMANENT COVEN AND MI CONSTRUCT. ACTNRY IS MCURRMM THE BRE, INSPEC"'NB GN BER .S. TO GNCF PER MONTH AND, AFTER I) MONTHS. MAY BE BUSAINGOD CdRETELY LMR QLANTSLCTdP S PCTNRY BESIDE . W ERE CONSTRVCTEN ALTVIIY xp MEN SDMMDED OK TOINQUIN GROUND CONOrtpYS. THE eRCEXMS ASO S BUSMMMD THE REQUIRED INSPECTIONS AND MAINTENANCE SCHEOULE MUST MON WMM N HOURS AFTER RUNCEE COOLED AT THE BYTE ON VFOI RESUMING CpSTHUCTIIXI NNICNEKR COMES FIRST -LOSE REFMEENR IE.CMCdNiRUC11ON MORRMM.SRR SIDE MSRCTON WLL INCLUDE INSFECT2A OETIE LgMNS -I dI�W FERNRRCMB IS)iXROANIIIN A ALL EROSION FREKMIGI AND SEDIMENT CONTROL MAPS AND FIXLUTION PREVENTION MANAGEMENT MEASURE VATERS FDI EVIDENCE M EROSION AND SEDIMENT DEPOSITION : VC DMTD18rtEVENICLEEWLQ M8FOIMMKEOFCEFBRESEUMEWTOMW PEESMOOMERARBMVELExiITMERg FMEVICExCECFCFPDREALCVWJ OXDR BEpNINT ANDSPAG WLLM PERFdMDAS O WM NNCTDNAL ON%BY THE END BMNI RE..MON TARE PV4E RNY AMEEUWITHX TOTHEMEMP MMYBd4SEDMAREBULT OFTHE REARM ipX KLL BE DOCUMENTEDAB VYLL BE COMPLETEDBY ANAPPRWRIATELYTRAINEDINDNWPL CHANGES NVOLNNOTME USE Of A LEES BTRIIEEMBM> WELL INCAS A JUSTIEBODHON DINFOR BIND HONTHE REC4CEMENi BMP BS FECTVF FOR THE SITE CHAR TEINSDQS. E B 4LWWESTOD AVDNSPECTEX AND MAINTENANCE RECGM FELL BE AER AT THE BRE DURING COASTS UCTM BY THE ASGROTEE WM NAB WE... CCONITTRROL OF THE ATE THE BVNRR CAN BE REPTIN EITHER FELDCONCE OR M AN ON SITE VEHICLE DURING A RRECORDPLVFILAB ME EMBITTERS AUL MME THE BYAFP, INCWDW INSPECTION RETORTS, MINIS NRETMM�S UPON REQUEST FOR THE WR.OE ME FORMS AROANNOR END TRAINING RECORDS YANFLANNE TO COMPRAMTE µND Ip THREE YEAR. FOLLPxNO EURNATW, ]. S. Bo WNENRWERAMOP 1 TME KFAS gSNPBEO WAIXGCWSTRUCTG!WILL BE AT HCRRA MINNEAPOLIS, MN QUISINDASHERIETHE MUCHTPB MPENYEUSES MACEBORTHE WE OFTERMINATEN(NOO FORM WILL IS NBn•L .¢AL—ILEI Mr 1`WI d M V� CALL YOU LL 2AE ql qli. IdbiR I1M HANHASSEN, MN POLLUTION PREVENTION PGN RERIDESCAl W OftR W OR[T 0� W QAR tlw Aa e° w w ROm m m a ..A a .o m• w dm WWPiR Wf� 'tldt y a a no o �o m m tl• m m w Im Iw—a �i to—m\�� 3M w f f ` OMb m.l W OfBff em mmawmms.� � — f - m m m At wit m m .A no a n a a tl m m m a• `��° WpifR W6iHR w tem eem w w fT m w m - w m w w '4e m a a ..e o w m a a w• m a m w im 71 a m m m .w a .e m• q ed10 w W aFFeR '90 m m a .m a m m a tl a m m•• ped• rwo f W3�E} WCFFBeT w rwwx ® < m m n0 o io m m e0 -m s ,o - m m �� 'mm y a a .w 0 �0 m A tl m • A • N �m Iq �A im �q �s{m 6 naior NorconCoxsTRraN, E------- LANDSLIDE REPAIRS ° HCRRA CHANHASSEN, MN 33101014.p1 Lm w A 3 ` _ MINNE 01.15. MN TRAIL MCOIFIOATIONS x ACWkMI LEKRIRY.IN mm CR0555ECTIONS C-00 O naruT nwo nano Hann __ — s+oo o�Y 4 E m w —e m m m m a uo a +o m m n dY w+�LT ,mb f PoOROET m m m m +e 0 +a a w a `d10 ^'w saner a � naiKl 1+0 1Na Im m i m w 0 +0 ID a w i�o HCRRA CHANHA66EN, MN MINNEAPOLIS, MN TRAIL MOOIFlLATION LROS63ELT�ON6 90%DE&6N dM M memeei �e.e.,.. xml rtvdsYmYJ¢Mwurc[ wn bdewmm -im (q w;o TRAIL MODIFICATION RYPIM) - BTA 560 TO 7N5 wmwur erxonoe��r "crawuce I ` \` nrxcx PiiarcuMerwon[wrtwe Iwo \``` euendi wndT I'lle�,roewererniwrau 4TeWxa[nero �2\SECTION TRAIL MODIFICATION(TYPICAL( STA . H]S TO 5W MD STA 7+75 TO INM HCRRA MINNEAPOLIS. MN CHANHABBEN, MN TYPICALSECTIONS r�r ----r- .. - - - - LIEGEND 0 T�R.REIR.�ENExtM,T 1 PL IN SOUTH Ag25LCPE REPAIR i00% DESIGN NOT FOR CONSTRUCTION s•mx.enrenexrmwxrt 4-4 1nwLANDLDE REPAIRS HCRRCHAHASSENMN w uur ¢m3omxm_it.a,. w MINNEAPOLIS. MN SOUTH AREA SLOPE REPAR A• U O i PLAN G1t C RENB9N RM'I11PIgX — e %11 ECTION: SOUTH AREA SLOPE REPAIR X31 SECTION- BOU H TEA L PE REPAIR SEN, H Lis, HAREA LOPE MN.. MINNEMOLIB. MN SOUTH MFA TIONS REPAIR SECTIONS MIINESGII.Bi iI1 �s.NI NEGIGx4IPw ' ' -------------- .__ ' - / B rr _ � eM.mau..xncNwrho/ ' BN.�.,arwNBlrex,B1 P SOUTHAREACUVERTOUT TANOSTREAMBANRREPAIR BO%aesRw ux.wree, WTF0RCMTRWT0V --- — LANDSLIDE REPAIR$ 23101014W HCRRA CMM'HA53EN. AN MINNEMOLIB, AN SOUTH AREA CULVERT OUTLET MO STREAMSANK REPAIR PLM C.13 O w ceuRi _ — w.ww Wv..[q Mr<I] EEEEEEEI� ��� v SECTION' 6 REAM CHANNEL 130'8 TT MWIDTHI GSECTIONC PA VLVE $LI IINE PROFJE CULV£RTOUT T AND STREAM CHANNEL rc n n e m �.xmxr.�.weixeff. cex:�.�.rre�x.eei 90% DESIGN NOTFORC0.VSTRL �molmom LANDS cHANLIDEHA6sREPAIRS EN. MN z�1011 MINNEAPOLIS, MN SOUTH AREA CULVERT OUTLET REPAIR I C,14 %iDFILE MD SECTIONS ■l■■■ 4 • mil PROFJE CULV£RTOUT T AND STREAM CHANNEL rc n n e m �.xmxr.�.weixeff. cex:�.�.rre�x.eei 90% DESIGN NOTFORC0.VSTRL HCRRA LANDS cHANLIDEHA6sREPAIRS EN. MN z�1011 MINNEAPOLIS, MN SOUTH AREA CULVERT OUTLET REPAIR I C,14 %iDFILE MD SECTIONS -- a., ------------------------------- - sscnoN wewo vAm�.... \Evv+wvawVnra � PLAN VIEW ASIN HCRRA MINNEAPOLIS, MN SOUTH MEA CULVERT OUTLET REPAIR SECTIONS AND DETAILS J 90% DESIGN DONNA. AND IININD �.. 0.tN,T,4�Hv.N � . \; Fl, vn ..�...,DD.� N�+.R„I�.,:,, R%RIPPAP TOE PROTECTION 6 BO.DE51(N! NDT PpR CDNSiRULiION — r LANDSLIDE REPAIRS ^•^v�q m.�R m BAR R e NM HCRRA cNANNAssEx, Mry zamm+a oa - - — — — — . 11 11 MINNEAPCLIB. IN STREAMBANK REPAIR C G 1 iN, L 11lYlOCX ZBCRIPIIRI--- CETAIL I -------------� ------------------- 8' -- ------------ - „___ _____ d�nviw.ix.assainvax.�a � a� eEE®.uu. tdn —------------------- s lI ----------- \_-- T / \ En In�uuwdxr \\`,.eninxnivawnaa 1 PLAN NORTH PREA50P REPAIR s HCRRA MINNEAPOLIS, MN CHANHASSEN. MN M AREA SLOPE REPAIR P,AN BOY. OESIGM l Ll ,% a .w o y b do Q) SECTON- NORT AREA SLOPE REPAIR JTA pNJ lt> PROF LE NORTH AREA SLOPE REPAIR �.r! � �� QTD we•ruxn eavewnevm.yuw�. uvNaoe W----------. w -- �rMfaw.[da�lvwrm.em ; jow —amm„M M..e.,. 11 IP, ob.awr.Nwe 4 ^ .r"..."r�.wn~mm x`Y`.cw • awv.rwcwurr..e.y..weum k 6V.eeq/IOeOr1M �rwmn�bnmi � 1. „o ter„ a rW M.JMnWxp¢MRv�lnMrr. ra.e- mwa,vnrb,.r.wuemen !d\OE AL:\MEfENCE DEBIOM YNK C6A1® l Ll ,% a .w o y b do Q) SECTON- NORT AREA SLOPE REPAIR JTA pNJ lt> PROF LE NORTH AREA SLOPE REPAIR RCRRACHANHASSEN, MN MINNEAPOLIS. MN NORTH AREA SLOPE REPAIR PROPIIE. SECTION. AND DETAIL �.r! � �� QTD we•ruxn eavewnevm.yuw�. uvNaoe w r.uwvQID �rMfaw.[da�lvwrm.em ; ... m9D .. wuwwaw.rsb. ob.awr.Nwe 4 ^ .r"..."r�.wn~mm x`Y`.cw • awv.rwcwurr..e.y..weum k 6V.eeq/IOeOr1M �rwmn�bnmi � a rW M.JMnWxp¢MRv�lnMrr. ra.e- mwa,vnrb,.r.wuemen !d\OE AL:\MEfENCE DEBIOM YNK C6A1® RCRRACHANHASSEN, MN MINNEAPOLIS. MN NORTH AREA SLOPE REPAIR PROPIIE. SECTION. AND DETAIL nurA,eKeawlm e-omx arcx — vanx .aL. faaml ow w uaea. mAMXM Aeaxm wKMM _ � '•,:�"'�•.,' v I ss—I 24 1 u 1 42 1 uu — nounrneraxmrwunnaxwxn ...... .ETML&. ROCKCHECN r �wm w A rartxe�.w¢, w,e[vnuxrtex meow. T �n� I Sl d J o 1°a ..wxax e.,w,�n.rrxe Q""s V Jg..r ex F -'I T I"4�'} .y ore�� iwwxi.No � v�.`o`exx.�xo�om °P� OET/J� ypR�p OnTFeLL cwwrwnw• Ir+.vx++mwnweo eawi HECK xrwa.crm SECTION: ROCK CHECK x� �� SFCTX]M ROCKCHECK 4 i H--1 .lm lm x M. �A1 S�EOO QY' RIflUP OUTFALL �91 BE OIION� _ NorroRcoNsrnucnav "sem HCRRA DSLI LANDSLIDE REPAIRS spoomroxw MN All i — --- -MINNEAPOLIS, MN STORM SEWER AND DRAINAGE CHANNEL ro B C 0 0 PEvisiorl cfaCslmqu x.rmx�, m arr n, w.n..m _�_ ,rn SECTIONS AND OEtAILS L]0 +O _ rauwlenaolc� _ auvv �µ"inoLF rwam�eWiLri � r r`umiwci r"so°vo ---' BD`o�s YL nFmc [ppER WI. TO AS np. W r U. LgIM. CP9unaNp q p Y .. A}gglw Wqw WO WS VL�.W wxgvL A' TOAw,AS wA.grpAM NOW, WAS ip"NALA, ccaMwiu pp vwv c.wAO rouieiuroA� �r�w'gMOL OLDDMiowowaroFc :. iAp.NrelxwL..cruRnowLuae. ECTIOM. DRAINAGE CHANNEL ., IA.A.1,,Ie...A F —� urrAo ovuLuo now— �lrwmrrorwM. n.urA an AFFnnv xrrw. AN IWASAKI ON MAMUNACTIVIeS UPASSONTATAI SMALL 01 mrAll INS I..a rxr"L.uYrgv . r.vnrND WIN NLuq.r A.w SIA.'..'—I gr.Yre pe.uMIO 1.1 .1 IN ITS Nuu 1. W. -I WALL. WASSI, P"A" All HIMANEILLF TO WSTUt INSIMSMANAL U�WU'VfWt UN06K ILL AIMONW. ITS I ATWMLAA IN 11' .1 UNATIALAWN." SMALL 'I". ..,All 11' $1 NASA UVALASNOMI ON %T0flAFSl WUL SO TIES 11 1 NI.N.W." INS SIMAIN .11. "A. I INS ........ A.I n:<wAW.AM:r Mi::.uIAu r... NNG 1 10.."AOAiD .'IN All nr��ue� o...:u�ri,—. TO rexe. •.Arcn A.raWim •A`:``ew1.LAAwn:W,..........._. ie:`LWASA•qHA. L.All roIR..A.iwA M. .r WHEAT TOM .A •.ni:i.IS,romrNA Axe IN Mp.IMN Rq OVER MAT W. A. ..d I.Do rx A A e[MAMM....Wr....... I. A1..RgryLT.M.RlXry "Ll mnmonnvuunnxvAn[xwnvwaNmWwra Ar A0.1`A F FLLIAA1A1 ONNINMAT N :;.;M. -MAN, :IA° WWAMOWA`.AN FLEXAMATE at +MA^x. ISO. STANDARD CHANNEL DETAIL r.geAO.A s Z -m:' °B ii ro w.ew. "AW..FT........ NTS Oq&FLE%IBLE CONCRETE G -GRID INSTALLATION F E%AMAT OR APPRO UAL OW.- I—MILOWITS urw ALL xxm.v HCRRA I CHANIW6BEN, MN MINNEAPOLIS. MN 6MEN SEWER PNDDRAINAG I )PI.ANI SEEDING HCRRA MINNEAPOLIS. AN IT E111TINH11011 KIDw„w m SEEDING PLAN 1\ 1 ---------1 \� W 1 ______________________________J �� '-_ - .^� � _- - �__-`-1 ..^•ter / .,. it _ / /- E) Pj��2CKET MULCH PLM HCRRA MINNEa M* MN EROSION COWRM & MMCH PVN 1 \ \ o TMLE xre waar ANTIWE H TjB n u,r mmn roeea >�11—INio _ __ L—,-- —I a [erne 1 oew.eer veimrn-.ruxrmernu .. NIII�+nnmewo-rtoovwl ® rmt_uxnweuM AN" -- �� N � we[ueeezom rI r B e se�e[w rvr �wm� rxap 4 aatntouw B < o e MINNEAPGLIS, MN TREE PLANING PLAN `awinuwe TM� GEigIL TREE PLANTING cmwecrwe[m \ \ o TMLE ESTIMATEDTREE N ANTIWE H u DESIGN roeea MTR7RCQM91RLCiNNI a Pin[niw[ �� N � w.�ogT Ww B e se�e[w rvr �wm� rxap gene nce e. aatntouw B < o e MINNEAPGLIS, MN TREE PLANING PLAN `awinuwe TM� GEigIL TREE PLANTING cmwecrwe[m R as R— MIMI MIN* IN \ \ o TMLE ESTIMATEDTREE N ANTIWE H u DESIGN roeea MTR7RCQM91RLCiNNI a Pin[niw[ �� N � w.�ogT Ww B e se�e[w rvr �wm� rxap gene nce e. aatntouw B < o e MINNEAPGLIS, MN TREE PLANING PLAN `awinuwe TM� GEigIL TREE PLANTING cmwecrwe[m TMLE ESTIMATEDTREE N ANTIWE H DESIGN MTR7RCQM91RLCiNNI LANDSLIDE REPAIRS ------ _ —_ x wrc HCRRA CHPNHASSEN, MN aatntouw B < o e MINNEAPGLIS, MN TREE PLANING PLAN BMI..RIPrICH m R as ,, ,EENINaFlm.M NEINANIE-,AN, INN E - i Nutt EVEar,yuan rear TIE „E.. IW ERM17ENT CHECK SLOT TRM ANCHOR PATTERN TOP ANCHOR TRENCH 0 04.6.LIURF REINFORCEMENT MAT EDGE NAT ON ANCHOR TRENCH LANDSLIDE REPAIRS HCRRA CHANHASSEN, MN MINNEAPOLIS. MN RESTORATION DETAILS 0%DESM Joint Application Form for Activities Affecting Water Resources in Minnesota This joint application form is the accepted means for initiating review of proposals that may affect a water resource (wetland, tributary, lake, etc.) in the State of Minnesota under state and federal regulatory programs. Applicants for Minnesota Department of Natural Resources (DNR) Public Waters permits MUST use the MPARS online permitting system for submitting applications to the DNR. Applicants can use the information entered into MPARS to substitute for completing parts of this joint application form (see the paragraph on MPARS at the end of the joint application form instructions for additional information). This form is only applicable to the water resource aspects of proposed projects under state and federal regulatory programs; other local applications and approvals may be required. Depending on the nature of the project and the location and type of water resources impacted, multiple authorizations may be required as different regulatory programs have different types of jurisdiction over different types of resources. Regulatory Review Structure Federal The St. Paul District of the U.S. Army Corps of Engineers (Corps) is the federal agency that regulates discharges of dredged or fill material into waters of the United States (wetlands, tributaries, lakes, etc.) under Section 404 of the Clean Water Act (CWA) and regulates work in navigable waters under Section 10 of the Rivers and Harbors Act. Applications are assigned to Corps project managers who are responsible for implementing the Corps regulatory program within a particular geographic area. State There are three state regulatory programs that regulate activities affecting water resources. The Wetland Conservation Act (WCA) regulates most activities affecting wetlands. It is administered by local government units (LGUs) which can be counties, townships, cities, watershed districts, watershed management organizations or state agencies (on state-owned land). The Minnesota DNR Division of Ecological and Water Resources issues permits for work in specially -designated public waters via the Public Waters Work Permit Program (DNR Public Waters Permits). The Minnesota Pollution Control Agency (MPGA) under Section 401 of the Clean Water Act certifies that discharges of dredged or fill material authorized by a federal permit or license comply with state water quality standards. One or more of these regulatory programs may be applicable to any one project. Required Information Prior to submitting an application, applicants are strongly encouraged to seek input from the Corps Project Manager and LGU staff to identify regulatory issues and required application materials for their proposed project. Project proponents can request a pre - application consultation with the Corps and LGU to discuss their proposed project by providing the information required in Sections 1 through 5 of this joint application form to facilitate a meaningful discussion about their project. Many LGUs provide a venue (such as regularly scheduled technical evaluation panel meetings) for potential applicants to discuss their projects with multiple agencies prior to submitting an application. Contact information is provided below. The following bullets outline the information generally required for several common types of determinations/authorizations. • For delineation approvals and/or jurisdictional determinations, submit Parts 1, 2 and 5, and Attachment A. • For activities involving CWA/WCA exemptions, WCA no -loss determinations, and activities not requiring mitigation, submit Parts 1 through 5, and Attachment B. • For activities requiring compensatory mitigation/replacement plan, submit Parts 1 thru 5, and Attachments C and D. • For local road authority activities that quality for the state's local road wetland replacement program, submit Parts 1 through 5, and Attachments C, D (if applicable), and E to both the Corps and the LGU. Minnesota Interagency Water Resource Application Form February 2014 Page 1 of 15 Submission Instructions Send the completed joint application form and all required attachments to: U.S Army Corps of Engineers. Applications may be sent directly to the appropriate Corps Office. For a current listing of areas of responsibilities and contact information, visit the St. Paul District's website at: http //www.mvp.usace.army.mil/MissionsIRegulatory.aspx and select "Minnesota" from the contact Information box. Alternatively, applications may be sent directly to the St. Paul District Headquarters and the Corps will forward them to the appropriate field office. Section 401 Water Quality Certification: Applicants do not need to submit the joint application form to the MPGA unless specifically requested. The MPCA will request a copy of the completed joint application form directly from an applicant when they determine an individual 401 water quality certification is required for a proposed project. Wetland Conservation Act Local Government Unit: Send to the appropriate Local Government Unit. If necessary, contact your county Soil and Water Conservation District (SWCD) office or visit the Board of Water and Soil Resources (BWSR) web site (www.bwsr.state.mn.us) to determine the appropriate LGU. DNR Public Waters Permitting: In 2014 the DNR will begin using the Minnesota DNR Permitting and Reporting System (MPARS) for submission of Public Waters permit applications (https�//webappsll dnr state mn us/mpars/public/authentication/login). Applicants for Public Waters permits MUST use the MPARS online permitting system for submitting applications to the DNR. To avoid duplication and to streamline the application process among the various resource agencies, applicants can use the information entered into MPARS to substitute for completing parts of this joint application form. The MPARS print/save function will provide the applicant with a copy of the Public Waters permit application which, at a minimum, will satisfy Parts one and two of this joint application. For certain types of activities, the MPARS application may also provide all of the necessary information required under Parts three and four of the joint application. However, it is the responsibility of the Applicant to make sure that the joint application contains all of the required information, including identification of all aquatic resources impacted by the project (see Part four of the joint application). After confirming that the MPARS application contains all of the required information in Parts one and two the Applicant may attach a copy to the joint application and fill in any missing information in the remainder of the joint application. Minnesota Interagency Water Resource Application Form February 2014 Page 2 of 15 Project Name and/or Number: PART ONE: Applicant Information If applicant is an entity (company, government entity, partnership, etc.), an authorized contact person must be identified. If the applicant is using an agent (consultant, lawyer, or other third party) and has authorized them to act on their behalf, the agent's contact information must also be provided. Applicant/Landowner Name: Hennepin County Regional Railroad Authority (HCCRA), Jessica Galatz Mailing Address: 7014 th Avenue 5, Suite 400, Minneapolis MN 55415 Phone: 612-348-2691 E-mail Address: Jessica.galatz@hennepin.us Authorized Contact (do not complete if same as above): Sarah Johnson Mailing Address: 325 5 Lake Avenue, Suite 700, Duluth MN, 55802 Phone: 218-529-7159 E-mail Address: sjohnson@barr.com Agent Name: Tyler Conley Mailing Address: 4300 Market Pointe Dr, Suite 200, Minneapolis, MN 55435 Phone: 952-832-2600 E-mail Address: tconley@barr.com PART TWO: Site Location Information County: Carver County City/Township: Chanhassen Parcel ID and/or Address: 25990600,252640080, 257560510, 250360200, and 250360700 Legal Description (Section, Township, Range): Sections 25, 36, Township 116 West, Range 23 N and Section 30, Township 116 West, Range 22 North Lat/Long(decimal degrees): 44.821518/-93.525386 Attach a map showing the location of the site in relation to local streets, roads, highways. Refer to Figure 1. Approximate size of site (acres) or if a linear project, length (feet): 9.3 acres If you know that your proposal will require an individual Permit from the U.S. Army Corps of Engineers, you must provide the names and addresses of all property owners adjacent to the project site. This information may be provided by attaching a list to your application or by using block 25 of the Application for Department of the Army permit which can be obtained at: http://www mvo usace armv mil/Portals/57/docs/regulatory/RegulatoryDocs/engform 4345 2012oct odf PART THREE: General Project/Site Information If this application is related to a delineation approval, exemption determination, jurisdictional determination, or other correspondence submitted prior to this application then describe that here and provide the Corps of Engineers project number. This application is related to the Chanhassen Slope Failure project number 2015-04215-MMJ. A wetland delineation was previously conducted in August 2015. This wetland delineation report was approved on December 18, 2015 (Appendix A). A second wetland delineation was completed on September 2019, for the expanded project area. This wetland delineation has been reviewed by the technical evaluation panel and the approval letter is attached. Minnesota Interagency Water Resource Application Form February 2014 Page 3 of 15 Describe the project that is being proposed, the project purpose and need, and schedule for implementation and completion. The project description must fully describe the nature and scope of the proposed activity including a description of all project elements that effect aquatic resources (wetland, lake, tributary, etc.) and must also include plans and cross section or profile drawings showing the location, character, and dimensions of all proposed activities and aquatic resource impacts. Project Description: The scope of the project includes landslide repairs on a portion of the Minnesota Bluffs LRT Regional Trail (trail) in Chanhassen, MN owned by the Hennepin County Regional Railroad Authority (HCRRA). Two areas will be repaired as part of this project —the north repair area and the south repair area. Project access will be from Highview Drive in Eden Prairie, proceeding southwest along the trail to the site, and also from Flying Cloud Drive through the Moon Valley Aggregate operated property (final access route through Moon Valley Aggregate operated property pending property owner authorization). Landslide repairs in the south repair area will include stabilizing the south slope, repairing the south culvert outlet area and constructing a new storm sewer and drainage ditch to direct water into the repaired area. Existing trail profile grades will be reduced with the embankment slopes regraded to less steep grades and finished with turf reinforcement mats. The existing damaged concrete headwall will be removed and existing riprap will be salvaged for reuse. The south culvert outlet area will be repaired with riprap, boulder cross vanes, and a stilling basin. Work in the north area will include removal of existing pipe debris, placement of riprap fill on north slope, and abandonment of the existing pipe crossing beneath the trail. Drainage will be rerouted from north pipe area via new buried storm sewer and lined drainage channel, which will discharge to the south culvert outlet area.Please refer to Appendix B for the complete set of design plans and layout of the aforementioned project featrues. Project Purpose and need In 2014, a large rain event (presidential declared disaster 41823) caused the slopes supporting the trail to fail. The trail has since been closed due to slope instability and public safety concerns. The purpose of the proposed project is to stabilize the trail slopes, reopen the trail, and thereby reconnect a six-year closure of a Tier 1 Alignment of the Regional Bicycle Transportation Network. Aquatic Resources Two wetland delineations were conducted within the project area. The first delineation was completed in August 2015. The Second wetland delineation was completed in September 2019 to accommodate the proposed construction limits in their entirety. The wetland delineations identified two wetland areas (0.49 acres) and one unnamed stream channel within the project area (Figure 2). The two wetland areas (Wetland 1, wetland 2) are incidental wetlands located within the ditch of the trail. Both wetlands contained of three communities; shallow marsh, shrub -carr, and wet meadow. The shallow marsh segment of the wetland is located on the northern end of the proposed access route. As the wetland extends southwest, the slopes gradually increase causing the plant community to change from a shallow marsh to shrub - carr and wet meadow. Using the Cowardin classification method the wetland areas were classified as palustrine emergent wetlands that are partially seasonally flooded and temporarily flooded and ditched (PEMAd/PEMCd). The unnamed stream was originally delineated as part of the 2015 wetland delineation report. The stream channel was classified as a type 1(RUBA) seasonally flooded sparsely vegetated stream channel. Work conducted in Aquatic Resources The proposed repairs will require work to be conducted within the two delineated wetlands and unnamed stream. A constructed 10 -foot wide access road is required along the existing trail to provide access for construction materials and equipment. Portions of the trail corridor are too narrow and require placement of temporary Hill in the existing ditches (wetlands 1 and 2) to create the required 10 -foot wide access route. Approximately 0.06 acres of temporary fill will be placed within wetlands 1 and 2 (Appendix B, Pg G-05). Once construction is completed, the fill will be removed and the ditches will be returned to as close to the pre -project existing conditions as possible. Minnesota Interagency Water Resource Application Form February 2014 Page 4 of 15 The proposed repair work requires 0.025 acres (86 cubic yards) of riprap be placed within approximately 79 linear feet of the existing stream channel. This portion of stream has been previously impacted due to installing riprap for an emergency repair in 2016. An additonal, 0.092 acres (64 cubic yards) of riprap will be placed below the ordinary high water level downstream from the emergency repair area. The placement of this riprap will impact approximately 294 linear feet of stream channel and help further protect the stream banks and prevent further bank erosion and sedimentation downstream (Appendix B, pg C-13). Schedule Tree clearing would be completed in the spring of 2020. Construction is anticipated to begin in the summer/fall of 2020 and commence by the end of 2020. Special considerations Threatened and Endangered Species A threatened and endangered species assessment was completed for the proposed project. The review identified two federally listed species and five state listed species occurring within one -mile of the project area (Appendix C). Rare natural Communities No records of rare natural communities are shown in the NNIS database within the project area. Special Fish and Wildlife Resources The project is expected to improve fish and wildlife habitat along the unnamed stream channel. The stream is an intermittent stream and does not support fish populations. Stabilization of the adjacent slope and stream bank will help improve downstream water quality by reducing the amount of sediment loading into the stream channel. The project will not block or impede potential fish passage. Cultural Resources In 2015, a review of records at the Minnesota State Historic Preservation Office (MSHPO) was requested to identify any previously recorded archaeological, historical, or architectural resources within the project area. Per the Minnesota Archaeological Inventory and Historic Structures Inventory for the project area, no archaeological sites were identified and one historic feature was identified within Section 25, T116N, R23W (Appendix D). This property will not be affected by the proposed project. In November 2019, a second record search was submitted to MSHPO for the expanded project area. No additional cultural resources were identified. Groundwater sensitivity The project will not directly impact groundwater since excavations will occur up to 10 feet below the ground surface. Sensitive Surface Waters The MDNR Pubilc Waters Inventory (PWI) did not identify any basins or watercourses within the Project area. No sensitive surface waters such as impaired waterbodies or trout waters were identified within the project area. Tree Removal It is anticipated the proposed project will require tree removal around the north and south repair area. Large trees will be avoided to the degree practical. Tree clearing will be conducted between November 1 and March 31 to limit impacts to sensitive wildlife species. All trees removed with >6" dbh will be replaced in accordance with the City of Chanhassen's permit requirements (Appendix 8, R-02). Status of Other Approvals Table 1 below includes the status of other approvals required by the project. Minnesota Interagency Water Resource Application Form February 2014 Page 5 of 15 Table 1, Status of Other Regulatory Agency Submittals Unit of Government Permit or Approval Status - City of Chanhassen Interim Use Permit To be Submitted in December, 2019 Wetland Delineation boundary and Approved, see attached letter type confirmation submitted 11/6/2019 City of Eden Prairie Application for Utility Right of Way To be submitted in spring 2020 permit Minnesota Interagency Water Resource Application Form February 2014 Page 6 of 15 Project Name and/or Number: PART FOUR: Aquatic Resource Impact' Summary If your proposed project involves a direct or indirect impact to an aquatic resource (wetland, lake, tributary, etc.) identify each impact in the table below. Include all anticipated impacts, including those expected to be temporary. Attach an overhead view map, aerial photo, and/or drawing showing all of the aquatic resources in the project area and the location(s) of the proposed impacts. Label each aquatic resource on the map with a reference number or letter and identify the impacts in the following table. 'If impacts are temporary; enter the duration of the impacts in days next to the "T". For example, a project with a temporary access fill that would be removed after 220 days would be entered 'T (220)". 'Impacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the flowline of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 ft (300 square feet). 'This is generally only applicable if you are applying for a de minimis exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A". 4U se Wetland Plants and Plant Community Types of Minnesota and Wisconsin 3'd Ed. as modified in MN Rules 8420.0405 Subp. 2. sRefer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: ' The term "impact" as used in this joint application form is a generic term used for disclosure purposes to identify activities that may require approval from one or more regulatory agencies. For purposes of this form it is not meant to indicate whether or not those activities may require mitigation/replacement. Minnesota Interagency Water Resource Application Form February 2014 Page 7 of 15 Aquatic Type of Impact Duration of Existing Plant County, Major Aquatic Resource Resource Type (fill, excavate, Impact Overall Size of Watershed #, ID as no on ( (wetland, lake, drain, or Permanent (P) Size of Impact z Aquatic Community my and Bank overhead view tributaryetc.) remove or Temporary Resource s Type(s) Impact Area 4 Service Area# vegetation) (T)' of Impact Areas Stream 1 Tributary Fill P 77ft (0.025 N/A None Carver County (Maintenance) acres) Watershed #33 BSA #7 Stream 1 Tributary Fill (bank P 296ft (0.092 N/A None Carver County stabilization) acres) Watershed #33 BSA #7 1,2 Wetland Fill T (90) 0.06 acres N/A None Carver County Watershed #33 BSA #7 'If impacts are temporary; enter the duration of the impacts in days next to the "T". For example, a project with a temporary access fill that would be removed after 220 days would be entered 'T (220)". 'Impacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the flowline of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 ft (300 square feet). 'This is generally only applicable if you are applying for a de minimis exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A". 4U se Wetland Plants and Plant Community Types of Minnesota and Wisconsin 3'd Ed. as modified in MN Rules 8420.0405 Subp. 2. sRefer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: ' The term "impact" as used in this joint application form is a generic term used for disclosure purposes to identify activities that may require approval from one or more regulatory agencies. For purposes of this form it is not meant to indicate whether or not those activities may require mitigation/replacement. Minnesota Interagency Water Resource Application Form February 2014 Page 7 of 15 PART FIVE: Applicant Signature ❑ Check here if you are requesting a ore -application consultation with the Corps and LGU based on the information you have provided. Regulatory entities will not initiate a formal application review if this box is checked. By signature below, I attest that the information in this application is complete and accurate. I further attest that I possess the authority to undertake the work described herein. Signature: ��— �� Date: I2-I13II 9 I hereby authorize to act on my behalf as my agent in the processing of this application and to furnish, upon request, supplemental information in support of this application. Minnesota Interagency Water Resource Application Form February 2014 Page 8 of 15 Project Name and/or Number: Attachment A Request for Delineation Review, Wetland Type Determination, or Jurisdictional Determination By submission of the enclosed wetland delineation report, I am requesting that the U.S. Army Corps of Engineers, St. Paul District (Corps) and/or the Wetland Conservation Act Local Government Unit (LGU) provide me with the following (check all that apply): ❑ Wetland Type Confirmation ❑ Delineation Concurrence. Concurrence with a delineation is a written notification from the Corps and a decision from the LGU concurring, not concurring, or commenting on the boundaries of the aquatic resources delineated on the property. Delineation concurrences are generally valid for five years unless site conditions change. Under this request alone, the Corps will not address the jurisdictional status of the aquatic resources on the property, only the boundaries of the resources within the review area (including wetlands, tributaries, lakes, etc.). ❑ Preliminary Jurisdictional Determination. A preliminary jurisdictional determination (PJD) is a non-binding written indication from the Corps that waters, including wetlands, identified on a parcel may be waters of the United States. For purposes of computation of impacts and compensatory mitigation requirements, a permit decision made on the basis of a PJD will treat all waters and wetlands in the review area as if they are jurisdictional waters of the U.S. PJDs are advisory in nature and may not be appealed. ❑ Approved Jurisdictional Determination. An approved jurisdictional determination (AJD) is an official Corps determination that jurisdictional waters of the United States are either present or absent on the property. AJDs can generally be relied upon by the affected party for five years. An AJD may be appealed through the Corps administrative appeal process. In order for the Corps and _GU to process your request, the wetland delineation must be prepared in accordance with the 1987 Corps of Engineers Wetland Delineation Manual, any approved Regional Supplements to the 1987 Manual, and the Guidelines for Submitting Wetland Delineations in Minnesota (2013). http://www.mvo usace armv mil/Missions/Regulatory/DelineationJDGuidance asox Minnesota Interagency Water Resource Application Form February 2014 Page 9 of 15 Project Name and/or Number: Attachment B Supporting Information for Applications Involving Exemptions, No Loss Determinations, and Activities Not Requiring Mitigation Complete this part if you maintain that the identified aquatic resource impacts in Part Four do not require wetland replacement/compensatory mitigation OR if you are seeking verification that the proposed water resource impacts are either exempt from replacement or are not under CWA/WCA jurisdiction. Identify the specific exemption or no -loss provision for which you believe your project or site qualifies: WCA: 8420.0105 Subp. 2. D. USACE: Nationwide Permit 13: Bank stabilization and Nationwide Permit 3: Maintenance Provide a detailed explanation of how your project or site qualifies for the above. Be specific and provide and refer to attachments and exhibits that support your contention. Applicants should refer to rules (e.g. WCA rules), guidance documents (e.g. BWSR guidance, Corps guidance letters/public notices), and permit conditions (e.g. Corps General Permit conditions) to determine the necessary information to support the application. Applicants are strongly encouraged to contact the WCA LGU and Corps Project Manager prior to submitting an application if they are unsure of what type of information to provide: WCA Under 8420.0105 Subp. 2. D WCA does not regulate impacts to incidental wetlands. The two delineated wetlands that would be temporarily impacted by the proposed project are manmade ditched wetlands. These ditches are meant to convey water away from the trail. However, due to the lack of slope, water has ponded in the trail area creating a narrow wetland within an upland area. The project will place approximately 0.06 acres of fill within the incidental wetland area. This fill will be temporary and removed upon completion of the project. The ditches will then be restored to as close to the pre -project existing conditions as possible. USACE: It is anticipated that work within Waters of the U.S. can be completed under Nationwide Permit 3 and/or Nationwide Permit 13. Maintenance Activities: The proposed project would need to repair 0.025 acres (86 cubic yards) of riprap within approximately 79 linear feet of the existing stream channel. Some riprap was originally placed in this segment of the stream channel as part of a previous emergency repair needed to stabilize the south culvert outlet. Since then the riprap has been displaced during subsequent flood and runoff events. The proposed project would salvage existing riprap and also install additional riprap to further protect the area from future erosion. Bank Stabilization Activities: Bank stabilization activities necessary for erosion control or prevention, such as vegetative stabilization, bioengineering, spills, riprap, revetment, gabion baskets, stream barbs, and bulkheads, or combination of bank stabilization techniques. In order to stabilize the bank of the unnamed stream, 0.092 acres (64 cubic yards) of riprap will be placed below the ordinary high water level. The placement of riprap will impact approximately 294 linear feet of stream channel. Minnesota Interagency Water Resource Application Form February 2014 Page 10 of 15 Project Name and/or Number: Attachment C Avoidance and Minimization Project Purpose, Need, and Requirements. Clearly state the purpose of your project and need for your project. Also include a description of any specific requirements of the project as they relate to project location, project footprint, water management, and any other applicable requirements. Attach an overhead plan sheet showing all relevant features of the project (buildings, roads, etc.), aquatic resource features (impact areas noted) and construction details (grading plans, storm water management plans, etc.), referencing these as necessary: Avoidance. Both the CWA and the WCA require that impacts to aquatic resources be avoided if practicable alternatives exist. Clearly describe all on-site measures considered to avoid impacts to aquatic resources and discuss at least two project alternatives that avoid all impacts to aquatic resources on the site. These alternatives may include alternative site plans, alternate sites, and/or not doing the project. Alternatives should be feasible and prudent (see MN Rules 8420.0520 Subp. 2 C). Applicants are encouraged to attach drawings and plans to support their analysis: Minimization. Both the CWA and the WCA require that all unavoidable impacts to aquatic resources be minimized to the greatest extent practicable. Discuss all features of the proposed project that have been modified to minimize the impacts to water resources (see MN Rules 8420.0520 Subp. 4): Off -Site Alternatives. An off-site alternatives analysis is not required for all permit applications. If you know that your proposal will require an individual permit (standard permit or letter of permission) from the U.S. Army Corps of Engineers, you may be required to provide an off-site alternatives analysis. The alternatives analysis is not required for a complete application but must be provided during the review process in order for the Corps to complete the evaluation of your application and reach a final decision. Applicants with questions about when an off-site alternatives analysis is required should contact their Corps Project Manager. Minnesota Interagency Water Resource Application Form February 2014 Page 11 of 15 Project Name and/or Number: Attachment D Replacement/Compensatory Mitigation Complete this part if your application involves wetland replacement/compensatory mitigation not associated with the local road wetland replacement program. Applicants should consult Corps mitigation guidelines and WCA rules for requirements. Replacement/Compensatory Mitigation via Wetland Banking. Complete this section if you are proposing to use credits from an existing wetland bank (with an account number in the State wetland banking system) for all or part of your replacement/compensatory mitigation requirements. Bank Wetland Bank County Major Service Credit Type Number of Credits Area # Account # Watershed # (if applicable) Applicants should attach documentation indicating that they have contacted the wetland bank account owner and reached at least a tentative agreement to utilize the identified credits for the project. This documentation could be a signed purchase agreement, signed application for withdrawal of credits or some other correspondence indicating an agreement between the applicant and the bank owner. However, applicants are advised not to enter into a binding agreement to purchase credits until the mitigation plan is approved by the Corps and LGU. Project -Specific Replacement/Permittee Responsible Mitigation. Complete this section if you are proposing to pursue actions (restoration, creation, preservation, etc.) to generate wetland replacement/compensatory mitigation credits for this proposed project. Corps Mitigation WCA Action Eligible Compensation Acres for Credit' 2 Technique Credit % Requested Bank Credits Major Service n County Anticipated Watershed # Area # 'Refer to the name and subpart number in MN Rule 8420.0526. 2Refer to the technique listed in St. Paul District Policy for Wetland Compensatory Mitigation in Minnesota. slf WCA and Corps crediting differs, then enter both numbers and distinguish which is Corps and which is WCA. Explain how each proposed action or technique will be completed (e.g. wetland hydrology will be restored by breaking the tile......) and how the proposal meets the crediting criteria associated with it. Applicants should refer to the Corps mitigation policy language, WCA rule language, and all associated Corps and WCA guidance related to the action or technique: Attach a site location map, soils map, recent aerial photograph, and any other maps to show the location and other relevant features of each wetland replacement/mitigation site. Discuss in detail existing vegetation, existing landscape features, land use (on and surrounding the site), existing soils, drainage systems (if present), and water sources and movement. Include a topographic map showing key features related to hydrology and water flow (inlets, outlets, ditches, pumps, etc.): Minnesota Interagency Water Resource Application Form February 2014 Page 12 of 15 Project Name and/or Number: Attach a map of the existing aquatic resources, associated delineation report, and any documentation of regulatory review or approval. Discuss as necessary: For actions involving construction activities, attach construction plans and specifications with all relevant details. Discuss and provide documentation of a hydrologic and hydraulic analysis of the site to define existing conditions, predict project outcomes, identify specific project performance standards and avoid adverse offsite impacts. Plans and specifications should be prepared by a licensed engineer following standard engineering practices. Discuss anticipated construction sequence and timing: For projects involving vegetation restoration, provide a vegetation establishment plan that includes information on site preparation, seed mixes and plant materials, seeding/planting plan (attach seeding/planting zone map), planting/seeding methods, vegetation maintenance, and an anticipated schedule of activities: For projects involving construction or vegetation restoration, identify and discuss goals and specific outcomes that can be determined for credit allocation. Provide a proposed credit allocation table tied to outcomes: Provide a five-year monitoring plan to address project outcomes and credit allocation: Discuss and provide evidence of ownership or rights to conduct wetland replacement/mitigation on each site: Quantify all proposed wetland credits and compare to wetland impacts to identify a proposed wetland replacement ratio. Discuss how this replacement ratio is consistent with Corps and WCA requirements: By signature below, the applicant attests to the following (only required if application involves project-specific/permittee responsible replacement): • All proposed replacement wetlands were not: • Previously restored or created under a prior approved replacement plan or permit • Drained or filled under an exemption during the previous 10 years • Restored with financial assistance from public conservation programs • Restored using private funds, other than landowner funds, unless the funds are paid back with interest to the individual or organization that funded the restoration and the individual or organization notifies the local government unit in writing that the restored wetland may be considered for replacement. • The wetland will be replaced before or concurrent with the actual draining or filling of a wetland. • An irrevocable bank letter of credit, performance bond, or other acceptable security will be provided to guarantee successful completion of the wetland replacement. • Within 30 days of either receiving approval of this application or beginning work on the project, I will record the Declaration of Restrictions and Covenants on the deed for the property on which the replacement wetland(s) will be located and submit proof of such recording to the LGU and the Corps. Applicant or Representative: Signature: Minnesota Interagency Water Resource Application Form February 2014 Title: Date: Page 13 of 15 Project Name and/or Number: Attachment E Local Road Replacement Program Qualification Complete this part if you area local road authority (county highway department, City transportation department, etc.) seeking verification that your project (or a portion of your project) qualifies for the MN Local Government Road Wetland Replacement Program (LGRWRP). If portions of your project are not eligible for the LGRWRP, then Attachment D should be completed and attached to your application. Discuss how your project is a repair, rehabilitation, reconstruction, or replacement of a currently serviceable road to meet state/federal design or safety standards/requirements. Applicants should identify the specific road deficiencies and how the project will rectify them. Attach supporting documents and information as applicable: Provide a map, plan, and/or aerial photograph accurately depicting wetland boundaries within the project area. Attach associated delineation/determination report or otherwise explain the method(s) used to identify and delineate wetlands. Also attach and discuss any type of review or approval of wetland boundaries or other aspects of the project by a member or members of the local Technical Evaluation Panel (TEP) or Corps of Engineers: In the table below, identify only the wetland impacts from Part 4 that the road authority has determined should qualify for the LGRWRP. Wetland Impact ID Type of Impact Size of Impact Existing Plant Community County, Major Watershed #, (as noted on (fill, excavate, (square feet orTypes) in Impact Areal and Bank Service Area # of act' overhead view) drain) acres to 0.01) Im P 'Use Wetland Plants and Plant Community Types of Minnesota and Wisconsin 3'd Ed. as modified in MN Rules 8420.0405 Subp. 2. 'Refer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. Discuss the feasibility of providing onsite compensatory mitigation/replacement for important site-specific wetland functions: Please note that under the MN Wetland Conservation Act, projects with less than 10,000 square feet of wetland impact are allowed to commence prior to submission of this notification so long as the notification is submitted within 30 days of the impact. The Clean Water Act has no such provision and requires that permits be obtained prior to any regulated discharges into water of the United States. To avoid potential unauthorized activities, road authorities must, at a minimum, provide a complete application to the Corps and receive a permit prior to commencing work. By signature below, the road authority attests that they have followed the process in MN Rules 8420.0544 and have determined that the wetland impacts identified in Part 4 are eligible for the MN Local Government Road Wetland Replacement Program. Road Authority Representative: Signature: Minnesota Interagency Water Resource Application Form February 2014 Title: Date: Page 14 of 15 Technical Evaluation Panel Concurrence: Project Name and/or Number: TEP member: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: Date TEP member: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: Date: TEP member: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: Date: TEP member: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: Date: Upon approval and signature by the TEP, application must be sent to: Wetland Bank Administration Minnesota Board of Water & Soil Resources 520 Lafayette Road North Saint Paul, MN 55155 Minnesota Interagency Water Resource Application Form February 2014 Page 15 of 15 % a • r.; • a. Tr Eastwood Cy i J ... YGN r c GN �. f _ �f �. � .aimst�d Cir f o `� .. .. m..:• * i .,r f : f � „ �� �r Pt`s d� .�ath,6�Pe y, �.. j rr �JQt1Q� t f @ %• F % • Seidel 'C.I dLakota Laz + � f % I i Qln��i .,•~� �aii � t`; � Ginrq�nl F` 99C^J ! Minnesota Bluff Rivers O LRT Regional Trail M O Construction Limits 0 700 County Boundary SOONER::= Feet QPublic Land Survey Section Imagery Source, NearMap, April 2079 _SP.f-' _t ® Wetland Sample Location Wetland Classifications r7 Construction Limits C3 Type 3 --- * Approximate Stream Channel Type 6 K Delineated Wetlands a� f 'd r 0 0 100 Feet Imagery Source, NearMap, April 2019 ■ ' s „ t``� Air /ate_ i •1 aa 4 J. ro .1b v� r �~ ® Wetland Sample Location Wetland Classifications N WETLAND DELINEATION , OConstruction Limits Type 6 Minnesota ' 0 too i i# River .. - Bluffs a. . . B- Approximate Stream Channel Chanhassen, Minnesota t`. Delineated Wetlands Feet Imagery Source: NeorMop, Apr(! 2019 FIGURE 2 t f, > `fix •,,�< - ;�, ' `".ice. G► i w ; ' = . 4 O Construction Limits Wetland Classifications WETLAND DELINEATION - 2015 Delineated Wetlands w3 TYPe 1Minnesota River Bluffs URT .. iX .. .i BARR _♦ Approximate Stream Channel Type 6 �0 Chanhassen, Minnesota " Feet (<- Delineated Wetlands Imagery Source, NearMop, April 2079 FIGURE Construction Limits bw, Delineated Wetlands O — 2015 Delineated Wetlands W��e/t(land Classifications �► Approximate Stream Channel W Type 1 0 100 Culvert Pipe Feet Imagery Source NearMap, Aprd 2019 Construction Limits Q - 2015 Delineated Wetlands 0 100 a BARR Approximate Stream Channel Feet t7 Culvert Pipe e ImagerySource; NeorMap, April 2079 APPENDIX A MN Wetland Conservation Act Notice of Decision Project Name and/or Number: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization PART ONE: Applicant Information If applicant is an entity (company, government entity, partnership, etc.), an authorized contact person must be identified. If the applicant is using an agent (consultant, lawyer, or other third party) and has authorized them to act on their behalf, the agent's contact information must also be provided. Applicant/Landowner Name: Jessica Galatz, Hennepin County Regional Railroad Authority Mailing Address: 701 Fourth Avenue South, Suite 400 Phone: 612-348-2691 E-mail Address: jessica.galatz@hennepin.us Authorized Contact (do not complete if same as above): Mailing Address: Phone: E-mail Address: Agent Name: Joel Swenson, Barr Engineering Mailing Address: 4700 West 77" St, Minneapolis, MN 55435 Phone: 952-832-2799 E-mail Address: jswenson@barr.com PART TWO: Site Location Information County: Carver Parcel ID and/or Address: Legal Description (Section, Township, Range): Lat/Long (decimal degrees): -93.527 44.819 City/Township: Chanhassen 536, T116N, R23W Attach a map showing the location of the site in relation to local streets, roads, highways. Approximate size of site (acres) or if a linear project, length (feet): 8.13 acres If you know that your proposal will require an individual Permit from the U.S. Army Corps of Engineers, you must provide the names and addresses of all property owners adjacent to the project site. This information may be provided by attaching a list to your application or by using block 25 of the Application for Department of the Army permit which can be obtained at: http://www mvp usace army mil/Portals/57/docs/regulatory/Regulatory DocsZengform 4345 2012oct.pdf PART THREE: General Project/Site Information If this application is related to a delineation approval, exemption determination, jurisdictional determination, or other correspondence submitted prior to this application then describe that here and provide the Corps of Engineers project number. Describe the project that is being proposed, the project purpose and need, and schedule for implementation and completion. The project description must fully describe the nature and scope of the proposed activity including a description of all project elements that effect aquatic resources (wetland, lake, tributary, etc.) and must also include plans and cross section or profile drawings showing the location, character, and dimensions of all proposed activities and aquatic resource impacts. Minnesota Interagency Water Resource Application Form February 2014 Page 3 of 11 Project Name and/or Number: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization PART FOUR: Aquatic Resource Impact' Summary If your proposed project involves a direct or indirect impact to an aquatic resource (wetland, lake, tributary, etc.) identify each impact in the table below. Include all anticipated impacts, including those expected to be temporary. Attach an overhead view map, aerial photo, and/or drawing showing all of the aquatic resources in the project area and the location(s) of the proposed impacts. Label each aquatic resource on the map with a reference number or letter and identify the impacts in the following table. Aquatic Resource Aquatic Resource Type ID I as noted on (wetland, overhead view lake, ) etc. ) Type of Impact (fill, excavate, drain, or remove vegetation) Duration of Impact Overall Size of Permanent (P) Size of Impact' Aquatic or Temporary Resource s (T)' Existing Plant CommunityWatershed T Type(s) yp (s) In Impact Area° County, Major p, and Bank Service Area IIIry of Impact Area 'If impacts are temporary; enter the duration of the impacts in days next to the "T'. For example, a project with a temporary access fill that would be removed after 220 days would be entered "T (220)". 'Impacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the flowline of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 ft (300 square feet). 'This is generally only applicable if you are applying for a de minims exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A". 'Use Wetland Plants and Plant Community Types of Minnesota and Wisconsin 3r' Ed. as modified in MN Rules 8420.0405 Subp. 2. 'Refer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: PART FIVE: Applicant Signature ® Check here if you are requesting a ore -application consultation with the Corps and LGU based on the information you have Provided. Regulatory entities will not initiate a formal application review if this box is checked. By signature below, I attest that the information in this application is complete and accurate. I further attest that 1 possess the authority to undertake the work described herein. Signature: ��,n/),(�Gpt.� .{� H�R'� Date: it/(P I I hereby authorize to act on my behalf as my agent in the processing of this application and to furnish, upon request, E,jwcr> sop r ?r— supplemental information in support of this application. 80.f1 F.t�giY)2.pliylq ' The term "impact' as used in this joint application form is a generic term used for disclosure purposes to identify activities that may require approval from one or more regulatory agencies. For purposes of this form it is not meant to indicate whether or not those activities may require mitigation/replacement. Minnesota Interagency Water Resource Application Form February 2014 Page 4 of 11 Project Name and/or Number: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization Attachment A Request for Delineation Review, Wetland Type Determination, or Jurisdictional Determination By submission of the enclosed wetland delineation report, I am requesting that the U.S. Army Corps of Engineers, St. Paul District (Corps) and/or the Wetland Conservation Act Local Government Unit (LGU) provide me with the following (check all that apply): ® Wetland Type Confirmation ® Delineation Concurrence. Concurrence with a delineation is a written notification from the Corps and a decision from the LGU concurring, not concurring, or commenting on the boundaries of the aquatic resources delineated on the property. Delineation concurrences are generally valid for five years unless site conditions change. Under this request alone, the Corps will not address the jurisdictional status of the aquatic resources on the property, only the boundaries of the resources within the review area (including wetlands, tributaries, lakes, etc.). ® Preliminary Jurisdictional Determination. A preliminary jurisdictional determination (PJD) is a non-binding written indication from the Corps that waters, including wetlands, identified on a parcel may be waters of the United States. For purposes of computation of impacts and compensatory mitigation requirements, a permit decision made on the basis of a PJD will treat all waters and wetlands in the review area as if they are jurisdictional waters of the U.S. PJDs are advisory in nature and may not be appealed. ❑ Approved jurisdictional Determination. An approved jurisdictional determination (AJO) is an official Corps determination that jurisdictional waters of the United States are either present or absent on the property. AJDs can generally be relied upon by the affected party for five years. An AJD may be appealed through the Corps administrative appeal process. In order for the Corps and LGU to process your request, the wetland delineation must be prepared in accordance with the 1987 Corps of Engineers Wetland Delineation Manual, any approved Regional Supplements to the 1987 Manual, and the Guidelines for Submitting Wetland Delineations in Minnesota (2013). htto://www mvo usace armv mil/Missions/Regulatory/DelineationJDGuidance.aspx Minnesota Interagency Water Resource Application Form February 2014 Page 5 of 11 Minnesota Wetland Conservation Act Notice of Decision Local Government Unit (LGL) Address City of Chanhassen 7700 Market Boulevard, PO Boz 147 Chanhassen, MN 55317 1_ PRA.TFC.T iNWORMATFON Applicant Name Project Name Date of Application Hennepin County Regional Rail MN River Bluffs LRT Regional Application 111/10/2015 Number 12015-10 Authority Trail Slope Stabilization Attach site locator map. Fype of Decision: ® Wetland Boundary or Type ❑ No -Loss ❑ Exemption ❑ Sequencing ❑ Replacement Plan ❑ Banking Plan Technical Evaluation Panel Findings and Recommendation (if any): ❑ Approve ❑ Approve with conditions ❑ Deny Summary (or attach): 2. LOCAL GOVERNMENT UNIT DECISION Date of Decision: December 15, 2015 ❑ Approved ® Approved with conditions (include below) ❑ Denied BWSR Fomes 11-25-09 Page 1 of 3 LGU Findings and Conclusions (attach additional sheets as necessary): Barr Engineering, on behalf of the Hennepin County Regional Rail Authority (HCRRA), has performed a wetland determination and boundary delineation for the site located along the LRT Regional Trail, between Pioneer Trail and TH 101 in Chanhassen, MN, and within the SE '/a of Section 25, TI 16N, R23W. This delineation identified two wetland basins on-site. Wetland Area 1 is located at the NE portion of the site, upslope from a stream channel. This has been identified as a Type 2 (PEMB) wet meadow seepage wetland. Wetland Area 2 is an intermittent stream channel located at the southern portion of the site. This wetland was identified as a Type 1, seasonally flooded stream in the delineation report, however this basin fails to meet the hydrophytic vegetation criterion and therefore is not considered jurisdictional under the MN Wetland Conservation Act. None of the wetland areas identified in the delineation are identified on the National Wetland Inventory Map, or the DNR Public Waters Map. Based upon our review, the City of Chanhassen, as the LGU responsible for administration of Minnesota R. 8420, concurs with the delineated boundary and types as identified in the wetland determination and delineation report prepared by Barr Engineering, dated August 2015, and the wetland boundaries shown within the report. The Application for Wetland Boundary and Type was noticed on November 101 2015. No additional comments were received from the Technical Evaluation Panel members or from the public. This concludes our review. Upon the provision of the electronic representation of the delineated boundaries (*.shp or *.dwe). this delineation will be considered approved Fnr Ronlarnment Plane ncina credits from the State Wetland Bank: Bank Account # Bank Service Area County Credits Approved for Withdrawal (sq. R or nearest 01 acre Replacement Plan Approval Conditions. In addition to any conditions specified by the LGU, the approval of a Wetland Replacement Plan is conditional upon the following: ❑ Financial Assurance: For project -specific replacement that is not in -advance, a financial assurance specified by the LGU must be submitted to the LGU in accordance with MN Rule 8420.0522, Subp. 9 (List amount and type in LGU Findings). ❑ Deed Recording: For project -specific replacement, evidence must be provided to the LGU that the BWSR "Declaration of Restrictions and Covenants" and "Consent to Replacement Wetland" forms have been filed with the county recorder's office in which the replacement wetland is located. ❑ Credit Withdrawal: For replacement consisting of wetland bank credits, confirmation that BWSR has withdrawn the credits from the state wetland bank as specified in the approved replacement plan. Wetlands may not be impacted until as applicable conditions have been met! BWSR Forms 11-25-09 Page 2 of 3 LGU Authorized Signature: Signing and mailing of this completed form to the appropriate recipients in accordance with 8420.0255, Subp. 5 provides notice that a decision was made by the LGU under the Wetland Conservation Act as specified above. If additional details on the decision exist, they have been provided to the landowner and are available from the LGU upon rrquest. Name Title Terrance Jeffery, WDC Water Resources Coordinator Signa Date Phone Number and E-mail 952.227.1168 effe ci.chanhassen.mn.us Addition'a -approvals f permits from local, state, and federal agencies may be required. Check with all appropriate authorities before commencing work in or near wetlands. Applicants proceed at their own risk if work authorized by this decision is started before the time period for appeal (30 days) has expired. If this decision is reversed or revised under appeal, the applicant may be responsrble for restoring or replacing all wetland impacts. This decision is valid for three years from the date of decision unless a longer period is advised by the TEP and specified in this notice of decision. 3. APPEAL OF THIS DECISION Pursuant to MN Rule 8420.0905, any appeal of this decision can only be commenced by mailing a petition for appeal, including applicable fee, within thirty (30) calendar days of the date of the mailing of this Notice to the following as indicated: one: Q9 Appeal of an LGU staff decision. Send LJ Appeal of LGU governing body decision. petition and $50_00 fee (if applicable) to: Send petition and $500 filing fee to: Chanhassen City Council Executive Director C/o Todd Gerhardt, City Manager Minnesota Board of Water and Soil Resources 7700 Market Blvd, PO Boz 147 520 Lafayette Road North Chanahssen, MN 55317 St. Paul, MN 55155 4. LIST OF ADDRESSEES ® SWCD TEP member: Chip Hentges, Aaron Finke BWSR TEP member: Ben Meyer LGU TEP member (if different than LGU Contact): DNR TEP member (notice only): DNR Regional Office (if different than DNR TEP member): WD or WMO (if applicable): Linda Loomis, Lower MN River Watershed District Applicant (notice only) and Landowner (if different): Jessica Galatz, HCRRA Members of the public who requested notice (notice only): Joel Swenson, Barr Engineering Corps of Engineers Project Manager (notice only) Melissa Jenny BWSR Wetland Bank Coordinator (wetland bank plan applications only): BWSR Forms 11-25-09 Page 3 of 3 5. MAELING INFORMATION ➢For a list of B WSR TEP representatives, see: www.bwsr.state.mn.us/aboutbwsr/workareas[WCA areas.vdf ➢For a list of DNR TEP representatives, see: www.bwsr.statemn.us/wetbnds/wca/DNR TEP contacts.odf of Natural Resources Reglonw t)mces: NW Remora: NE ReOon Cenhal Region: Southern Re¢ioa: Reg. Fay. Assess. Ecol. Reg. Env. Assess. Ecol. Reg. Emv. Assess. Reg. Env. Assess. Ecol. Div. Ecol. Resources Div. Ecol. Resources Ecol. Div. Ecol. Resources 2115 Birchmont Beach Rd. 1201 E. Hwy. 2 Div. Ecol. Resources 261 Hwy. 15 South NE Grand Rapids, MN 1200 Warner Road New Ulm, MN 56073 Re idii_ MN 56601 55744 St Paul, MN 55106 ;or a man ive Rej ions, see: htto ➢Por a list of Corps of Project Managers, see: www.myousace army mil/regulatory/default.asy?p4gcid=687 or send to: ➢Dept, of the Army, Corps of Engineers, St. Paul District ATTN: CO -R,190 Fifth Street East St. Paul, MN 55101-1638 ➢For Wetland Bank Plan applications, also send a copy of the application to: Minnesota Board of Water and Soil Resources Wetland Bank Coordinator 520 Lafayette Road North St, Paul, MN 55155 6. ATTACHMENTS in addition to the application, list any other attachments: ® Joint Water Resources Application for Approval of Wetland Type and Boundary, dated November 6n, 2015 ® Wetland Delineation Report, dated August 2015. BWSR Forms 11-25-09 Page 4 of 3 MBOARD OF WATER AND SOIL RESOURCES Minnesota Wetland Conservation Act Notice of Decision Local Government Unit: City of Chanhassen County: Carver Applicant Name: Jessica Galatz, Hennepin County Regional Rail Authority Applicant Representative: Sarah Johnson, Barr Engineering Project Name: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization Delineation Update LGU Project No. (if any): Date Complete Application Received by LGU: 10/30/2019 Date of LGU Decision: 12/5/2019 Date this Notice was Sent: 12/9/2019 NCA Decision Type - check all that apply ®Wetland Boundary/Type ❑Sequencing ❑Replacement Plan ❑Bank Plan (not credit purchase) ❑No -Loss (8420.0415) ❑Exemption (8420.0420) Part:❑A❑B ❑C❑D❑E ❑F ❑G ❑H Subpart:0203❑4115 11607 0809 Replacement Plan Impacts (replacement plan decisions only) Total WCA Wetland Impact Area: Wetland Replacement Type: ❑ Project Specific Credits: ❑ Bank Credits: Bank Account Number(s): Technical Evaluation Panel Findings and Recommendations (attach if any) ❑ Approve ❑ Approve w/Conditions ❑ Deny M No TEP Recommendation LGU Decision ❑ Approved with Conditions (specify below)' ® Approved' ❑ Denied List Conditions: Decision -Maker for this Application: ® Staff ❑ Governing Board/Council ❑ Other: Decision is valid for: M 5 years (default) ❑ Other (specify): ' Wetland Replacement Plan approval is not valid until B WSR confirms the withdrawal of any required wetland bank credits. For project - specific replacement a finoncial assurance per MN Rule 8420.0511, Subp. 9 and evidence that all required forms have been recorded on the title of the property on which the replacement wetland is located must be provided to the LGUfor the approval to be valid. LGU Findings — Attach document(s) and/or insert narrative providing the basis for the LGU decision' ® Attachment(s) (specify): Wetland Delineation Figure M Summary: The LGU reviewed the site in the field on October 29, 2019. No comments were received from the TEP and the LGU concurred with the boundary and type observed in the field. 'Findings must consider any TEP recommendations Attached Project Documents BWSR NOD Form — November 5, 2019 1 N Site Location Map ❑ Project Plan(s)/Descriptions/Reports (specify): Appeals of LGU Decisions If you wish to appeal this decision, you must provide a written request within 30 calendar days of the date you received the notice. All appeals must be submitted to the Board of Water and Soil Resources Executive Director along with a check payable to BWSR for $500 unless the LGU has adopted a local appeal process as identified below. The check must be sent by mail and the written request to appeal can be submitted by mail or e-mail. The appeal should include a copy of this notice, name and contact information of appellant(s) and their representatives (if applicable), a statement clarifying the intent to appeal and supporting information as to why the decision is in error. Send to: Appeals & Regulatory Compliance Coordinator Minnesota Board of Water & Soils Resources 520 Lafayette Road North St. Paul, MN 55155 travis.germundson@state.mn.us Does the LGU have a local appeal process applicable to this decision? ® Yes' ❑ No 'if yes, all appeals must first be considered via the local appeals process. Local Appeals Submittal Requirements (LGU must describe how to appeal, submittal requirements, fees, etc. as applicable) Send petition and $50.00 to 7700 Market Boulevard, PO Box 147, Chanhassen, MN 55317 Notice Distribution (include name) y ® SWCD TEP Member: Aaron Finke ® BWSR TEP Member: Ben Carlson ® LGU TEP Member (if different than LGU contact): Todd Gerhardt, City of Chanhassen, Andi Moffatt, WSB ® DNR Representative: Leslie Parris, Jennie Skancke ® Watershed District or Watershed Mgmt. Org.: Linda Loomis, Lower MN River Watershed District ® Applicant (notice only): Jessica Galatz, Hennepin County Regional Rail Authority ® Agent/Consultant (notice only): Sarah Johnson, Barr Engineering; Tyler Conley, Barr Engineering Optional or As Applicable: ® Corps of Engineers: Mariah Weitzenkamp ❑ BWSR Wetland Mitigation Coordinator (required for bank plan applications only): ® Members of the Public (notice only): Leslie Stovring, Eden Prairie LGU; Erik Henricksen, City of Chanhassen; Terry Jeffery, RPBCWD ❑ Other: rSignaturc: as noticean�mpanying applicaaon materials may be seM electroaiaNy or by muill, TM Lou a" "a to saw a summary of the appfiation to members of the public upon request per *120.0255, Subp.1 BWSR NOD Form —November 5, 2019 Minnesota Bluff Rivers LRT Regional Trail N O O Construction Limits p 700 1___. County Boundary � Feet QPublic Land Survey Section Imagery Source, NearMop, Apri12019 Twp tr6w RNG NN SEC 22 Iw i x V. r l ; y � TWP1�16W •r. .• T r 1 Carver County Hennepin CounRy Minnesota Bluff Rivers LRT Regional Trail N O O Construction Limits p 700 1___. County Boundary � Feet QPublic Land Survey Section Imagery Source, NearMop, Apri12019 Twp tr6w RNG NN SEC 22 I ® Wetland Sample Location Wetland Classifications O OConstruction Limits Type 3 �► 0 100 Approximate Stream Channel Type 6 MMMMME== K Delineated Wetlands Feet Imogery Source; NearMop. Apri12019 -- 40 y�3vt- 1 i r �• r i .AQP i _ - s ® Wetland Sample Location Wetland Classifications O OConstruction Limits Type 3 �► 0 100 Approximate Stream Channel Type 6 MMMMME== K Delineated Wetlands Feet Imogery Source; NearMop. Apri12019 ALI .*k 1/.. �`.. 4 r r •. •` f.r 1.� � t ,ti Mw I t..-i3kor t?. • r if r �, �, • r, 4 , ® Wetland Sample Location Wetland Classifications WETLAND DELINEATION MAPN ■ O Construction Limits Type 6 Minnesota River ARRmommEK::= Chanhassen, Minnesota —♦ Approximate Stream Channel 0 100 f< Delineated Wetlands Feet Imagery Source; NeorMaO, Aprd 2019 FIGURE 6 A' l • '. A. R ' Txt' Iry a� a�5qs a >t + 3 1 , W r r, Construction Limits Weedand Classifications O 0 9 ON• - 2015 Delineated Wetlands f/V Type t BARR —� Approximate Stream Channel Type 61111111111111111111NE= Chanhassen, Minnesota 0 DO '•. • ••- Delineated Wetlands Feet Imagery Source. NearMap, Apru 2019 FIGURE 6 A , y i A O Construction Limits jjw4 Delineated Wetlands WETLAND DELINEATION MAPN 2015 Delineated Wetlands Wetland Classifications O Minnesota —1110, Approximate Stream Channel C3 Type 1 0 100 ' • , . . River , , - Bluffs .. � Culvert Pipe Feet of Imagery Source; NeorMap. ApnI 2019 FIGURE 6 OConstruction Limits - 2015 Delineated Wetlands BARR —♦ Approximate Stream Channel --0- Culvert Pipe r Gx 0 0 100 Feet Imagery Source, NeorMop, April 2019 MINNESOTA BLUFFS LRT REGIONAL TRAIL LANDSLIDE REPAIRS HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY (HCRRA) COOgYMRACT�E'. w,eenw�w xoe iwNM�w 01Z66ElE�DEffi FM/Q PrroetMrreMww xn�.rAwelrm aln. weRYMwn� HCRRA MINNEAPOLIS. MN rvex of sHEE,s OOI .,., TITLE SHEET, PROJECT LOCAUDN,. SHEET WOES ON LESS.. NOTES. ANDNIG-ENU CONTROL DATA O% ... sTATEMEMDFESMSATEDOVANTRUES Op ..,SITE ACCESS. STAMNO. AND TRAFFIC CONTROL: OVERALL R.W.WO NOTEB ONES.._SUE ACCESS.STAOIMO. AN D TRAFFIC CONTROL -PLANS OM .. SUE ACCESRETAOINO.ANDST OF IO Z:OL.FWIAXDMTME OQ/ ... TRAIL CLOEVRESMWAOE Usi OF WfERREY N.E ... MONCi UYOVi PUN "I ... Ex!HUNO CONOInorvS. ALAN OHIO... EFISi1NC CON OUR) 9�PHOTOS CO9 REMOVALS AND TEMPORARY EROSNM CONTROL PUN Gy TE M POR ARVEROMONCONTROLOETMl4 p,p POLLUTION MEYENTNN PLAN pNVPrI DM w TTN OLLUTION PRIZENnory NA SAVAPI CHO TRAIL MOURIUT10NS-PUVMDPROFRE Dy .... MAIL MOLYFICATONS-CROSSSE CTIONS OHIO....nWL S MODIFICATIONCROSS 6ECTONE GIS .... MIL M901FICAOONO-TYMALSECGONE GII .... SOUTH MU SLOPE REAAIR-PI.W p.lE .... SOUTH AREA SLOPE RE PNER. SECTIONS OIS ....MVTMMFA CVLL'ERT OUTLET AND STREIMbWN REPAIR -PIµ CM .... ENEM MEA CUILSRTOUTLET REPAI0. PROFRE AFq YCl10Ns WE ....$OYER MG CULMERT OUTLET REPAIR- SECTIONS AND DETAILS 415 .. STMMMSVM REPAIR -DETAIL 611 ..., AMEN AREA ELOR REPNR.PLAN 61E NC."AREA SI OR RE 'AIFILEFILE. 9EOMER AND OETML 611 STORM SEWER ANDDRMNAOECHANNEL.PUHMDPROFILE C.A SLOEM $EWE R AND DRAINAGE CHARNEL. SECTIONS AND MINIS C.]I .... STORM SEWER AND DRAINAGE CHANNEL -SECTIONS AND MASS RDI ... SEEDING PUH R-0$ ... ERDSON CONTROL RUNNET AND MULCH PUN P. ... MEE PUMIND PVR 0.M ,.,,RERTOPATXINOETALS GENERAL NOTES DATAFROM SURVEVECCNSUCTEDBY RAR11REXAMEERIMOCOPH THIS PLAN EXlAMU.Rl.E T IS A NOF ,U.I.MDUCTEUSVSTorvI.o NMMUMYMISANOM.wRMIUwR roPOONMw. 1 I.ERY, Co,M MR PIROMMl INTERNATIONAL COMP AND HENNEPIN COUNTY, WNM1. AIS. f. MM6OMAL MTIIN AND CODA"NUESYSTEM GRMACOU1CKRCNRTEI. NAMS MRN, US SURVEY ffln A VERTICALMNM'. M. NDE)( AND -i EYISTINO INDIA... Y. EXISTING IRERMELMR CGrtWR CLP.SASTI. EYISiINOPMCIILME —fe EMHIMED BESMRMER w — !"bTNS ARER MIC -. S..'NG EE., IME ® !PMTS. S.... GSEMEM FEB GbT."TREANTN.ALNEO ----- I.SUP. RPMAM BnINFH —WA— eA. NE . - - - - - - - CDNSMUCTMN UulS AG— PROPOSED INDEX CONSTwR —1M— 'Ill. INR RSE SAM CgrtWR —u— PRGVWeD ETMMEMGS —A — PRONGSEDFENCE pnn mle9m eoxluO 0Z, eYLTCL PIESMETE" 0.. ESU..' N. S-1 SORHNLMRING SYMBOLS .-AA A d��MI SECTION MEW CALL OUT d¢fIOM SCHMXI/M (PEP.I SVRcb R SECTION'. GRAPHICS STANDARDS e"uw,M rCrnl SECTION MEW TITLE Ards rRmndR DETAIL MEW CALL OUT urtuE LnNrvRdR pTPJ pETNL GRAPHICS STANDARD PH1d[S A". NR,� GENERAL NOTES. 1. MSMALL. ANDEELOYESUNV LLSAI UTLIHIS IN. To MARK ADAGE.ARLDP. MASS, HS. GWUM L SSMALL N BE DISTURBED IRNGM. LMRMx. COIDRI MNTOR SMALL COORDINATE SURVEYS BEENME ENGINEER TO OSUMEM MELOMTRUYMEI EXISTING CO ASTUM ISSUES ] EON@ACTOR SHALL I.TALL AND MAINTAIN ALL ERGSMN COMTRX. MRS MMR To COMRSESSEERSTLIFFEESESSEENHUR EACH LOCATIDI DURINOCGISAUFMN. EROSICS DIMNESS, PLANS ME P.NOEO INSIDE THE PROJECT STOF AMAULR FpLUTMN EAEKMICN PUN UANR PPI, A CONHTRUCM.MNMRHMSMGMIMEApmommAnnNALCDISTRURMTIUMRSTO BECCpIDMATEDNRHMEf ERA.STAKEDINTME FIELD. 5. GEMI.A.ORUMINGTOBE PERFORMEDCNLYMMINGRAOINOLMM9AND RCCE33ROUTESUNLESSOTME" EGRECTEDRENGINEER. H MEEHTORCIEAREDMLWWRMEDINiERELDBYENDNEER, ALLTREE3YICM DNMETER NOT AGREED ECR REMOVAL SEOUL BE PROTESTED MESS CERTIFIED BYEENGINEER EOR ALDFION.SL PROTECTION BMALL BE PROTECTED OMINRROHTCDLPPLTMN, CLMACEMDp3FMUREMENTINACOSEE HE'MM GMTSPECGATS.PROTECT OFTREES.T NTIFIEDTOBEREM DSMRLLM WCMERAL ..SHALL EASE ENAU M. TO BRINGS IS MANAGER OF AQUAM MMD TERRESGL IHYMNE SRGEH TO THE .. RUP ERT P D R.IBLE. TRAIL MODIFICATIONS CONTROL DATA -ALIGNMENT'T SOUTH AREA CULVERT OUTLET AND STREAMBANI( REPAIR CONTROL DATA -ALIGNMENT "C TYITMO. HTRmduiMMl mMT NG . .Gm. BEAM LENGTHRUPY PcmATNW rtRAIM 1. STATION ENDxom. e.MmMO NORTH AREA SLOPE REPAIR CONTROL DATA -ALIGNMENT WS ABBREVIATN)NS C. CN EARN CLP.SASTI. CLAM OMPIXI.EOtd4 AM. COPRLGPRO METAlgi£ CONC. SMORSTE EL ELEVATOR FEB PULSED ENG HECTIM LE, Y INVEST EIFVAMNB MAXINNE MW! MINNEHOTACEPM RTGETRRNMMMNCM NM MCRNAL VALE" LEVEL RYP REISHNESEOCIXICfElA FEES Mc A COPRU¢AINFORM MEMLNT EARL PIP BASS SYMBOLS .-AA A d��MI SECTION MEW CALL OUT d¢fIOM SCHMXI/M (PEP.I SVRcb R SECTION'. GRAPHICS STANDARDS e"uw,M rCrnl SECTION MEW TITLE Ards rRmndR DETAIL MEW CALL OUT urtuE LnNrvRdR pTPJ pETNL GRAPHICS STANDARD PH1d[S A". NR,� GENERAL NOTES. 1. MSMALL. ANDEELOYESUNV LLSAI UTLIHIS IN. To MARK ADAGE.ARLDP. MASS, HS. GWUM L SSMALL N BE DISTURBED IRNGM. LMRMx. COIDRI MNTOR SMALL COORDINATE SURVEYS BEENME ENGINEER TO OSUMEM MELOMTRUYMEI EXISTING CO ASTUM ISSUES ] EON@ACTOR SHALL I.TALL AND MAINTAIN ALL ERGSMN COMTRX. MRS MMR To COMRSESSEERSTLIFFEESESSEENHUR EACH LOCATIDI DURINOCGISAUFMN. EROSICS DIMNESS, PLANS ME P.NOEO INSIDE THE PROJECT STOF AMAULR FpLUTMN EAEKMICN PUN UANR PPI, A CONHTRUCM.MNMRHMSMGMIMEApmommAnnNALCDISTRURMTIUMRSTO BECCpIDMATEDNRHMEf ERA.STAKEDINTME FIELD. 5. GEMI.A.ORUMINGTOBE PERFORMEDCNLYMMINGRAOINOLMM9AND RCCE33ROUTESUNLESSOTME" EGRECTEDRENGINEER. H MEEHTORCIEAREDMLWWRMEDINiERELDBYENDNEER, ALLTREE3YICM DNMETER NOT AGREED ECR REMOVAL SEOUL BE PROTESTED MESS CERTIFIED BYEENGINEER EOR ALDFION.SL PROTECTION BMALL BE PROTECTED OMINRROHTCDLPPLTMN, CLMACEMDp3FMUREMENTINACOSEE HE'MM GMTSPECGATS.PROTECT OFTREES.T NTIFIEDTOBEREM DSMRLLM WCMERAL ..SHALL EASE ENAU M. TO BRINGS IS MANAGER OF AQUAM MMD TERRESGL IHYMNE SRGEH TO THE .. RUP ERT P D R.IBLE. TRAIL MODIFICATIONS CONTROL DATA -ALIGNMENT'T SOUTH AREA CULVERT OUTLET AND STREAMBANI( REPAIR CONTROL DATA -ALIGNMENT "C TYITMO. HTRmduiMMl mMT NG . .Gm. BEAM LENGTHRUPY PcmATNW rtRAIM 1. STATION ENDxom. e.MmMO NORTH AREA SLOPE REPAIR CONTROL DATA -ALIGNMENT WS TPEIN). RMT RAINM "ART .BIG 1 WARENiI. CFAM. LM 1 RMNC I ID RAAtX RSTATION C.C}AININ I CNOMCRMM 1. IAfTHO rn Em Iwlw,b AN. I U.S. HCRRACHANHASSEN. MN MINNEAPOLIS. MN LEGEND, NOTES, ABBREVIATIONS, AND A)GNMENT CONTROL DATA 90% DESIGN STATEMENT OF ESTIMATED MUANTRIES RLIr MJ.., MEM OesLR1V1' UI31.]% MUNwAllox IUMVSIIM 10s1�1 MMXRXPNI: iu 3UM 110LSW LIEMIX4.. _ _ — IJRC2 $b15U5 9PUPBIM6 ASE Fl TEO i I AL I.M 80%DESION NOT FOR CONSTRLCTION 3Ip.5p RMWFCCN(MRMUNWaI fKN 3 i1p.50E R xF}OMFRR _ fKN l 3 W5@ ]RlV>4F RFNM LSG 1 i W.SW RfMLYF WOLq nfraNlHG XxP )I llp.SN PfMPIF CXMX VXR LANCE UNIT iMB lipESW RFmT'f sFwSnnR l)i0RM1XORlll ai111 LIN FT ) EIp W) faMGf PANWMRIWJI CUrO N) }lp,®1 MMOYtMKFLWIFWSOFBNSINORIx WPf MMN1 LIMSUM ) ]IM.Sp OEarFltRFrPRRKIYMs 57ro IPIR SIOS.WI pWAIIIIMY6 IIIMIAIM ] iMMf (pISr11VCl R[[FSSRORO LVMIfUM ] SIoS.m) EMI1vA)IEMs]wwl aro m1 }ms.Em xANAxoolsroMacaxrArWwrmsn aro )MI 3X6501 NGVAlIp1,CpIMp1 IS tl99U Ilp.$)3 COrMiN EM&WRMXrINI CUrO INM i]]3 W) SVKPRp MY1IMl1[MI NIM W]) zlNsc) AwMMrE wMACIM31NIcuss Lvlau Nro 3Mo.sv wuNIPXM [oxmpl rAou is 3313.Sp RUUnl4RM MSEIM[1/SSs CUro T. i6L5p COMSf IGGREMR NC01N91N1 NY0 B ttl3503 IS- V1NGSx16aKNMRW FJ6rl }y]SU} 31" W R14 NKH UCx 3 350).W3 ]1'MMPpf 5fW91LIPFCSWNLLMILLN VMR )Ol )SCI].Ep MV4iIlL RNONnXIXXI NMSFWfR IMR IN $501.•V) VNIXG<VIYEM IIPEI>S]Iarl]IECW NXM ) 35335p 6FOlE1frI1F fM3E0. rTE1 S4Y0 ]5 RRN00M RIVMI(IAtl 114OIl WLVbM Nro Nl is11Jp Mx MRIYMVCIASSSMLLLLIR3A1 NVO MI i)E1503 MXVOM N%4V(USSSIfCMLIMAI Nro 510 lslLSYr M31CtMWIMV<IAS5111 NYO 193 slxsm MxooMNRw CussW Nro m Sslvv) cRRrNURNInn Nw 303 tsusp cRNuuImMP Moomit Nro o, ssum %KE wVNu EUM ro xsr.V51x51u1cxax LNlx RxCE IMM 3R nn ro] sAenlrtocaxsrwrnax IN, 15h50s SEED F e �j j R ry MN CERCRIMMX HCRRA MINNEAPOLIS. MN "' LANDSLIDE REPAIRS MINS la]olar4p CHANHPSSEN. MN xa.w STATEMENT OF ESTIMATED QUA "TIFF ww Ntln z zsn.ws snrrlxEE, mfws NLM )4M3 nnsp caMMox*clsoRrollRax Nro Nw znseXE Ewslox<oXlxpxwlxE*unmMw 15)s.SVL rINIRf COXCRMF GEWRIU1Mr lsR.s01 1VPI MINiOP[EMENI IMi U1f0Ml wro SYFO SUrO 3x10 llR IP10 153.'b MULCX NA)NIPl T9E1 ]41T 10.M0 MPF )I3 ..w ��...wu�w nwn.Pm•.o eAw .� �.o.... Yw.00 �'. � �"�. 1�� � TT""�r .. 14 .mom.. 4" FRI I. �� � � � (I•i� ila# !!! EPIANOVERAUACCEas LAN HCRRA MINNEAPOm MN CHANHA SEN, MN BITE ACCEM. STAOMO, AND TRAFFW OVERALL PUN AND NOMS . x..a mir- P e 1 T rV'M� ♦♦uy _ ',~ _• p�� `�x- �Y ♦ MCIIM Iy N . woA 1' I 1h ~mss �i�+INIfM.,- \ Y t f-�a'L _ „-.--� \`•�; — w � L �.smxoearo GP LN SITE ACCESS 6 STAQtNQ o xuenrter • Q e OMrw oMPewmven.rcarw i ___ �� ICItI AT w Nl %i�mwnvMaremcmx Q ^e aux rwu mnxm ••r•'•nrvnEr1mrco`rva.w /]\gTroL�METFYPOpACY T �MML M �ea� 'rr , awxeur TMLEI o sir. m °uw wrexruarr.crm°r wue ypr.p I... «��� m6M aeswuwremura FMYACru m i o 4 Y.ANpw..w m.,wpnwaao»drro�.J \ me r.. ou. w�`u'i IT -LI.... 1IlA;pj ITVMINOUSTRAIL RESTORATION 5 Ly �OETAIC GRAVEL TR IL ESTORAiION y p rr W9iDESrN OUSTRL 1Y /IJ1FOIfCQV$iRU:f7LVi — — — — — — — LANDSLIDE REPAIRS •.•+�—•w• — — _ _ _ -- HCRRA CHA."MN. MN iiTo+ m a° MMNEMMIS, MN SITE ACCE55. STAGING. ANO TRAFFIC CONTROL plNtlN OIYAIMpM PIPN AND DETAILS O� O MIRV.w1VR i �1\ PLAN HCRRA MINNEAPOLIS. MN CHANHA!MN, MN �C EC. urour n 00% DESIGN -- ® i\ � w - -- _-----_--- _ MIRV.w1VR i �1\ PLAN HCRRA MINNEAPOLIS. MN CHANHA!MN, MN �C EC. urour n 00% DESIGN I•A•Y.IRUeT WAN VALLlY nm•earz ---------- 1 AN.TNO CONDffM6 ©y W. DESIGN e NOT FGR CONSMUCODN --- LANDSLIDE REPAIRS zammw.01 �« u ------- arc HCRRA CHANHPSSEN, MN MINNEMOUS, MN EXISTING CONDITMS A• U 0 PL L-01 D MV�CN RCIIPIkMI !rc 4 Nr 1 i !rc 4 Nr MoaxvuLv i uoMwrz / PVN:REMOV BN1 TEMPORARY EROSION COMROL sxemrre Q -- ��,.�� _ HCRRA CH.WHASSEN. MN MN00S. MN REMOV&S M O TEMPO WE AR RY mmnww m — e c 0 0 BARB wra wM EROBroN CON1ROL PIAN N CO3c p p / _—�sa�.m.m>.pm�,./--_________— — =— MoaxvuLv i uoMwrz / PVN:REMOV BN1 TEMPORARY EROSION COMROL sxemrre Q -- ��,.�� _ HCRRA CH.WHASSEN. MN MN00S. MN REMOV&S M O TEMPO WE AR RY mmnww m — e c 0 0 BARB wra wM EROBroN CON1ROL PIAN N CO3c p p DOWNSTREPM VIEW carts SECTION VIEW /1 \ DETNBILT FENCE -MACHINE SLICED �w.Cw -SECTION VIEW Y�fi TERIE, M TRIT .-I AY � (A ,.m,,,� o .., ANNRA,: BE ./ [ \ DR 41 U PROTECTION -SEDIMENT LOO DEwR:o l .,.. BIDE VIEW ON SLOPE SIDE VIEW FLAT i (•aVLY.° BEEI E. FRONT VIEW TOP VIM IOL`E A IIA ALILEATLI "T I LEAR IT —1 N 1-11 111 LINE, AE— tiP' 7 urz BNAKLUNN— 1,86L TABILIZED CONSTRUCTION EXIT p HCRM MINNEAPOLIS, MN. i�41F.I. urrnucx RcuAu EATEEM—MINEr..—em EL-1—wunoR. L Tne Tu.En e..-wm.maxovw.oE[wvm.w emuw. ill 1. RCF mrtl.v MFErA CSM 4 v M_bCesd RViwe: eEeT mmCwCcwWmveaewu. ..mv:E YM id CMCI�LNMCWR.VYR5O.o.TE v.N m4vdavEx�vEoviC. L+vpou.RV 1. INE -ALN INALL EREAREN-1 IIINEARA E. ITNENTRIN 1. Tl.—NI A— IEN— ILIA LANDSLIDE REPAIRS CHANHASSEN, MN TEMPORARY EROSION CONTROL DETAILS 90%DESIGN IO,IONACTMIWmm, BRAVADOES EAMM vnDx PREVENM ACYV VSC,MAMKKW MENPMEOINCOWLWICURED TYPE WxNNESOTA ERu STORWI C PADA GGCONSTRCGTgXPLTMYM,MN POLLUTANT PROPAGATE SU E ATEMSYSTE THE MINNESOTA SYSTEM INGM89pPROGRAM, POAIYNGPTXE Nn1bHPL PCLLYinM Cb[X4PoE ELIMWnMX9YSTEN9TniE g6Pb' 4 THE WECTA LOCATED IN THE CRI CF CXMWASEN, CMVFR COUNTY MNNESOTA. PRI EO CONSTRUCTION PCTMRS WLL TAKE PLACE ALONG MDIVSTSpTI DEME MNNESOTA BWFF6 REGIONAL MAIL BEN•EEX FLYING CLOUD RwOAND 4KETP UNE. THE MIAMI CEMROOOFTXE PROJECT MS P LAMJOEDF44 01NBi AND P LCNWIUOE CF 43UC THIS PROJECT INVOLVES MMSNMNCpRRCL ASEARS AND REGRADING OF MROSUDS wNAMOSLOPE5. REPAIR OF GANAGED CGLVERB, WETSWTCN OF 5TORM SEVER AND MNMESSI AND SIDE RESTORATION TXE PPWECT AS PROPWEO MSPTMAL CATURBANC E MEA OF 1 E3 ACRES E RC S ON PREVENTION AND SEDIMENT COMMEM MEASURES ME SECURED TO ANGLES EIW W EPMMR MpiMMINVECRE[K, VAPOR MAN IMPAIRED WARR.REFER i0 PROJECT DRANLDxi3 POSRISS C�ZFOR 1 PIECECT 96E MDCVN iULA NEINPERYIWBBVRF TM MTCMATEO ARE.L Oi OSLUPSNKE M MMS IDMRLY IS] P40.f S. ME ttITAL ASES ME LdbTROG1W W ER BMG M APPROWAELY DA PORES, THE TOTAL AREA OF PopTLGNeTRYC1MN IMPERVIOUS AREA b APPROXMARLY O.A )ARG, • 'HE TOTAL NEW IMRRNWB AR G N APPROXIMATE LY O ACRES. t>-oRTE ANTIMPATED START GTE: TBo AMCIPnIEoexodSTf:iW RX T CSIM CL PTY REGIONAL RMRC.WAUTXORIG AILING ADDRESS: MII 4TH 5.SW CONTACT SON: JESSICA GALAR ME PROTECT MAXAMG ONE NUMBER. SI%]{YEM1 B. ADDRESS ICBME.MUR®HENNENNYS ALTE MATE CONTACT PEPS ON DUNDEE BRXLY TALE: PROJECT EMMEER PHONE MUM.R IB 151. EMAIL ADDRESS. All ETHIC STEILY®xE NNE PIN. US OPERATOR I GENERAL CONTRACTOR IVAE CVERSR MPLEMEMPTKKN CF THE MEW I TBD WILING ADDRESS CONTACT PERSON: TRE. PXCNE NUMBER. MAE ADCESS'. PARTY RESPONSIBLE FREE WAGlMFM OVERARM ERIpRMAND MJMEMNCE OFTIE PERMANENT STdMfMRR MANAGEMENT SYSTEM. NAL RAILROAD ITY MIMING ADDRESS .1 Rx PVP S SHERE rERSON. JESSG CALM DTE: MUNICTMANbER PINE RUSSIA BIUI OME SWEAOMESS JESSICAMGTZpXENNEPIRUS 10 RECEMMVMTERS. MEROTINOEMEIGRESTSMHTMEMMCEITMTMEMELYMRCENESO~TERRUFMXE EPMEN ET% INCLUDE 9ECMLAIRED WBLE ANTE A VTx YA1NK ANSI N VMRR04 Oa SARDINIA, IMPG�N MWniERJlE4 � .LOS ONSIX "EEK AND.M.R. O YEA NO O REc E e aISCG nO x IN TYEEMMRES: MTCx.PoXo. METLWo wLCMEOUS EN. LANE. 5,AM RNER F) PARR B]OI MENTNGTICN ODI MMR ACT ME AVAILABLE FOR ALL METER ROGER. USE THE SPECIAL AND LONGED AARR35GRMTOX. AT NITTS:/NISVSrAATATE W.U& ROTMNWPTER4P CWANdMPAIREDVMRRSSEMCX (S) REFER TO WWPERMI RECTUM 23.IMPMEDWARR FM THE FOLLOWING FALLMAMry1M 5TRESSMISI: PNWPMMYB MNTNR DC BWTTA IFENNTS TIUM ObMssIXs3 lM.MVATIC PLARNAGARO 9ESSEMTOTAL �NMONDAWDATE MCPGX,11BRnRMYO£M. NONSESSMEMI n OYGMINOIMM.IREOWATEE: TIE MMA'S SPECIAL AMIMPAMEOMTERS SEARCH TOLLARS LEVI LOGR SFECML MPA REC'M' TERSMRXIN ONE MILE ARAI RADIUS EMUREMENTIM THE MWECTSE S UEORIEDM M EPAVAPMWEDIMPADMEM FOR TURINIY AND N6ABNRA MAE MPAIRMMSME COEICEREDCgIBigVCIICXPE4TED EAD DECLINE .DDERRMRST NUMMAGOVEEIR'RACRCESIMPBIOR PLAN RENEW NPCONPUPNCE MM N THE GENES PERMIT ESW MCORIMAL BW50R QUER SMISUD CONSTRUCTION RELATED MPLEMEAURMAGMAMEASGNNTNNCINMMMWED TOTAL MNMUM GAILY LANG (MD-) INCLUDE IMME DATE STABILMPTEN M EPKSE D SM LEGS MO CONSTRV C V M CTA RMPMARY SEGMEMPTM SAL IN EOP CORA CH ORI LCwin pSTMCR T SERVE AN MGVSMSM MOREAES.b8W PERMIT REM 1.1 R PEfYMMTO,9 TICMOJERMESNOTINCLYM .MKNPUBIEVARE. ESOT IEPMREME111 SS V2TGNDMPMR. TXM MOMCi CQS NW NCLVDE VIETANDIMPPLTB. IW W PMMR EM 24AN02 M ANOSECGiHYII LAM OTIERRECUI EVENS: STMMV.ARRMR NMWVRESMENEREOUNEDMA ULTMMENNRONMENTAL RYIEW IE GMV.,EM EMI, ENw2MEREDOETHRGM TEDSPECIES RENEW. ARCNEOLOSIML BRE RENEW.OROT ER LCGL STATE .M EOEPAL RfVIEW [MWLTEOFM TXE PRW ECT.IW W PCRNR EM 3A, 3 B, MO 5.1N p0 NMMMFASM CRIKINO VMRRSUPEY MINM[MEMARFAS. MBPRWECTMES WTMCLUOEANYMNSTM MNMW VMRRSV PLY IMNWEMENTAMGEI WRPMRREN918.18, ISM, M01610/ REONREDFMTME S FEi HVNBEF PROJECT LCCPTCN ANDCCM6TXUCTX)X LIMITS COR EXEMAQAMDFIMLOMRS, IN0.VWp DRPIMDEMMSVNDARTES, SPECIMENS Op,FIW.10 CF ANDPLLd RMR MERESTORNNF.TMISIfPVM10TNESEDR 9ME.=R AND TO MINIMUM CHANNEL AND B RESNPAKK EROSION AND BOOM IN THE MARMOTS EMRRIMASVRWLEMMRR CHAR. ESB EXPECTED PRESENT GO.A., OF RANGE FSOLBERT)E M SCI TAPE. AT ME BRE • IOw}GHB OF PISNMU. SIMFACE6 OPWI • LCG1k19 GE... ACT BE BE METTEA E D IS D,. SUFERIDXE3.YK14HW, ETC.) OM,b1AD15 LOCUTIONS ON ARAM DE STEEP A. OCSGxGm LOCATIONS OF AREAS AREAS DOERR UOTWW ARIL BE FINANCED I MMA. DUNI M OF EAMES.... POSITIONS OF THE SRS THAT GRAIN IO A PERIOD MATER LMll MS VAR x N MASTER DM RESTRICMNRS FCR MN SLAV SSE.RN EFRARRI MATIONS OF ALL TEMPORARY AND MONUMENT E0.05KKR AND SEDIMENT CONRAD. COS.OGEOER BAPS AS RE W IR EO IN KEPT SECTIONS 3 THROUGH 10 AND 14 THROUGH M • BUFFER IDN ESAS R EOMRED N PER MR REM 9 1 AND 2311 ..G -MC -A LOCATIONS OF ACREAGE MLLUTgFWEM RATING SCRAMS MAI N IN AMR G AlIA015 TPNCMDOETAILSFG ERWXNIMOSEUMEMCONTRABMMTOBEIMTALLEO ATTRESPE 001 4i1L •IT.. )?£Ell' PERMANENTLY CEASED. NE OR MORE Of THETS A E FORI METDI HODS. P RM SPI AWM . DAMON$ EOMAFIEM OMCEPUPI CURN PE RW ITS M RE) P. EROSION PREVEMNM IMREME ARMOR TMLINE3:IWW ERMF EMS SA, e A THROGI M, ANO E3% 6TAMLPATILW OF EXPOS ED ME. AREAS IRCWGNO STOCKPILES) NP L BE MINTED IMMEDIATELY TO DMIT S R D M ANYON PLRTENN EVER MY CT MM SITE WILL NOT ME POR A EREO EXC.GM3 IDRYT, FEE PC. WASCINTLY ON PONARILY FMR DAR. IF THE M HE [XWBID.1 AREAS AN TO A MCHMM b EMERGE PGTHAT MRS. ME MILE ISRAEL 4 S MFABUREMEMI M A MECMI M MARRED WATER IBES SECTION SDI, RABEATEN OF GPCSED SGL AREASINCLUDING STCCWILE% A E EE)STATED IMMEDIATELY TO UM. ER.. NEMER MY CMS1N W MIN MTAK I ME E ONGESMY M TEMPMAREY CAMEO M ANY FORMS UTNE SE AND MLL NOT RESUME FM P PERIOD EXCEEDING TGIENDAR DAYS, TEFMLQ ACTMTIESCMMTHAWTOINIMRS.1.1: PREPRNOTHESMFOR COMTE. STDRN MAIN RELATE MILL BE PAOTECTEO YALE ALL SOWCES MOR PoRNML MR dBCMMGXO TO M INLET MVE BEEN STPBu¢LD. INLET MAGRI SWE POLL BE SE GMEM CONTROL LOO, RTE R SPINS. ORlQU EM MEASURES A VENk1ETRACKINCBMPS IWWIERMRl MSRMDLTSI TINEAS COXSRUCMmu AREAANOWLLMELUOE:T SOCKAIDSMDMUMiBSORIMILOM' AY S R SM OD. NATURAL SUPPER MUM E PRESERVEDN CONSTRUCTION MEM u USCNMR•u — SPECMLMIMPIREDSURFACE GROSS FA SPECIAL M IMPNREDSUNIACE MASTER N LOCATED STAN 1%EET M THE PAWECrS EARTH MTURMNCIS ANO RMMIATSR ROM TRIP W.IACE WATER, M VMENA BUEER IS INEPfiMLE REWMMM 6EMMEMCMTROLS POLL 55 PRONGED. REWNMMNELAAIIMMR0NAW3MLL.11xSTILLEOATLEMT5EUAMRTUNLEUUMEDBY LACK OF E WE OFSEWEMATEx TREPEREMCNEPOSGUIEG. PRALINES' , FLOCCOVMtt, BTC.1%NOT AITEIPATED AS PPMOFTHE PROJECT, IW W NERMRREW 552 ANDS10) 10. THEPRWECTM1u AOTICwR 1ooRYMEACRESOFMTMBEo9OLMAMIxGioP COWCN TI.�CSW�R MSECIMAR PN NO GREAT SA SIN UGH OR SAC OUINNO ALL OCCUR AS PART M THIS PPW WEOTOTARGE M NOAVECETAME STASRDATbN, APPLYING MELON MOTHER NM VEGETA G UCTTM E EXPOSED 6M MG. M SEEDMO M RPARSO T1E BEACHED MEA P 4 IMP MACH FACTORS: THE FMLOMXOOMP DESIGN FACTORS FAIR BEEN COMPOSED IN DESIGNING PIKE EVEpNMEMMES TXEF0.LCNIMne M.ERMKKNPREAGAVEN LERbNMM AOORCMW IWWESMRRGAN'. SS..WD EMEGRAL JI•HMEVENTIMMDSEDMENTCDNTROLSMPS 3 EXPECT ECAMWM,FREQUENCY, INTEMSRYANOWRATWOPPREgPRATMN. METIICOSALLSEIMLEMENRDPTTEESREWRb0.]uCREN 8.101 LL BE MEO VMERENER WARBLE TO AID M ERMMN PRMNFIM. SM OISTUREAXCE AMINI TAT ON ALL E ME S SRI G MM EREVER NABOB TO LIMB MPMCD IOL AND REM T NATURE OFSTMMRPRR RUNMFANO RUNCNATTXE SITE NCLUdNO FPCTMISVGI PS EXPECTED F*�FMR! IMPERVIOUS SURFACES. BUNSEN AND SE ORMNWE FEATURES. MVARRVOLVMS VELOCITY MD PEAK RCW RPRSiOMINIMME MCXPRM MPOLVFAM9M IF NG VEDE FRI L SERVES XPNRAL VEGETATIVE WEER3. 9ME.=R AND TO MINIMUM CHANNEL AND B RESNPAKK EROSION AND BOOM IN THE MARMOTS U} EDSOLMBREPSM 8NIVIMLLEETABILOEOUSMSERMCNCOMRCLM.ANKETS ANDOO. CHAR. ESB EXPECTED PRESENT GO.A., OF RANGE FSOLBERT)E M NI MONSLOPE DIAGRAM WILL BE MIRED TO MEREAMS MORROW PTENMl ENTAL e. i IVO GEL BE MSOTO ASSIGNED 11O6KU POUNDAL. Mxr AN UENuuMINNEAPOUSwrvE HCRRA I CHPNHNB6EN. MN , MN 6TORMWATER M" UTILM MEVENTION 90% DESIGN AKN ., GEE ..WI ANMr[YBRM! REd1MED FREE E MEGT RESULTS I.. ECM W AAM[ OF M.IWIRYYMNI aMRRECIS GA REONA NA NET NCRW[CE p1lq LtgA AGGER OF C... N!W ANNE. SUMPCM N TOY. M R' T2 PROU ECT! .1 OF A L UM N. NH EN OF CELCVMM E. ICdN KAI RT TES.T Tub, 1.1 KRWM ..AxI.A TRGMM SV . IF FOR NMF NI. REAR S,IS, UTY,"A AM 11 THAT w NOTA IUGR MaecT WM IACROPRIOMMNVV. ryawMRAATReM 1sn IT TMT PROJECT DOES NOT gacnEllOC TO n ApIEATRGM ICM ATIpMMr TO A TIIMaTAEEMSICAW MRMR RUN 11"1 6_2 MASFW9mPnN AIONA PAINEDIEd•LLTI91ACwIXTNKMFARRESRMPp1MpE SUPERVENINGINSTALL ING O, ANOWMENEW lROINAI RR[A4 NIEJN AXD lIdYEM q BNPSATTHE9RE REPAIRING INSPECTING WCINCNMJMMEAMORESNNNet[FAIN WWATgN ESN TME GENETµ MRSPIE UryTIL TN[ CONSTEUCION CIMIIES ME C.0 W LCR. PERMANENT E.A EBB eai ISTMANNEO. MDA SOFTESTORRMRMTCN REST HAS RMI.. ICSW MRMP ITEMS IM, 9)1, AND II AMO TOTEM III MESE MLINpYLT ARE IN FENNER N RCIORDAMCE WE THE REQUIREMENTS OF ME GENERAL PERMIT N0.URAMENTREQUEN WW WTTMC WAWGKMKMMMWLLBECL NSMATEMTMME MLRTVN.'S FM gRIEa AND RESKNBMNRB. BELOW A UST OF KRIE RESPONSIBLE NR TES PROJECT READ ARE KNOWLEDGEABLE AW EXPERIENCED IN THE MNORTNRWOOFF 1[AR� .M[WMRN MD SEGMENT COPPED, eEAS. EMC E1PZdtRIC6 Ci PBMMWOAT!W MI SPLINGFURYDEARMJGT NUUEAK.EUl TBD WIDE.. RE EMPP IUVLEMENTA. RD TED 1W RRRMMWCEO EENT"ABPEcigxe NG TRD 1® KMONMANCE M SVPGVAM OF TED TED RIKNOTAPMAIN DANCE. AND WES 'TA.VMq dFUMEMATON AGITATE �NR3 LdR �OFMKM% SCN9 ATRE'IDKRWLLRd LX[ YMftM EEM[CgOTRUTONOTI AT RLGEAKET MEI'WAYi I WYS.1. AGAN TEUCipI • MATRON N HOURS AFTER A RAINFALL EWER GREATER THAN Q REALMS N RMWRS ITHECTICAN KETLEICV MAY M ADJUSTED UNDER ME F0.LANNUM CMATAWEB .OF, FAULTS DA THE ICIRM MEM IVE PERMANENT CON ER EM WORK AS.. ON OTHG PARTS GENE ST[. NSK CLASPS OF THE MEAS PAH PERMANENT GOWR NOW BE REDUCED TO ME KMONEY R . WHERE GdgTRICTNM MEA! IK PERMANENT CUTER AND W CgOTRUCTCN BCTMIY 4 OCCMRND W LINE SITEGM SE FIGURES 1. .1 KR. MD. Iz M]MM, MAY BE SUSPENDED T-0MKEiENLv UNTIL COMTRUG. CTM1Y AESOMES. NEER BCTNRY NM SUBMERGED SKRGED qTO FASTER MGM CONDITIONS. THE INEEPECTELATY BE SUSPENDED. ME REQUIRED INSPECTIONS AND INNEIWE SCHEDULE MST BEGAN WSMM24 HOURS AFTER NUMATE OCCURS AT THE ORE MPoINK MBVMMG CONSTRUCTIONNNE , MEVER COMES FIRST A S NSKCTWw R EWNUARTU MMC STIR LWBtt ~M R5RENMECIWIWLLMALUMIMKC DTT FFOLLOWNOMEis ICew PEAMRSAR n.EMRGRN 11.N LLL GoaaM MEVENTW MD RDREMmxrREwPo Aro PouvrlOX KEvexnW MAIGERM uCMINes FNKMOC�eOA?IT7�SFMOO UADIUSILMEME OfCREATE STREETS AND SUNNI TRADINGOR SHEaAPEIF s .,Ar TO R sROED,AGR ewc W E OF OFF ARE JEcuwulNAR a SEGMENT 04 RMEREEN FEE REONREUENT.S MMMEMWE OF THE FML AREAS AND BANK NEIL R PERFORMED AS N[LOtC ICSW P[RMT III Ma II T NM—N II.0 • NGFNJCTIGxAL AMPS "LL XF RETIRED PRESAGED. OF SUPPLEMENTED WITH FUNCTIONAL TWO M R MD • Ci CONTROL GAVRES sIu,v DEF TER gCREAOVEEYA RELACEMMLOcpNMbN9 A EN THEY LIT MNEMNCR.L OR ME SEMeuT REAL EF! S OF THED E HEIGHT OE0 ON f THE DEVICE LEMENTED NNEX THEY e[cWE • TEMPORARY ANO PERMANENT SEDIMENTATION GENS FELL BE OPMNED AND THE SEDIMENT REMOVED WREN SHAG UM OF SEGMENT CCLLECED N MI NNIN AVCXES I a ME OULANDE VOLUM,• . DILTM MDa[GMEM IXF[NNTION SMFIA! NNTERsvA.t E REMOVED ADD THE AREAS AERIE SEGMENT MRESULTS N EMPoSED SOL WALL R RL TABIL¢EO. ME REMOVAL AW STAMRATIGV WLLE W TSDY ] CALENDAR DAYS CT WCOMIRY ONUS$ PRECLUDES BY LEGAL. REGULATORY ON RMC4 ACCeK CO VIAE. [ NNUUMEO WEIO ACCESS ccxsANUNKMR NTS. REASNE ETO M. ACCEN WALL BE USED REMOVAL AW STABILIZATION NILE TAPE PLACE MTNx )uLENDAR GETS OF GRRMIO CCESS• . • Mw NMEENDENT OERE STABILIAIONVALE BEROiAEI11SO n5 NMESMRYETOTAGNEEDAY RREQIIRED CGVER. A1RfCGIDIEEmD REDNRRMEMBOSW KRWf ItEM411.11 nnDzl9 nxDa[cipxa a nxDMl MUCROIMDTRHERIKKWI ECV!nCTN11FT0N'MNlWBEREWRDEMDM .RFOODOACAII ]ENJURe OYEAF M.nClryRv ELLNALVMM1GATT AND TME,INECMSKCTPANAMA OFINS l e OOFFECIEW x5(LGAME TKA,/ ER]VCdV MNBLEENER )AND xFELLEVEMTSMEAMRMENOSMHE51xEMpANDMEAWMcRAINPALENP, EAT ENENG WCTION ELOCATNAXOAPPEANCEFHU TTLELOY SE5KKEMMMm PED AWES , GE aMEEN, AxDOTR CENWS MIZATOES OF Ai 1u BE WCVMEMEDAMA PNOTNRAPN WLL BE TAKEN. ]. PW1LLMAM NMDTOIXCLUCEAO.E .b LdIDEMMPOCMRECTMCNEWM AA1VFPESSSITUATINS FAMUNWR ENTRE IB A "AND" IF DESIGN. cCNBAUCINn. OPERATION MWTEXAWS WEEMRC AR OFSEASOORWNDNATIGENE ONDEIKKISTIT MM A SAGNIMnxT CEECT ON ME RECHARGE OF POLLUTANTS TO IEC1bNS ON NVESTSON". BY ME "T" "A"" OPEMTW. ON CONTRACCTTORS OR ByNUAEP. WNGk FFEWS INDICATE THAT THE. IS MIT AN EUMITND OR AMAZING THE MI E CRGE OFNALvrAMB TOT ADINGE PATENS M DRWMARATER. THEROE9 ARUSGA AKN ATTER O � STANDARDISCIEWICES OR THE BVAM MO PPF AMENDMENTSI ANY TO MN SERA PROPOSED AS A RESULT CP ME IEPECTW FALL BE WCUMExRO AS AMRIVOMENTS FEEL BE COMPLETED BY AN APPROPRIATELY LEANED IxCMpIAL LEANED S NrvIXM10 ME STRINGENTUSE A LESS BMP ARE MCLUR A 1V91RICA.TCX MB CLAWS XON ME REPLACEMENT BNP IS MARCTERgMS. RECORDS BEENTIONTHE AT MPCK. BALLOONED ALL CLAMPS TO R, MO maPCTION AND NARD WE R ESTE DURING CtM'SITUCTCE BY ME KRMRTEE WHO HAS CPEGTtlxM [EMTRIX CELT THE ME EMPP CAN BE KEPT IN ETIER A RENO CLEF ON P M W ARE WEIGLE DURING MC WMpW MNIRB ARMENIANAGRIIY ME NRVREEe WLL WE TME SPFPP. NCLURMPBRCTW REPgiS, WIEALS IEF THAI RDA" UPWCIGUENDS AWOESTTMEd TIE DURATION OF LEEPERMIT TCOWRRGE AMNO TDA REE YEARS PGL WMp ME NOTICE OP T E RMNATFN. ♦. AGNE YEAR WELL R CCLLCCRRSTMED. AW MNCEDOFIMCPERY M CWNMNCE MY MINNESOTA KNTMLE TORETS WOAILINEGNMNRJWOfwSR[TOIMWlMAWWALL IGR TLOGGED EMDVMAPMAMBYNNMORE CMSDMEOOLRCNE TANCMATTERSRMAR6SYAND 9WTOLL HeEeDg AND D ASUE0T 0REEY TO R ARM MEAN META CHAPTER HTPoR ULTTRE ALLVFMTEO AXMWMEESM E NAU.EI WSREDIz51 0. VICLI EMBLEM FEEL YOCCIM DESIGNATED AREAS FL RSIZED APPROPRIATELY ONE O{MNILEASiAMMNTLRE1CFESTED.FINAL N'S ABLE BE LABELED AM CONTEND EIFURCCMAMXWSO MEBWMVMOTECETAGLOIO.SKLMLOERECTEDTOTMNE90AdoGMS*EWRE D eYNNUMATMGEc�xISSTESwPERMnEDx3AT AYFUEL OniiuoKwSmAAL LTEPLYLLOCCENRSnioOO FFUEANNAMEMUSTYTAnoelOSwrtT TYPE ANCEIRLYEAKEENTANNED. WTLLEOLLLY WdFRO. WI MSSIW LW MGC idl FLGAY3NNIDONSLFPALLEOTANKR. SIAM duOES lwi VES. ETC.ION SE REMORO ERCT TM YFRX N IF F WEREEPONSEMCWDE ME PG9WASE STEPS TO PRVFMME . C6CHURK OF SMILES M LGKEDCEMGLS. AN MGNMERECHEMF4 NELWLLBELMDEDMVNLOMED. FS—MF=e MNPAE OR Ae5 KR SUNLESS MFOSMLE PERFORM *UOULAR PENEUSENTATINE ON TKABLI AND FUEL LESS RCTIGR WELSHEDI THE AREAS F UPON COMNCTION OFNS ATM R WNEW OGWR WV BF WOETATVE M WELOGETETNE ASAVPRCMOTE F STABLETHIME NET OF HE C M RMAY INC LUDE I FOLLOW W AGUMI E 59 E GEA M AND OFFOGEONOUGETR INLARRATS KEYETUMIll OICTM TOCHMNET'KRM.AWNTCWER' THE FIXLWINO REOUIREMFMa MUST BE CSWPERal.—NF MNT GIU A AIL SdL gSNRtlWLCOXSR CTICMR AOE IACTIVITIES HAVE BEEN COMKETEOAND PERMANENT COKE HAS MENIETUUGONGRALLMEAS. VEOETAMECOVERCO Ta OFAUNFORMPERENNMLKOETATMM WHAMNS"C NMCFEISEAKCrtOFINALORGMM. WOETATONIENOTREOVMeDWORETME SKCIM AREA OCTATTS NO VEGETATION RUCN AS IMPERVIOUS 4VRF.KCBMTI! WC OTAN"DITEEL A ALL HAS BEEN REMONIED FROM UUOAAFYANEF� SYSTEMS. INCwgW CULWATS. MEM ERGERN MEVERTPI IAEVEN .10.BMP9 MAV! BEEN BCNPIIORAR. WTEMPORARY vN Po... TO DECCMNBE DELETE WY BE IIFi M PLWC. a AMAMETFAMII COxV SARECWN[ AWTCEOFTERMNATIONIWFIFDRMNILL Be TURNETnoTOMEMKA HCRRA MINNEAPOLIS. MN ARE AM ANA FKAL �•r M�T�MI HUNES, EFFNE 1f/N1MtlYM WM i•NCNRN },AMLIR� IAiNMIFNi 6wCM9.M.MMW IIA 1 CVNCNP, , STATIC CNE CALL .IR ]TATE OE CALL GAL RPoII! rW GG. Ian.9.". CEUNIU65EN, MN STORM WATER POLLUTION PREVENTION PLAN UEGROP) On DE" __ _ 1 1 I _ V.ppl1 uenm 1 � Y / // Mwnw iewrtw[ 1 1 -�ffP T- _ --------------- O _- k� 99 a� 6� eA K ------------------ 1 MWI .. Mx�°° AO%DESIGN �e.. i ADTPDRGDNmRIcwN --- lA1JDSLIDE REPAIRS 231010I4.M _ r:a•�s rcu,.,mn HCRRA CHANH/SBEN, MN .av _ _ _ _ _ _ = MINWWOLIS, MN TRAR MODIMAMN8 _ A l D P PUN MD PROFlLE C47 D I IIMIIYI RODIIIIGII W OPfER D IrDJ PopbR m 3r• i (�' c Wm m u y .q • �• A tl s s% 'tly m A 1• 0 �• tl M •� WRRR M1• i y y 1• • n P N tl N• A m• I ��• �N �Y �tl b `Y{N W OFNl1 Wp SW �wtaJ PopflR OrW rom i y y n0 • w ID ••• A tl ``IY M b OePoR � � a40 !rW «• - tl0 m "S• m i m .• e m a tl a w .m Iw n m �« �• m i p y ,• • w N N tl '"a,• m TM Poowee "4e—.o - m i .m a w a a w Y tl m«. 1•e'• � WOfgR bC•]R _ _ fi 3r• v.» • E_- __ _ w E., AM IN m i y y �• m w r N b ` a '� i i• �• ID a tl Y w A w w `��' A'm p y y .1• • �• a tl• m A« �P I�• �ID �P wo-��• I nwww OR DESAIN aa. NOTFORCONSTRUC110N UN... REPAIRS N 2310101404m tlwlww - •r HCRRA CNPNNDSSEN, MN a ^m^.w — wapNgt%waw MINNEAFOLIS, MNTRRILMODIFICATIONS v e, riur eEWeEo • p C 0 0 t i �"wM, n.eaxm µp 7w ��. ,�... ,,.ii xevNPxxecnnpx rn Mawr .woe w.emwueo n�ammr �:. �' .m CR0589ECTIONS TION6 CAB 0 PoWALi l.fl un wan! f = EMm o 110 C.1■ HCRRA MINNEAPOLIS, MN 100210110.. ■■ NONE. u ■■ •::■■ ■EME■MEMEM.BE mann II.N 'N::::::: LANDSLIDE REPAIR'. CHANHASSEN. MN TRAIL MODIFICATIONS CROSS SECTIONS 0%DESIGN .Y wan! f = EMm o 110 C.1■ HCRRA MINNEAPOLIS, MN 100210110.. ■■ NONE. u ■■ •::■■ ■EME■MEMEM.BE mann II.N 'N::::::: LANDSLIDE REPAIR'. CHANHASSEN. MN TRAIL MODIFICATIONS CROSS SECTIONS 0%DESIGN ,eF------------------------ i IN -N-.- \ N. MM�i nwwn�w[nrcrwxf,,, 4rteRl o,Efwa�l %15E61I0N TRAIL MOOIFILATION ITVPICALI-STA. Srp5 TO 7,75 : LeTaec4 NCfMOP,9,l yr�� roonwrtamrnw rC6Nwr6� Ia[rMte�rarcevr,mm11 vrm,varsrxcxor,�> tl�pRpp.. Mee.,an w'.see w�w't�nva,n�rw nc.,mia���. U e�wewaorwrmxnMwn SECTION TRAIL MODIFICATIONITYPICALI-STA. 1.75 TO FM ANCSTA 7q5 TO 12.00 T. HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIR CHANHASSEN. MN TRAIL MODIFICATIONS TYPICAL SECTIONS 90%OESUM IECENo D RMR.P NRERENiCRUMCM IMT ftEMIR[COXCR[ROCMRIY •—•—•—•—• \�� \\ /�j • Rewaa •ui f 1e �� I iav[ci eM� 111 aRueRi /nuC Rwe M . In•.l I 1 j 1 A I l iRoorcAu+x. WtTTH MEA $LoE REPAIRQ 90% DESIGN NDTWRCONSM4 --- LANDSLIDE REPAIRS ]SIDq ��••�i------- evert HCRRA CXANHA66EN, MN MINNEAPOLIS, MN SOUTH AR EA ELOPE REPAIR w e o vola ait M mI R WRMPbIU Bn xwRwxn xa R R <µxn SECTION. SOUTH AFEA SLOPE flEPAW l lmiw TMA tt R R _ R R �15E TION SOVTHAREASLOPE REPAIR POi.'OESTR& NDT FQQCONSTRUCIgN " LANDSLIDES z3�moAo� � HCRRA CHMIMA6SEN, MN EN MIN DARR MINNEAPOLIS, MN SOUTH AREA SLOPE REPAIR cgI1T.7x B C D D SECTIONS O_IZ p mluliu n.uu�.wammi e,' � ... ...... T ---------------- I Ui CULVERT OUTLET AND STREAM" REPAIR r unN.. W% DEM NOTFORCONSMLCTION --- LANDSLIDE REPAIRS 331DUH4,M OM _a _------ ranrt wnE HCRRA LHANNASSEN, MN mna _LBA m MINNEAPOLIS. MN SOUTH AREA CULVERT OUTLET AND e < o STREAWANK REPAIR RAN C-13 0 MY}p10lBLIIRKW � MLM.-< IFY .a mw. -1.1 M i IoM, . orw...c�xre. NW.L.m.waorwm.. �.m�w"0 m.m+o mxM.ne° mr�mmm. WMNIR,GN.Iwa.MN WxM EM..M M�.M'm 1MAMIW2H.@wn�. Tp IOM. WIR4 wm MaMOMgMNNI1MmMYC1Yl i11 SECTION CM A CMVEAT BLI LINE wa�wmv N. NOMINEE IEEE � m --- _ osmmmw j(f4 1�„wc xnrc ["lpR FIL OUTLET AND STREAM CMPfJNEL Ijl SECTION. STREAMCWINNEL n BOTTOM W TH S w w oULVFA e m mn.. °vuwrtm ..r✓.ux�r 90%OSSIDN i NOTro2caysnrucnoN LANDSLIDE REPAIR$ 33o£cB�va i HCRRA CHANHA66EN. MN „ MINNEAPOLIS, MN BWTI AREA CULVERT OUfIET REPAIR nFImMNMYR1I1bN PROME AND SECTIONS c-u o ME e� (na' eeULDFA CROMV E Mnu ---------------- ------------------- ------------- zza7 SELTpN VIFWD vivmiwr �amrruoro n AcfTIDN MEW L L PLAN VIEW ] OET.1 TI LINGBASIN HCRRA LXAN WSSEN, MN MINNEAPOLIS. MN SWTN MFA CULVERT OVTLET SECMNSANDD TMLS �OFI; RIPAAP TOE PROTECTION s 6 i R ADT FCW CON HCRRA LANDSLIDE REPAIRS CXPNHASSEN, MN 23101014,0a 6TREAM&1NR REPAIR DETAIL _ C O 0 I MINNEPPOLI6, MN [scxITON C-16 O -------------------------------- 1 PLAN. NORTH MEAaOP REP R Z appER HGRRA MINNEAPOLIS, MN NDSLIDE REPAIRS CHANHASSEN. MN fH AREA POPE REPNR PLAN W% DEM EPNOFRE NORTH NMA BL OPE REPAIR cW nam re.xa�oxw�ru L// ppaeuwueea �D �erw,ODD wraewm �Reemarwn � ,�� grm.ava,o�vvuuoe v ,wwnrannrm, mas,vwam.: on. -- fMM,�a,wx� � •xwrs `\\ � wSL�i .. n. m ,a, `rveweowor,uueFnmw w0-�w n ^ earmxwu�m 0 my �aoa,�ioro wiar .,o z 1. a .a n d°' mrwm..I a rsrt[n+uzow,xw¢eanw,e.n,:. /}1 SECTF]N NORT MFASLOPEREPAWI6T M331 ^pQ enw xoswaarxvamas Al y/IyE FENCE OESIOX VNKCWTEp EPNOFRE NORTH NMA BL OPE REPAIR cW nam LANDSLIDE REPAI HCRRA CHANH EN, MN _ -.... - nn 11 -_ i MINNEMOLIS, MN NOR PROFILE, SECTION, ANO MTNL re.xa�oxw�ru L// ppaeuwueea �D �erw,ODD wraewm �Reemarwn � ,�� grm.ava,o�vvuuoe v ,wwnrannrm, mas,vwam.: on. I � •xwrs `\\ � wSL�i .. n. m ,a, `rveweowor,uueFnmw w0-�w n ^ earmxwu�m 0 my �aoa,�ioro wiar .,o z 1. a .a n d°' mrwm..I a rsrt[n+uzow,xw¢eanw,e.n,:. /}1 SECTF]N NORT MFASLOPEREPAWI6T M331 ^pQ enw xoswaarxvamas Al y/IyE FENCE OESIOX VNKCWTEp LANDSLIDE REPAI HCRRA CHANH EN, MN _ -.... - nn 11 -_ i MINNEMOLIS, MN NOR PROFILE, SECTION, ANO MTNL _ _.-•- ___________________ t • • • � / • r • — _ _ _ _ _ � _._ _ _ — � IIWe • r 1c1C• _ _ _ � _ � _ � tAplYf.HLRiI•LOgMK _ —•��—• wwaw �.—. � A A—.� _ x.wrRH uro•re. mn emu sti .0 r r.me v /� `ue Basr I ___ __ __-_-_- • / ri menu mrtae�� ... u .[rniu.caes.n r[ wa»¢a � eNx•a. .MM,r.,M4M.,n - ---------MMS' --------------- ------- ------------------------- , , ' M STORM n HxuaxweruoMwaweerw ronworo i{� rrewner � © ra w•ew _ Y, Y'U ��r�,w xw[RHaxl 11-��i MRLV TRUHL w[Wru irtnourvu •FVHere�wmr o S wnae,.oe_ _______ __ ____ - NMneP.R•M em g FF nx.x.x Hnp�er,.. oe`ow xu..H. m si -- p r.ma •.we 1 ewe ��me x�n .me sr PROFU STORM R A eECHMNEL •e.a DoE "•�meu NDi WFCON51R1,CilON1M LANDSLIDE REPAIRS a6�+m6�+,a NCRRA CHRNHAg6EN. MN n•.•a+nn. _ _ _ _ _ _ uN MINNEAPOLIS, MN STORM SEWERANO DRAINAGE CHANNEL w __ A p 0 PLAN M'O PRN O.IB O F ro MVtlRM RBCApRCN — .� aM rwaRun -�� vA oe RUM iwo rn Rwuu a am wunr• a1R - 1Y� 1 1 I I 1 hd IQ OETAY:OE OLRIP rA1 BwrCeuu�rtmu LYIlR O m� 9urornaw� mm.iaxr. ® moue x=ia Nuxu r�ar.wumn�resu�mrm nrw " (B'\ 8EECo�.J rzu.r er "i P ga RCCK ..ECK mvxwwr R rae � i muururmunwEOE.awi mROCK CHECK on ME �ql SECTIORUCK CHEC9 HCRRA MINNEAPOLIS. ON CHANHASSEN. MN W% DESIGN IIN WMA®/MO .vC/.PtPOIi _ rnx;rm �ia'YaER� \ I FItYtE WIOERDLCYi AAM.I . _. �'rana[ m..cROEDwmroznv..r.ia....ueeew.. ` mw"�`�ro°mw.:u�l�wmo�w.�mmM:aom°O�.cinu•am...wu�me at uwnw.wrvr.AaMr.r.. sEOE..E.. r.AMAL"00Arow.I.L ..E.wEowc.E.E.E��o.wa.rc.ax /{1 SECTION. DRAIN MAI'LL. MMMMI AM 1. .�wwr reuxere. xro/n OYPRLMD RDIt �� LL�P'unPO �ry�.w EM. aPOI. tn.pvt0llilP. OFF% OF ALL 1�1 .......... .I wEwu. wro m. w. IAA AAMFLA.. A, OE,%FLEXIBLE CONCRETE GEOGRIO INSTALLATION F WUTAT OR APPRovgo EQUA61 f__ --- —.— LACHAI EREPAIRS iDohio+Aw !imms.nw. _ wn HCRRA CHAN1U63EN MN MINNEMOLIB, MN r ALL STORM SEWER AND DRAINAGE CHANNEL ....�. A / 0 D 0 ,.__,�.. _ _...._ I BECTIONSrWDOETNLS 4fT D'd F anEE. E..N.14,y.wr.Y.1.1"AM......wnR.. neuro Eo.EwtN.wui........ WR. wt IF mu...r .D.L. ......... on Tox N.OWMALAE ... ""`t""'""' . FLEXAMAT FmtW w... v.....1 A.... .11,m �RwC . .oN.elDt STANDARD CHANNEL DETAIL NTS OE,%FLEXIBLE CONCRETE GEOGRIO INSTALLATION F WUTAT OR APPRovgo EQUA61 f__ --- —.— LACHAI EREPAIRS iDohio+Aw !imms.nw. _ wn HCRRA CHAN1U63EN MN MINNEMOLIB, MN r ALL STORM SEWER AND DRAINAGE CHANNEL ....�. A / 0 D 0 ,.__,�.. _ _...._ I BECTIONSrWDOETNLS 4fT D'd N coo HCRRA MINNE. OLIS. MN C UNHA N. MN SEEOINGP W%OESGN nt C UNHA N. MN SEEOINGP W%OESGN � a rcw 5 0 ; 00 00 ig ;l l ---------- -------- 3t i § , i P 1/7 -IA z/ — — - I L ly �Kn ue� e ^DETNI TREE PLNITMG <nl,�.cwTes ® Aen�.,Iww, weeaevueow ��� sswma.wo I L ly �Kn ue� e ^DETNI TREE PLNITMG <nl,�.cwTes 8 WTED WEE P 8 W UNDSLIDE REPAIRS " HCRRA CHNJHAS'N MN MMNEAPOLS. MN I TREE MMTING PIAN 3,. ARIALL AI43 At At —E AM— KOR Of SESEK� AN TOP 01 ML E-- ARD—TLY AVIEFIRTO IRRAIR RA I—e`em n ILA. L'IE „.e . .� R«� I.Rama INTERM TIENT CHECK SLOT TRM ANCHOR PATTERN TOP ANCHOR TRENCH <) R;N6,TURF REINFORCEMENT RMT I&At..11.NR.K.,,. LLAARCARKE-- EOG- TERMINAMN ANCHOR TRENCH &1%DESIGN wrnuoaie wevnHCRRA Ir CHANHASSEN. MN AEAR "NEAPOOS. MOET N 1 RESTORATIONAILS APPENDIX C Threatened and Endangered Species Review Memorandum resourceful. naturally. BARR engineering and environmental consultants - Technical Memorandum To: File From: Tyler Conley Subject: Threatened and Endangered Species Review Date: 12/05/2019 Project: Chanhassen Slope Failure Project Barr Engineering Co. (Barr) has completed a threatened and endangered species desktop review for the Hennepin County Regional Railroad Authority (HCRRRA) Slope Failure Project. The project area consists of 9.58 acres centered on the Minnesota River Bluffs LRT Regional Trail. Located within the City of Chanhassen and City of Eden Prairie Minnesota, Section 23, T1 16W, R23N. Federally listed species are protected by the federal government under the Endangered Species Act and require consideration for projects involving federal permits. State listed species are protected under Minnesota's Endangered and Threatened Species Law and must be considered for state level permitting requirements. The project area was reviewed for federal and state listed species and their associated habitats that may be found in the project area. This desktop review was completed in November 2019 using a combination of data available from the United States Fish and Wildlife Service (USFWS) and the Minnesota Department of Natural Resources (MNDNR). 1.1 Federally listed species The USFWS Information, Planning, and Conservation System (IPaQ identified two federally listed species as occurring within the project area, the northern long-eared bat (Myotis septentrionalis; federally threatened) and the Rusty patched bumble bee (Bombus offinis; federally endangered). No designated critical habitat for any federally listed species is located within the project area. The northern long-eared bat inhabits caves, mines, and forests. According to the MNDNR, the nearest hibernacula is over 6.7 miles southwest of the project area, and no maternity roost trees have been identified within the vicinity of the project area. To minimize the potential impact on the species tree clearing will be conducted between November 1 and March 31. Therefore, project clearing activites completed prior to April 1, 2020 are anticipated to have no effect on northern long-eared bat. Rusty patched bumble bees are typically found in grasslands with flowering plants from April through October. They are typically nesting in underground and abandoned rodent cavities or clumps of grasses above ground as nesting sites. During the winter months, queens typically overwinter in underground cavities in upland forests dominated by maple -basswood or oak -hickory trees. The project area is located within USFWS designated High Potentail Zone for the rusty patched bumble bee. The USFWS Section 7 guidance recommends USFWS consultation for projects located within the High Potential zone. Barr Engineering Co. 4300 MarketPointe Drive, Suite 200, Minneapolis, MN 55435 952.832.2600 www.barr.com To: File From: Tyler Conley Subject: Threatened and Endangered Species Review Date: 12/05/2019 Paye: 2 1.2 State -listed species Barr Engineering Co. (Barr) has a license agreement (LA -898) with the MNDNR for access to the Natural Heritage Information System (NHIS) database, which was queried in November 2019 to determine if any rare species could potentially be affected by the proposed Project. Two state -listed species have been previously recorded within the project area; American ginseng (Panax quinquefolius), and smooth rock cress (Boechera laevigato). In addition, the NHIS database identified five, state -endangered, threatened, special concern or watchlist species have been documented within one mile of the proposed project area (Table 1). Five native plant communities were also noted. Table 1 Rare Species Documented within One Mile of Proposed Project Area According to MNDNR NHIS 1: Habitat information obtained from MDNR Rare Species Guide: httpsY/www.dnr.state.mn.us/mgfndex.htmi Kitten tails is the only state listed threatened species identified within one mile of the project area. Primary habitat for the species consists of oak savanna communities on north facing slopes. No such habitat is present within the project area. The majority of the project area is densely wooded deciduous forest with a southeast facing slope. No dry prairie is present. Therefore it is unlikely for the species to be located within the project area. The remaining state listed species are listed as species of special concern. These species are monitored by the DNR but are not protected under state law. Federal Common Name Scientific Name Status State Status Habitat' Primarily found in oak savanna communities, though it occurs in dry prairies and oak woodlands. Plants show a preference for partial to open light and Kitten -tails Besseya bullii N/A Threatened upper slopes. Some populations exhibit a preference for less xeric north facing slopes in prairie habitats. Soils are most often sandy to gravelly, well -drained soil derived from alluvium or limestone. Smooth Rock Boechera laevigata N/A Special concern Found to occur on slopes in mesic Cress deciduous forests. Chondestes Typically in dry short prairie grasslands in Lark Sparrow N/A Special concern areas with sand or gravel spoils with some grammacus bare ground and scattered trees. American quinquefolius None Special concern Typically found in well-developed forest GinsengPanax soil, mesic loamy soil. Gophersnake Pituophis catenifer None Special concern Prefers well -drained, loose sandy andgravel soils. 1: Habitat information obtained from MDNR Rare Species Guide: httpsY/www.dnr.state.mn.us/mgfndex.htmi Kitten tails is the only state listed threatened species identified within one mile of the project area. Primary habitat for the species consists of oak savanna communities on north facing slopes. No such habitat is present within the project area. The majority of the project area is densely wooded deciduous forest with a southeast facing slope. No dry prairie is present. Therefore it is unlikely for the species to be located within the project area. The remaining state listed species are listed as species of special concern. These species are monitored by the DNR but are not protected under state law. APPENDIX D SHPO Historical/Architectural Resource CR -CHC -049 Memorandum resourceful. naturally. BARR engineering and environmenlol consulronis Technical Memorandum To: Jessica Galatz From: Joel Swenson Subject: SHPO Historical/Architectural Resource CR -CHC -049 Date: 09/15/2015 Project: 23101014.00/004-100 c: Kristin Alstadt As part of finalizing Task 2 and moving into final design, Task 3, the HCRRA (Hennepin County Regional Rail Authority) and the Barr design team needed to understand the existence and extents of any wetlands or fens within HCRRA right-of-way. This would include anything that would impact the design option selected by HCRRA. A preliminary desktop review of the site was performed by Barr staff in February, 2015. A complete wetland delineation was recently performed June 17, 2015. A report summarizing the preliminary and final wetland delineation findings was submitted to the HCRRA in July. In addition to the wetland delineation, the Minnesota State Historical Preservation Office was contacted by Barr staff to perform a database search for potential historical and archaeological resources within this area of Section 25 and 36, of Township 116, Range 23 in the City of Chanhassen within Carver County. According to the SHPO database, a historic feature (CR -CHC -049) is placed south of the landslide as shown on Figure 1 (also attached). Figure 1. Historical/Architectural resource database results Barr Engineering Co. 4700 West 77th Street, Suite 200, Minneapolis, MN 55435 952.832.2600 www.bw.com To: Jessica Galatz From: Joel Swenson Subject: SHPO Historical/Architectural Resource CR -CHC -049 Date: 09/15/2015 Mae: 2 The Historic feature is listed as a house (highlighted in yellow in Figure 2). History/Architecture Inventory Rom,'�u6¢ .eowm �l uaUR .M&Cu 414 m41 W. 16M 6 161.Mlvn B i*e. On t 166 me BMF6 ce�rra.6r6 M6rn.6amel.ne c®emersy eis rl.e6 ce.6aa C�emen66q slsss>q cl,.ed6e ,yl 2Mfl2q(bYOne Cas D.Mft 2e5n� Figure 2. Historical/Architectural Inventory lM v B WSW 9i¢ Q� 116 v M ftw w Q 5 116 n M Ytgs Q 116 v M a ea• M4M" 116 n M 1F.NG' M�' 116 it M W# Q�GOM 116 v M nam n'�010 116 n M W# Q To further investigate the potential for cultural resources within the project area or vicinity, Barr staff scheduled a visit to the SHPO office to pull the file for this Inventory Number CR -CHC -049. Upon arriving at the office, it was determined that a file had not been created for this inventory number as of the afternoon of July 10, 2015. Julie Hillenbrand (a grant process facilitator at SHPO) left a voicemail with Barr staff KNA the next moming on July 11, 2015 stating that their independent contractor who they hire to create the files has not provided them with any documentation for this inventory number. Julie and Tom Cinadr (property information/database searches at SHPO) both indicated that they had no idea when they expected to receive files for this inventory number. CITY OF CHANHASSEN AFFIDAVIT OF MAILING NOTICE STATE OF MINNESOTA) ( ss. COUNTY OF CARVER ) I, Kim T. Meuwissen, being first duly sworn, on oath deposes that she is and was on January 9, 2020, the duly qualified and acting Deputy Clerk of the City of Chanhassen, Minnesota; that on said date she caused to be mailed a copy of the attached notice of Public Hearing to consider a request for an Interim Use Permit (IUP) for the purpose of repairing landslides along a portion of the MN Bluffs LRT Regional Trail, Planning Case No. 2020- 01 to the persons named on attached Exhibit "A", by enclosing a copy of said notice in an envelope addressed to such owner, and depositing the envelopes addressed to all such owners in the United States mail with postage fully prepaid thereon; that the names and addresses of such owners were those appearing as such by the records of the County Treasurer, Carver County, Minnesota, and by other appropriate records. Kim Meuwissen, Depu C`e� Subscribed and sworn to before me thisi� day of 2020. Notary Public Nalmy A t .SAN M cT•- , M.tiw '. war �""'w""•�arw This map is neither a legally recorded map nor a survey and is not intended to be used as one. This map is a cormpilation of records. information and data located in various city, county, state and federal offices and other sources regarding the area shown, and is to be used for reference purposes only. The City does not warrant that the Geographic Information System (GIS) Data used to prepare this map are error free, and the City does not represent Mat the GIS Data can be used for navigational, tracking or any other purpose requiring exacting measurement of distance or direction or precision in the depiction of geographic features. The preceding disclaimer is provided pursuant to Minnesota Statutes §06.03, Subd. 21 (2000), and the user of this map acknowledges that the City shall not be liable for any damages, and expressly waives all claims, and agrees to defend. indemnify, and hold harmless the City from any and all claims brought by User, its employees or agents, or third parties which arise out of the users access or use of data provided. This map is neither a legally recorded map nor a survey and is not intended to be used as one. This map is a compilation of records, information and data located in various city, county, state and federal offices and other o,urces regarding the area shown, and is to be used for reference purposes only. The City does not warrant that the Geographic Information System (GIS) Data used to prepare this map are errorfree, and the City does not represent that the GIS Data can be used for navigational, tracking or any other purpose requiring exacting measurement of distance or direction or precision in the depiction of geographic features. The preceding disclaimer is provided pursuant to Minnesota Statutes §466.03, Static. 21 (2000). and the user of Mis map acknowledges that the City shall not be liable for any damages, and expressly waives all claims, and agrees to defend, indemnity, and hold harmless the City from any and all claims brought by User, its employees or agents, or third parties which arise out of the users access or use of data Provided. «TAX_NAME» xTAX_ADD_L1s «TAX_ADD_Ula xNext Record* (TAX_NAMExi ikTAX_ADD_L1» dTAX_ADD_L2w Notice of Public Hearing Chanhassen Planning Commission Meeting Date & Time: Tuesday, January 21, 2020 at 7:00 P.M. This hearing may not start until later in the evening,depending on the order of thea enda. Location: City Hall Council Chambers, 7700 Market Blvd. Consider a request for an Interim Use Permit (IUP) for the Proposal: purpose of repairing landslides along a portion of the Minnesota Bluffs LRT Regional Trail. Zoned Agricultural Estate District A2 . Applicant: Jessica Galatz, Hennepin County Regional Railroad Authority Property Minnesota Bluffs LRT Regional Trail Location: A location map Is on the reverse side of this notice. The purpose of this public hearing is to inform you about the applicant's request and to obtain input from the neighborhood about this project. During the meeting, the Chair will lead the public hearing through the following What Happens steps: at the Meeting: 1. Staff will give an overview of the proposed project. 2. The applicant will present plans on the project. 3. Comments are received from the public. 4. Public hearing is closed and the Commission discusses the project. If you want to see the plans before the meeting, please visit the City's projects web page at: www.cl.chanhassen.mn.us/2020-01. If you wish to talk to someone about this project, please contact Bob Generous Questions & by email at bgenerousCo)ci.chanhassen.mn.us or by phone Comments: at 952-227-1131. If you choose to submit written comments, please send one copy to staff in advance of the meeting. Staff will provide copies to the Commission. The staff report for this item will be available online on the project web site listed above the Thursday prior to the Planning Commission meeting. NEWT Sign up to receive email and/or text notifications when meeting agendas, packets, minutes and videos are uploaded to the city's website. Go to www.ci.chanhassen.mn.us/notifyme to sign u I City Review Pmcidure: • Subdivisions, Planned Unit Developments, Sne Plan Reviews, Conditional and Interim Uses. Wetland Almraticre, Rezoninge, Comprehensive Plan Amendments and Coda Amendments require a public has,, before the Planning Commission. City ordinances require all property within 500 feel d the subject site to M notified of IM applicatun m writing Any miereeled pant in Invited m attend Me nursing • Stag prepares a report On" subject application that includes all pertinent Information and a recernmandalon. Those nspaM me available by request At the Planning Commission meeting staff will give a verbal overview of the rapod and a recommendation. The item will be opened for the public to speak ahold the proposal as a part Of the hears, process. TM Commission will dose the public Merirg and discuss the item and make a recommendeion tot" City Council The City Counx9 may reverse, affirm or modiy whi or party Me Planning Commission's recommendation Remmngs, land use and code amendments take a simple majority vote of the City Council except moorings and land use amendments from residential to CommercMglndustrial • M,nnecbta State Statute 519 %regmProcessed res all applications to be prossed within SO days unless 9s log icanl waives this standard. Some applications due to their complexity may take Miami months to complete. AM WWn wishing to bll an item through tM progeee should check with, the Planning Department regarding its status and scheduling fa the City Council mashing • A neghboMico l a pokesgnortim,maimmOve is encouraged to provide a coniM for the city. Often developers are encouraged to most with the neighborhood regarding their proposal Staff is also available to review the project with any interested Mrson(s). • Because the Planning Commission holds the public heanrg, the City Council does not Minutes are taken and any correslsadenca regarding ma application will M included In the report to IM City Council II you cosh m havesomelning b be included in the repsid, please contact the Planning Sleff remon named on the notification. Notice of Public Hearing Chanhassen Planning Commission Meeting Date & Time: Tuesday, January 21, 2020 at 7:00 P.M. This hearing may not start until later in the waning,depending on the order of the agenda. Location: City Hall Council Chambers, 7700 Market Blvd. Consider a request for an Interim Use Permit (IUP) for the Proposal: purpose of repairing landslides along a portion of the Minnesota Bluffs LRT Regional Trail. Zoned Agricultural Estate District (A2). Applicant: Jessica Galatz, Hennepin County Regional Railroad Authority Property Minnesota Bluffs LRT Regional Trail Location: A location map is on the reverse side of this notice. The purpose of this public hearing is to inform you about the applicant's request and to obtain input from the neighborhood about this project. During the meeting, the Chair will lead the public hearing through the following What Happens steps: at the Meeting: 1. Staff will give an overview of the proposed project. 2. The applicant will present plans on the project. 3. Comments are received from the public. 4. Public hearing is closed and the Commission discusses the proalect. If you want to see the plans before the meeting, please visit the City's projects web page at: www.ci.chanhassen.mn.us/2020-01. If you wish to talk to someone about this project, please contact Bob Generous Questions IN by email at bgenerousCdlci.chanhassen.mmus or by phone Comments: at 952-227-1131. If you choose to submit written comments, please send one copy to staff in advance of the meeting. Staff will provide copies to the Commission. The staff report for this item will be available online on the project web site listed above the Thursday prior to the Planning Commission meeting. NEWT Sign up to receive email and/or text notifications when meeting agendas, packets, minutes and videos are uploaded to the city's website. Go to www.ci.chant�assen.mn.us/notifyme to sign up! CIM Review Procedure: • Subdlvisiona. Planned Unit Developments, Site Plan Reviews, C.d,tlorml and IMenm Uses, 6Potlaltl Atlareiae. Rin onage. Comprehensive Plan Amendments and Code Amendments require a Public hearing before tll6 Planning Commission City ordinances require all property within 500 Met of the subject site to he notified of the application in wi ing Any interested parry is invited to attend the meeting. • SIM prepares a report on Me subject application mal includes all Pertinent information and a recomme,Maeon. These reports are available by request At the Planning Commission meeting staff will give a verbal overview, of the mood antl a recommendation. The, item will M opened for the public to about, about IM proposal as a par/ of Ms hearing process. TM Commission will close (M Public hearing and discuss the item and make a recommendation to the City Council The City Counal may reverse, affirm or n 0y wholly m partly tM Planning Commissro . recommendation. Reaocdngs, land use ant coda amendments lake a simple majority vote of the City Council except rezonirgs and lend use amendments from residential b commerciallmdushial. • ams Stall Statute 519 all applications Io M 60 daya the applicant wanes mit Some Some rr complexity due to mar complexity may take several months to whole too completeparson Any person wishing to an item through IM rough th s should ch cilow process ahnap check with thesaf Planning Department regarding its h end scheduling for the City Council meeting. • Ae a Ovide to provide a vented lie the dry. Oftenh are encouraged M spokespereonaepresameir Is aril meat with the n with the pr tl regarding their propwah Stan i Ste i also available to review, me project any mte pereonls). any land • Because the Planning, Co alon cation IM public hearing, the City t does riot Minutes ere taken and any m t any Cng correspondence regarding int ce regarding Mal will ni included In int opal to me to Me Council. n yw wish to have something to M III mtluded in rte replease contact gre Planning Stan named M int ngrl(IUticn. contact not PIN TAX -NAME 254090030 MATTHEW J CHRISTENSEN 257560410 JOE MORRISON 253350020 SUSAN V RECH 257560390 TINA RISCH 253350030 JOHN D & BARBARA J FORCE 257560130 CHRISTOPHER & MICHELE A 1 FAZI 257560400 DANIEL LOST 253350010 PAUL W & SUSAN M ALLEN 257560140 JUDY E MANEY TRUST 257560150 STACEY M BURROUGHS REV TRUST 257560160 MICHAEL KANE 257560420 HEATHER HOLLAND NEUBAUER 257560170 MATTHEW T KEEN 257560430 WILLIAM & ELIZABETH PETA 257560180 CHRISTOPHER & ERIN WETMORE TRUSTS 257560440 PAUL A & SHERYL A CARLSON 257560190 SCOTT ANSETH 257560200 DANIEL W ABERCROMBIE 257560500 SETTLERS WEST LP 257560210 PHILIPPE O SCHWOB 253300100 RUSSELL A LEIGHTON JR 253320160 MARY E BRIOL 253320270 MICHAEL PARADIS REV TRUST 253320230 BEVERLY ZIMMER 253320250 SCOTT LINDBLAD 253320240 WILLIAM N DECOULOS 257420120 ELIZABETH M VOGEL REV TRUST 253300110 KEVIN E & JANET S WINTER 254090010 BRYAN & ANGELA MALONEY LIV TRUST 253300120 NANCY MADSEN REV TRUST 250360700 BEATRICE I ZWIERS IRREV TRUST 250360200 MOON VALLEY AGGREGATES INC 250350800 GORAN PU11C 250350700 ALAN L10NGERIUS 253300140 LEO RICHARD DEE & KAREN COUGHLIN DEE TRS 253320260 MAREN DVORAK 253300150 BRIAN JAY BIELKE 253250050 JEFFREY M GOOD 253250040 THOMAS GNANAPRAGASAM TAX -ADD -Ll 10 PIONEER TRL 100 8TH AVE S UNIT 106 1000 HESSE FARM RD 10005 TRAILS END RD 1001 HESSE FARM RD 10012 TRAILS END RD 10017 TRAILS END RD 1002 HESSE FARM RD 10024 TRAILS END RD 10036 TRAILS END RD 10048 TRAILS END RD 10053 TRAILS END RD 10060 TRAILS END RD 10065 TRAILS END RD 10072 TRAILS END RD 10077 TRAILS END RD 10084 TRAILS END RD 10096 TRAILS END RD 10096 TRAILS END RD 10112 TRAILS END RD 1025 HESSE FARM RD 10377 HEIDI LN 10421 BLUFF CIR 10440 BLUFF CIR 10441 BLUFF CIR 10460 BLUFF CIR 105 PIONEER TR 1075 HESSE FARM RD 108 PIONEER TRL 1101 HESSE FARM RD 11111 DEUCE RD 11111 DEUCE RD 1161 BLUFF CREEK DR 1190 BLUFF CREEK DR 1201 HESSE FARM CIR 1221 BLUFF CREEK DR 1225 HESSE FARM CIR 1231 BLUFF CREEK OR 1251 BLUFF CREEK DR TAX -ADD -L2 CHANHASSEN, MN 553178627 HOPKINS, MN 55343- CHASKA, MN 553189520 CHANHASSEN, MN 553174594 CHASKA, MN 553189527 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHASKA, MN 553189520 CHANHASSEN, MN 553174594 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174594 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174593 CHASKA, MN 553189527 CHASKA, MN 553189516 CHASKA, MN 553189534 CHASKA, MN 55318 CHASKA, MN 553189534 CHASKA, MN 553189534 CHANHASSEN, MN 553178660 CHASKA, MN 553189527 CHANHASSEN, MN 553178659 CHASKA, MN 553189526 ELKO, MN 55020-9591 ELKO, MN 55020 CHASKA, MN 55318 CHASKA, MN 553189515 CHASKA, MN 553189518 CHASKA, MN 553189515 CHASKA, MN 55318 CHASKA, MN 553189515 CHASKA, MN 55318 SITEADD 10 PIONEER TRL 10029 TRAILS END RD 1000 HESSE FARM RD 10005 TRAILS END RD 1001 HESSE FARM RD 10012 TRAILS END RD 10017 TRAILS END RD 1002 HESSE FARM RD 10024 TRAILS END RD 10036 TRAILS END RD 10048 TRAILS END RD 10053 TRAILS END RD 10060 TRAILS END RD 10065 TRAILS END RD 10072 TRAILS END RD 10077 TRAILS END RD 10084 TRAILS END RD 10096 TRAILS END RD 9841 TRAILS END RD 10112 TRAILS END RD 1025 HESSE FARM RD 10377 HEIDI LN 10421 BLUFF CIR 10440 BLUFF CIR 10441 BLUFF CIR 10460 BLUFF CIR 105 PIONEER TRL 1075 HESSE FARM RD 108 PIONEER TRL 1101 HESSE FARM RD 220 FLYING CLOUD DR 100 FLYING CLOUD DR 1161 BLUFF CREEK DR 1190 BLUFF CREEK DR 1201 HESSE FARM CIR 1221 BLUFF CREEK DR 1225 HESSE FARM CIR 1231 BLUFF CREEK DR 1251 BLUFF CREEK DR 3.01162E+12 CITY OF EDEN PRAIRIE 250351710 HAGEN LAWN & LANDSCAPE LLC 3.01162E+12 MARK W & SUZAN R KAMMER 257420110 JONATHAN P & JOANN DIMINO 3.01162E+12 KARL REYNOLDS & CHRISTI HART 3.01162E+12 THOMAS A & KELLY A HOPPER 3.01162E+12 KRISTA A HAYEK & PETER N WHITE IV 3.01162E+12 MICHAEL &AMY RUETZ 252640160 NATHAN H GRIFFITHS 3.01162E+12 JEFFREY J HOLM & JENNIFER EKEREN-HOLM 257560010 MICHAEL A & CHRISTINE M MANNO 252640150 TRUST AGREEMENT OF RICHARD & CATHERINE M 257560020 DANIELS LAUN 257560300 SCOTT LAUERMAN 257560030 SARAH J BREIT 252640140 ANN K LONSTEIN REVOCABLE TRUST 257560040 JASON BURLAGE 252640130 JOHN M & LINDA REVIER 252640120 RYAN & COURTNEY DUNLAY 257560310 AJEFFREY KARSCHNIK 257560050 JARED JOHN GRUNIG 257560320 ELIZABETH A FARRELL 252640110 KIRK D HEISSEL 257560060 JASON EMMETT 257560330 LENNART J JOHNSON 257560070 WILLIAM J ROUSE 252640100 ROSS LHABBEN 257560340 JON FRANSWAY 257560080 STEVEN C KIMES 257560350 ROBERT G DAUB REV TRUST 257560090 XIANGDONG LIN 252640090 JENNIFER M PALMQUIST 257560360 CHRISTOPHER C ATTERBERRY 257560100 JAMES DOBCHUK 257560370 STEVEN R PASCHKE 252640070 PAULJTAUNTON 252640080 JIMMY M & MARY E ROANE 257560110 RANDALL S & MELODEE D BROOKS 257560380 MATTHEW 1 WILLIAMS 257560120 RICHARD BARBARI 8080 MITCHELL RD 850 FLYING CLOUD DR 9600 HIGHVIEW DR 9751 MEADOWLARK LN 9800 TRAILS END RD 9805 TRAILS END RD 9812 TRAILS END RD 9817 TRAILS END RD 9821 DEERBROOK DR 9824 TRAILS END RD 9836 TRAILS END RD 9841 DEERBROOK 9848 TRAILS END RD 9853 TRAILS END RD 9860 TRAILS END RD 9861 DEERBROOK DR 9872 TRAILS END RD 9881 DEERBROOK DR 9901 DEERBROOK DR 9905 TRAILS END RD 9912 TRAILS END RD 9917 TRAILS END RD 9921 DEERBROOK DR 9924 TRAILS END RD 9929 TRAILS END RD 9936 TRAILS END RD 9941 DEERBROOK DR 9941 TRAILS END RD 9948 TRAILS END RD 9953 TRAILS END RD 9960 TRAILS END RD 9961 DEERBROOK DR 9965 TRAILS END RD 9972 TRAILS END RD 9977 TRAILS END RD 9980 DEERBROOK DR 9981 DEERBROOK DR 9984 TRAILS END RD 9989 TRAILS END RD 9996 TRAILS END RD EDEN PRAIRIE MN 55344 CHASKA, MN 553189503 EDEN PRAIRIE MN 55347 CHANHASSEN, MN 553178826 EDEN PRAIRIE MN 55347 EDEN PRAIRIE MN 55347 EDEN PRAIRIE MN 55347 EDEN PRAIRIE MN 55347 CHANHASSEN, MN 553178550 EDEN PRAIRIE MN 55347 CHANHASSEN, MN 553174591 CHANHASSEN, MN 553178550 CHANHASSEN, MN 553174591 CHANHASSEN, MN 553174591 CHANHASSEN, MN 55317 CHANHASSEN, MN 553178550 CHANHASSEN, MN 55317 CHANHASSEN, MN 553178550 CHANHASSEN, MN 553178552 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553178552 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553178551 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174592 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174592 61 ADDRESS UNASSIGNED 850 FLYING CLOUD DR 9600 HIGHVIEW DR 9751 MEADOWLARK LN 9800 TRAILS END RD 9805 TRAILS END RD 9812 TRAILS END RD 9817 TRAILS END RD 9821 DEERBROOK DR 9824 TRAILS END RD 9836 TRAILS END RD 9841 DEERBROOK DR 9848 TRAILS END RD 9853 TRAILS END RD 9860 TRAILS END RD 9861 DEERBROOK DR 9872 TRAILS END RD 9881 DEERBROOK DR 9901 DEERBROOK DR 9905 TRAILS END RD 9912 TRAILS END RD 9917 TRAILS END RD 9921 DEERBROOK DR 9924 TRAILS END RD 9929 TRAILS END RD 9936 TRAILS END RD 9941 DEERBROOK DR 9941 TRAILS END RD 9948 TRAILS END RD 9953 TRAILS END RD 9960 TRAILS END RD 9961 DEERBROOK DR 9965 TRAILS END RD 9972 TRAILS END RD 9977 TRAILS END RD 9980 DEERBROOK DR 9981 DEERBROOK DR 9984 TRAILS END RD 9989 TRAILS END RD 9996 TRAILS END RD CITY OF CHANHASSEN AFFIDAVIT OF MAILING NOTICE STATE OF MINNESOTA) ( ss. COUNTY OF CARVER ) I, Kim T. Meuwissen, being first duly sworn, on oath deposes that she is and was on January 9, 2020, the duly qualified and acting Deputy Clerk of the City of Chanhassen, Minnesota; that on said date she caused to be mailed a copy of the attached notice of Public Hearing to consider a request for an Interim Use Permit (IUP) for the purpose of repairing landslides along a portion of the MN Bluffs LRT Regional Trail, Planning Case No. 2020- 01 to the persons named on attached Exhibit "A", by enclosing a copy of said notice in an envelope addressed to such owner, and depositing the envelopes addressed to all such owners in the United States mail with postage fully prepaid thereon; that the names and addresses of such owners were those appearing as such by the records of the County Treasurer, Carver County, Minnesota, and by other appropriate records. Kim Meuwissen Depu Cler Subscribed and sworn to before me this day of 2020. Notary Public V M✓Y H JEAN M, Noma waw jw„.na S-CAW1150 This map is neither a legally recorded map nor a survey and is not intended to be used as one. This map is a compilation of records, information and data located in various city, county, state and federal offices and other sources regarding the area shown, and is to be used for reference purposes only. The City does not warrant that the Geographic Information System (GIS) Data used to prepare this map are error free, and the City does not represent that the GIS Data can be used for navigational, tracking or any other purpose requiring exacting measurement of distance or direction or precision in the depiction of geographic features. The preceding disclaimer is provided pursuant to Minnesota Statutes §466.03, Subd. 21 (2000), and the user of this map acknowledges that the City shall not be liable for any damages, and expressly waives all claims, and agrees to defend, indemnify, and hold harmless the City from any and all claims brought by User, its employees or agents, or third parties which arse out of the user's access or use of data provided. This map is neither a legally recorded map nor a survey and is not intended to be used as one. This map is a compilation of records, information and data located in various city, county, state and federal offices and other sources regarding the area shown, and is to be used for reference purposes only. The City does not warrant that the Geographic Information System (GIS) Data used to prepare this map are error free, and the City tices not represent that the GIS Data can be used for navigational, tracking or any other purpose requiring exacting measurement of distance or direction or precision in the depiction of geographic features. The preceding disclaimer is provided pursuant to Minnesota Statutes §466.03, Subd. 21 (2000), and the user of this map acknowledges that the City shall not be liable for any damages. and expressly waives all claims, and agrees to defend, indemnity, and hold harmless the City from any and all claims brought by User, its employees or agents, or third parties which arse out of the user's access or use of data provided. «TAX_NAME* «TAX_ADD_L1» ((TAX—ADD—LZ) «Next Record»sTAX_NAME» uTAX_ADD_Llo «TAX ADD L2» Notice of Public Hearing Chanhassen Planning Commission Meeting Date & Time: Tuesday January 21, 2020 at 7:00 P.M. This hearing may not ' start until later in the evening, depending on the order of the agenda. Location: City Hall Council Chambers, 7700 Market Blvd. Consider a request for an Interim Use Permit (IUP) for the purpose of repairing landslides along a portion of the Proposal: Minnesota Bluffs LRT Regional Trail. Zoned Agricultural Estate District (A2). Jessica Galatz, Hennepin County Regional Railroad Applicant: Authority Property Minnesota Bluffs LRT Regional Trail Location: A location map Is on the reverse side of this notice. The purpose of this public hearing is to inform you about the applicant's request and to obtain input from the neighborhood about this project. During the meeting, the Chair will lead the public hearing through the following What Happens steps: at the Meeting: 1. Staff will give an overview of the proposed project. 2. The applicant will present plans on the project. 3. Comments are received from the public. 4. Public hearing is closed and the Commission discusses the project. If you want to see the plans before the meeting, please visit the City's projects web page at: www.ci.chanhassen.mn.us/2020-01. If you wish to talk to someone about this project, please contact Bob Generous Questions & by email at baenerous(ccDci.chanhassen.mn.us or by phone at 952-227-1131. If you choose to submit written comments, Comments: please send one copy to staff in advance of the meeting. Staff will provide copies to the Commission. The staff report for this Item will be available online on the project web site listed above the Thursday prior to the Planning Commission meeting. NEWI Sign up to receive email and/or text notifications when meeting agendas, packets, minutes and videos are uploaded to the city's website. Go to www.ci.chanhassen.mn.us/notifyme to sign up! City Review Procedure: • Subdivisions, Planned Unit Developments. Site Plan Reviews. Conditional and Interim Uses, Wetlantl Alterations. Rezonings, Comprehensive Plan Amendments and Code Amendments require a public hearing before the Planning Commission. City ordinances require all property within 500 feet of the subject site to be notified of the application in writing. Any interested party is invited to attend the meeting. • Staff prepares a report on the subject application that induces all pertinent information and a recommendation. These reports are available by request At the Planning Commission meeting staff will give a verbal overview, of the report and a recommendation. The Item will be opened fm the public to speak about the proposal ase pan of the hearing process. The Commission will close the public hearing and discuss the Item and make a recommendation to the City Council. The City Cound(may reverse, affirm or modify wholly or partly the Planning Commission's recommendation. Razonings, land use and code amendments take a simple majority vote of the City Council except rezonings and land use amendments from residential to commerciallndustrial. • Minnesota Slate Statute 519 99 requires all applications to be processed within 60 days unless the applicant waives this standard. Some applications due to their complexity may take several months to complete. Any person wishing to follow an Item through the process should check with the Planning Department regarding Its status and scheduling for the City Council meeting. • A neighborhood spokesperschmepresentative is encouraged to provide a contact for the city. Often developers are encouraged to meet with the neighborhood regarding their proposal Staff is also available to review he project with any interested personts). • Because the Ptanning Commission hoids the public hearing. the City Council does not. Minutes are taken and any correspondence regarding the application will he included in the report to the City Council. 0 you wish to have something to be indudetl in there rt, lease contact he Planning Staff person named on the notification. Notice of Public Hearing Chanhassen Planning Commission Meeting Date & Time: Tuesday, January 21, 2020 at 7:00 p.m. This hearing may not ' start until later in the evening,depending on the order of thea enda. Locatioll City Hall Council Chambers, 7700 Market Blvd. Consider a request for an Interim Use Permit (IUP) for the purpose of repairing landslides along a portion of the Proposal: Minnesota Bluffs LRT Regional Trail. Zoned Agricultural Estate District (A2). Jessica Galatz, Hennepin County Regional Railroad Applicant: Authority Property Minnesota Bluffs LRT Regional Trail Location: A location map Is on the reverse side of this notice. The purpose of this public hearing is to inform you about the applicant's request and to obtain input from the neighborhood about this project. During the meeting, the Chair will lead the public hearing through the following What Happens steps: at the Meeting: 1. Staff will give an overview of the proposed project. 2. The applicant will present plans on the project. 3. Comments are received from the public. 4. Public hearing is closed and the Commission discusses the project. If you want to see the plans before the meeting, please visit the City's projects web page at: www.ci.chanhassen.mn.us/2020-01. If you wish to talk to someone about this project, please contact Bob Generous Questions & by email at baenerous(fti chanhassen mn us or by phone at 952-227-1131. If you choose to submit written Comments: comments, please send one copy to staff in advance of the meeting. Staff will provide copies to the Commission. The staff report for this item will be available online on the project web site listed above the Thursday prior to the Planning Commission meeting. NEW Sign up to receive email and/or text notifications when meeting agendas, packets, minutes and videos are uploaded to the city's website. Go to www.ci.chanhassen.mn.us/notifyme to sign u I City Review Procedure: • Subdivisions, Planned Unit Developments, Site Plan Reviews, Conditional and Interim Uses, Welland Alterations. Razonings, Comprehensive Plan Amendments and Code Amendments require a public hearing barons the Planning Commission. City ordinances require all property within 500 feet of the subject site to be notified of the application in writing. My interested party is invited to attend the meeting. • Staff prepares a report on the subject application that induces all pertinent information and a recommendation. These reports are available by request At he Planning Commission meeting, staff will give a verbal overview of the report and a recommendation. The item will be opened for the public to speak about the proposal ase pan of the hearing process. The Commission will dose the Public hearing and discuss the item and make a recommendation to he City Council. The City Council may reverse. affirm or modify wholly or partly the Planning Commission's recommendation. Rezonings. land use and code amendments take a simple majority vote of the City Council except rezonings and land use amendments from residential to commeroiallindustriel. • Minnesota State Statute 519.99 requires all applications to be processed within S0 days unless the applicant waives this standard Some applications due to their complexity may take several months to complete. Any person wishing to follmv an item through the process should check with he Planning Department regarding its status and scheduling for the City Coundl meeting. • A neighborhood spokespersonlrepreserbalive is encouraged to provide a contact for the city. Often developers are encouraged to meet with the neighborhood regarding their proposal. Staff is also available to review the project with any interested person(s). • Because the Planning Commission holds the public hearing, the City Council does not. Minutes are taken and any correspondence regarding the application will be included in the report to the City Council. If you wish to have something to be included in the report dease contact the Planning Staff person named on the notification. PIN TAX -NAME 254090030 MATTHEW J CHRISTENSEN 257560410 JOE MORRISON 253350020 SUSAN V RECH 257560390 TINA RISCH 253350030 JOHN D & BARBARA 1 FORCE 257560130 CHRISTOPHER & MICHELE A J FAZI 257560400 DANIEL JJOST 253350010 PAUL W & SUSAN M ALLEN 257560140 JUDY E MANEY TRUST 257560150 STACEY M BURROUGHS REV TRUST 257560160 MICHAELJ KANE 257560420 HEATHER HOLLAND NEUBAUER 257560170 MATTHEW T KEEN 257560430 WILLIAM & ELIZABETH PETA 257560180 CHRISTOPHER & ERIN WETMORE TRUSTS 257560440 PAUL A & SHERYL A CARLSON 257560190 SCOTT ANSETH 257560200 DANIEL W ABERCROMBIE 257560500 SETTLERS WEST LP 257560210 PHILIPPE 0 SCHWOB 253300100 RUSSELL A LEIGHTON JR 253320160 MARY E BRIOL 253320270 MICHAEL PARADIS REV TRUST 253320230 BEVERLY J ZIMMER 253320250 SCOTT A LINDBLAD 253320240 WILLIAM N DECOULOS 257420120 ELIZABETH M VOGEL REV TRUST 253300110 KEVIN E & JANET S WINTER 254090010 BRYAN & ANGELA MALONEY LIV TRUST 253300120 NANCY MADSEN REV TRUST 250360700 BEATRICE I ZWIERS IRREV TRUST 250360200 MOON VALLEY AGGREGATES INC 250350800 GORAN PUJIC 250350700 ALAN L10NGERIUS 253300140 LEO RICHARD DEE & KAREN COUGHLIN DEE TRS 253320260 MAREN DVORAK 253300150 BRIAN JAY BIELKE 253250050 JEFFREY M GOOD 253250040 THOMAS GNANAPRAGASAM TAX _ADD _L1 10 PIONEER TRL 100 8TH AVE 5 UNIT 106 1000 HESSE FARM RD 10005 TRAILS END RD 1001 HESSE FARM RD 10012 TRAILS END RD 10017 TRAILS END RD 1002 HESSE FARM RD 10024 TRAILS END RD 10036 TRAILS END RD 10048 TRAILS END RD 10053 TRAILS END RD 10060 TRAILS END RD 10065 TRAILS END RD 10072 TRAILS END RD 10077 TRAILS END RD 10084 TRAILS END RD 10096 TRAILS END RD 10096 TRAILS END RD 10112 TRAILS END RD 1025 HESSE FARM RD 10377 HEIDI LN 10421 BLUFF CIR 10440 BLUFF CIR 10441 BLUFF CIR 10460 BLUFF CIR 105 PIONEER TR 1075 HESSE FARM RD 108 PIONEER TRL 1101 HESSE FARM RD 11111 DEUCE RD 11111 DEUCE RD 1161 BLUFF CREEK DR 1190 BLUFF CREEK DR 1201 HESSE FARM CIR 1221 BLUFF CREEK DR 1225 HESSE FARM CIR 1231 BLUFF CREEK DR 1251 BLUFF CREEK DR TAX _ADD _L2 CHANHASSEN, MN 553178627 HOPKINS, MN 55343- CHASKA, MN 553189520 CHANHASSEN, MN 553174594 CHASKA, MN 553189527 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHASKA, MN 553189520 CHANHASSEN, MN 553174594 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174594 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174594 CHANHASSEN, MN 553174593 CHASKA, MN 553189527 CHASKA, MN 553189516 CHASKA, MN 553189534 CHASKA, MN 55318 CHASKA, MN 553189534 CHASKA, MN 553189534 CHANHASSEN, MN 553178660 CHASKA, MN 553189527 CHANHASSEN, MN 553178659 CHASKA, MN 553189526 ELKO, MN 55020-9591 ELKO, MN 55020 CHASKA, MN 55318 CHASKA, MN 553189515 CHASKA, MN 553189518 CHASKA, MN 553189515 CHASKA, MN 55318 CHASKA, MN 553189515 CHASKA, MN 55318 SITEADD 10 PIONEER TRL 10029 TRAILS END RD 1000 HESSE FARM RD 10005 TRAILS END RD 1001 HESSE FARM RD 10012 TRAILS END RD 10017 TRAILS END RD 1002 HESSE FARM RD 10024 TRAILS END RD 10036 TRAILS END RD 10048 TRAILS END RD 10053 TRAILS END RD 10060 TRAILS END RD 10065 TRAILS END RD 10072 TRAILS END RD 10077 TRAILS END RD 10084 TRAILS END RD 10096 TRAILS END RD 9841 TRAILS END RD 10112 TRAILS END RD 1025 HESSE FARM RD 10377 HEIDI LN 10421 BLUFF CIR 10440 BLUFF CIR 10441 BLUFF CIR 10460 BLUFF CIR 105 PIONEER TRL 1075 HESSE FARM RD 108 PIONEER TRL 1101 HESSE FARM RD 220 FLYING CLOUD OR 100 FLYING CLOUD DR 1161 BLUFF CREEK DR 1190 BLUFF CREEK DR 1201 HESSE FARM CIR 1221 BLUFF CREEK DR 1225 HESSE FARM CIR 1231 BLUFF CREEK DR 1251 BLUFF CREEK DR 253300160 MAUREEN ANN GRAZZINI TRUST 1251 HESSE FARM CIR 253250030 NICHOLAS WARITZ 1271 BLUFF CREEK DR 257980010 P R KELLY PROPERTIES LLC 13991 KENSINGTON AVE NE 250350500 HEIDI R MOE 1425 BLUFF CREEK DR 3.01162E+12 JOSH & JULIE TAYLOR 1510 MIDWAY LN 250351810 SKIP 5 COOK 15506 VILLAGE WOODS DR 250250800 WILLIAM C GRIFFITH 185 PIONEER TRL 250360100 RILEY PURGATORY BLF CRK WS 18681 LAKE DR E 3.01162E+12 RYAN & HEATHER ZICK 18936 EXPLORER TR 3.01162E+12 WESTON T & LARUA K ROPER 18945 EXPLORER TR 3.01162E+12 GREGORY & COLLEEN WEBER 18948 EXPLORER TR 3.01162E+12 MICHAEL & CARIN VIERTEL 18957 EXPLORER TR 3.01162E+12 RANIA DOUBAL BACHOUR 19042 VOGEL FARM TR 3.01162E+12 JEFFREY V & JENNIFER J 11OVANAllO 19066 VOGEL FARM TR 3.01162E+12 RICHARD 1 & SUSAN J LANAHAN 19090 VOGEL FARM TR 3.01162E+12 WILLIAM & PATRICIA BARTRAM 19114 VOGEL FARM TR 250362500 RUSSELL BARTO II 1969 WOODSTONE LN 250362900 DAN & VALERIE TESTER 230 FLYING CLOUD DR 250363300 STEVEN JON & ANGELA S SMITH 240 FLYING CLOUD DR 250363200 MAX LAUREANO 250 FLYING CLOUD DR 259990600 HENNEPIN CO REG RR AUTHORITY 300 6TH ST 5 SW STREET LEVEL 250362020 RUSSELL & YVONNE BARTO 400 LAKOTA LN 250362400 RUSSELL J & YVONNE L BARTO TRUST 400 LAKOTA LN 250363800 MATHEW JOHNSON 415 LAKOTA LN 251300050 KEVIN FALCONER 425 LAKOTA LN 251300040 WANDA SYNSTELIEN 445 LAKOTA LN 250360710 CHARLIE D HAllARD 450 FLYING CLOUD DR 250363100 ALVIN R LEBENS 460 FLYING CLOUD DR 250362800 MICHAEL S SPIESS 470 FLYING CLOUD DR 251300030 DONAVON GLOUDE 495 LAKOTA LN 250350111 STATE OF MINNESOTA - DNR 500 LAFAYETTE RD 251300020 ECO REAL ESTATE HOLDINGS LLC 510 PLEASANTVIEW RD 258490010 MARTIN K & KATHLEEN M SCHUTROP 540 LAKOTA LN 251300010 HEATHER LYNN SILVA 565 LAKOTA LN 250362210 CHRISTOPHER R KNUTSON 575 LAKOTA LN 250362200 JOHN C SCHWANKE 595 LAKOTA LN 250361300 608 FLYING CLOUD LLC 608 FLYING CLOUD DR 250362220 JAMES A & BONNIE B SWANSEN 615 LAKOTA LN 3.01162E+12 HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY 7014TH AVE S SUITE 400 3.01162E+12 SETTLERS WEST HO ASSOC - COMMUNITY DEV INC 7100 MADISON AVE W CHASKA, MN 55318 1251 HESSE FARM CIR CHASKA, MN 553189515 1271 BLUFF CREEK DR PRIOR LAKE, MN 55372- 550 FLYING CLOUD DR CHASKA, MN 553189515 1201 BLUFF CREEK DR GLENVIEW IL 60026-7792 19018 VOGEL FARM TR EDEN PRAIRIE, MN 55347-1439 10551 GREAT PLAINS BLVD CHANHASSEN, MN 553178660 185 PIONEER TRL CHANHASSEN, MN 55317 EDEN PRAIRIE MN 55347 18936 EXPLORER TR EDEN PRAIRIE MN 55347 18945 EXPLORER TR EDEN PRAIRIE MN 55347 18948 EXPLORER TR EDEN PRAIRIE MN 55347 18957 EXPLORER TR EDEN PRAIRIE MN 55347 19042 VOGEL FARM TR EDEN PRAIRIE MN 55347 19066 VOGEL FARM TR EDEN PRAIRIE MN 55347 19090 VOGEL FARM TR EDEN PRAIRIE MN 55347 19114 VOGEL FARM TR VICTORIA, MN 55386-9639 410 LAKOTA LN CHASKA, MN 55318-9532 230 FLYING CLOUD DR CHASKA, MN 553189532 240 FLYING CLOUD DR CHASKA, MN 55318 250 FLYING CLOUD DR MINNEAPOLIS, MN 55487-0999 Null CHASKA, MN 553189452 CHASKA, MN 553189452 400 LAKOTA LN CHASKA, MN 553189457 415 LAKOTA LN CHASKA, MN 55318 425 LAKOTA LN CHASKA, MN 553189457 445 LAKOTA LN CHASKA, MN 553189533 450 FLYING CLOUD DR CHASKA, MN 55318 460 FLYING CLOUD DR CHASKA, MN 553189533 470 FLYING CLOUD DR CHASKA, MN 55318 495 LAKOTA LN ST PAUL, MN 55155-4045 CHANHASSEN, MN 55317 535 LAKOTA LN CHASKA, MN 553189453 540 LAKOTA LN CHASKA, MN 55318 565 LAKOTA LN CHASKA, MN 553189455 575 LAKOTA LN CHASKA, MN 553189456 595 LAKOTA LN CHASKA, MN 553189502 608 FLYING CLOUD DR CHASKA, MN 553189455 615 LAKOTA LN MINNEAPOLIS MN 55415 61 ADDRESS UNASSIGNED GOLDEN VALLEY MN 55427 61 ADDRESS UNASSIGNED 3.01162E+12 CITY OF EDEN PRAIRIE 250351710 HAGEN LAWN & LANDSCAPE LLC 3.01162E+12 MARK W & SUZAN R KAMMER 257420110 JONATHAN P & JOANN DIMINO 3.01162E+12 KARL REYNOLDS & CHRISTI HART 3.01162E+12 THOMAS A & KELLY A HOPPER 3.01162E+12 KRISTA A HAYEK & PETER N WHITE IV 3.01162E+12 MICHAEL & AMY RUETZ 252640160 NATHAN H GRIFFITHS 3.01162E+12 JEFFREY HOLM &JENNIFER EKEREN-HOLM 257560010 MICHAEL A & CHRISTINE M MANNO 252640150 TRUST AGREEMENT OF RICHARD & CATHERINE M 257560020 DANIEL S LAUN 257560300 SCOTT LAUERMAN 257560030 SARAH J BREIT 252640140 ANN K LONSTEIN REVOCABLE TRUST 257560040 JASON BURLAGE 252640130 JOHN M & LINDA J REVIER 252640120 RYAN & COURTNEY DUNLAY 257560310 AJEFFREY KARSCHNIK 257560050 JAREDJOHNGRUNIG 257560320 ELIZABETH A FARRELL 252640110 KIRK D HEISSEL 257560060 JASON EMMETT 257560330 LENNARTJ JOHNSON 257560070 WILLIAM ROUSE 252640100 ROSS LHABBEN 257560340 JON FRANSWAY 257560080 STEVEN C KIMES 257560350 ROBERT G DAUB REV TRUST 257560090 XIANGDONG LIN 252640090 JENNIFER M PALMQUIST 257560360 CHRISTOPHER C ATTERBERRY 257560100 JAMES DOBCHUK 257560370 STEVEN R PASCHKE 252640070 PAULJTAUNTON 252640080 JIMMY M & MARY E ROANE 257560110 RANDALL S & MELODEE D BROOKS 257560380 MATTHEW J WILLIAMS 257560120 RICHARD BARBARI 8080 MITCHELL RD 850 FLYING CLOUD DR 9600 HIGHVIEW DR 9751 MEADOWLARK LN 9800 TRAILS END RD 9805 TRAILS END RD 9812 TRAILS END RD 9817 TRAILS END RD 9821 DEERBROOK DR 9824 TRAILS END RD 9836 TRAILS END RD 9841 DEERBROOK 9848 TRAILS END RD 9853 TRAILS END RD 9860 TRAILS END RD 9861 DEERBROOK DR 9872 TRAILS END RD 9881 DEERBROOK DR 9901 DEERBROOK DR 9905 TRAILS END RD 9912 TRAILS END RD 9917 TRAILS END RD 9921 DEERBROOK DR 9924 TRAILS END RD 9929 TRAILS END RD 9936 TRAILS END RD 9941 DEERBROOK DR 9941 TRAILS END RD 9948 TRAILS END RD 9953 TRAILS END RD 9960 TRAILS END RD 9961 DEERBROOK DR 9965 TRAILS END RD 9972 TRAILS END RD 9977 TRAILS END RD 9980 DEERBROOK DR 9981 DEERBROOK DR 9984 TRAILS END RD 9989 TRAILS END RD 9996 TRAILS END RD EDEN PRAIRIE MN 55344 CHASKA, MN 553189503 EDEN PRAIRIE MN 55347 CHANHASSEN, MN 553178826 EDEN PRAIRIE MN 55347 EDEN PRAIRIE MN 55347 EDEN PRAIRIE MN 55347 EDEN PRAIRIE MN 55347 CHANHASSEN, MN 553178550 EDEN PRAIRIE MN 55347 CHANHASSEN, MN 553174591 CHANHASSEN, MN 553178550 CHANHASSEN, MN 553174591 CHANHASSEN, MN 553174591 CHANHASSEN, MN 55317 CHANHASSEN, MN 553178550 CHANHASSEN, MN 55317 CHANHASSEN, MN 553178550 CHANHASSEN, MN 553178552 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553178552 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553174592 CHANHASSEN, MN 553178551 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174592 CHANHASSEN, MN 55317 CHANHASSEN, MN 553174592 61 ADDRESS UNASSIGNED 850 FLYING CLOUD DR 9600 HIGHVIEW DR 9751 MEADOWLARK LN 9800 TRAILS END RD 9805 TRAILS END RD 9812 TRAILS END RD 9817 TRAILS END RD 9821 DEERBROOK DR 9824 TRAILS END RD 9836 TRAILS END RD 9841 DEERBROOK DR 9848 TRAILS END RD 9853 TRAILS END RD 9860 TRAILS END RD 9861 DEERBROOK DR 9872 TRAILS END RD 9881 DEERBROOK DR 9901 DEERBROOK DR 9905 TRAILS END RD 9912 TRAILS END RD 9917 TRAILS END RD 9921 DEERBROOK DR 9924 TRAILS END RD 9929 TRAILS END RD 9936 TRAILS END RD 9941 DEERBROOK DR 9941 TRAILS END RD 9948 TRAILS END RD 9953 TRAILS END RD 9960 TRAILS END RD 9961 DEERBROOK DR 9965 TRAILS END RD 9972 TRAILS END RD 9977 TRAILS END RD 9980 DEERBROOK DR 9981 DEERBROOK DR 9984 TRAILS END RD 9989 TRAILS END RD 9996 TRAILS END RD 256010020 PCH DEVELOPMENT LLC PO BOX 94 SHAKOPEE, MN 55379 10520 GREAT PLAINS BLVD CITY OF CHANHASSEN CARVER & HENNEPIN COUNTIES NOTICE OF PUBLIC HEARING PLANNING CASE NO. 2020-01 NOTICE IS HEREBY GIVEN that the Chanhassen Planning Commission will hold a public hearing on Tuesday, January 21, 2020 at 7:00 p.m. in the Council Chambers in Chanhassen City Hall, 7700 Market Blvd. The purpose of this hearing is to consider a request for an Interim Use Permit (IUP) for the purpose of repairing landslides along a portion of the Minnesota Bluffs LRT Regional Trail. Zoned Agricultural Estate District (A2). Applicant: Jessica Galatz, Hennepin County Regional Railroad Authority. A plan showing the location of the proposal is available for public review on the city's web site at www.ci.chanhassen. mn-us/2020-01 or at City Hall during regular business hours. All interested persons are invited to attend this public hearing and express their opinions with respect to this proposal. Bob Generous Senior Planner Email: bgenerous@ ci.chanhassen.mmus Phone: 952-227-1131 (Published in the Chanhassen Villager on Thursday, January 9, 2020: No. 9823) saiNi ED • • PL ao ac-) -a i Affidavit of Publication Southwest News Media State of Minnesota) )SS. County of Carver ) Laurie A. Hartmann, being duly sworn, on oath says that she is the publisher the newspapers known as the Chaska Herald and the Chanhassen Villager and has full knowledge of the facts herein stated as follows: (A) These newspapers have complied with the requirements constituting qualification as a legal newspaper, as provided by Minnesota Statute 331A.02, 331A.07, and other applicable laws, as amended. yy ��,,..,,�� (B) The printed public notice that is attached to this Affidavit and identified as No.�—) was published on the date or dates and in the newspaper stated in the attached Notice and said Notice is hereby incorporated as part of this Affidavit Said notice was cut from the columns of the newspaper specified. Printed below is a copy of the lower case alphabet from A to Z, both inclusive, and is hereby acknowledged as being the kind and size of type used in the composition and publication of the Notice: abcdefgh4lklmnopgrstuvwxyz/,,� Laurie A. Hattmm Subscribed and sworn before me on this ! day of JYMME JEANNETTE BARK NOTARY PUBLIC • MINNESOTA MY COMMISSION EXPIRES 01131123 RATE INFORMATION Lowest classified rate paid by commercial users for comparable space.... $31.20 per column inch Maximum rate allowed by law for the above matter ................................ $31.20 per column inch Rate actually charged for the above matter ............................................... $14.03 per column inch CITY OF CHANHASSEN CARVER & HENNEPIN COUNTIES NOTICE OF PUBLIC HEARING PLANNING CASE NO. 2020-01 NOTICE IS HEREBY GIVEN that the Chanhassen Planning Commission will hold a public hearing on Tuesday, January 21, 2020 at 7:00 p.m. in the Council Chambers in Chanhassen City Hall, 7700 Market Blvd. The purpose of this hearing is to consider a request for an Interim Use Permit (IUP) for the purpose of repairing landslides along a portion of the Minnesota Bluffs LRT Regional Trail. Zoned Agricultural Estate District (A2). Applicant: Jessica Galatz, Hennepin County Regional Railroad Authority. A plan showing the location of the proposal is available for public review on the city's web site at www.ci.chanhassen.mn.us/2020-01 or at City Hall during regular business hours. All interested persons are invited to attend this public hearing and express their opinions with respect to this proposal. Bob Generous Senior Planner Email: b¢enerous@ci.chanhassen.mn.us Phone: 952-227-1131 (Publish in the Chanhassen Villager on January 9, 2020) SCAKIZO g1plan\2020 planning cases\20-01 chanhassen slope failure project iup\ph notice to villager.docx COMMUNITY DEVELOPMENT DEPARTMENT Planning Division — 7700 Market Boulevard CITY OF CHMNSEN Mailing Address — P.O. Box 147, Chanhassen, MN 55317 Phone: (952) 227-1130 / Fax: (952) 227-1110 AGENCY REVIEW REQUEST LAND DEVELOPMENT PROPOSAL Please review and respond no later than the review response deadline Agency Review Request Date: Agency Review Response Deadline: Date Application Filed: December 20, 2019 January 9, 2020 December 20, 2019 Contact: Contact Phone: Contact Email: Robert Generous, AICP 952-227-1131 bgenerous@ci.chanhassen.mn.us Senior Planner Planning Commission Date: City Council Date: 60 -Day Review Period Deadline: January 21, 2020 at 7:00 p.m. February 10, 2020 at 7:00 p.m. February 18, 2020 Application: A request for an Interim Use Permit (IUP) and Wetland Alteration Permit for the purpose of repairing landslides along a portion of the Minnesota Bluffs LRT R Tonal Trail. Zoned Agricultural Estate District AZ .t PlanningCase: 2020-01 Web Pa e: www.ci.chanhassen.mn.us/2020-01 In order for staff to provide a complete analysis of issues for Planning Commission and City Council review, we would appreciate your comments and recommendations concerning the impact of this proposal on traffic circulation, existing and proposed future utility services, storm water drainage, and the need for acquiring public lands or easements for park sites, street extensions or improvements, and utilities. Where specific needs or problems exist, we would like to have a written report to this effect from the agency concerned so that we can make a recommendation to the Planning Commission and City Council. Your cooperation and assistance is greatly appreciated. City Departments: Federal Agencies: Adjacent Cities: ❑ Attorney ❑ Army Corps of Engineers ❑ Chaska ❑ Building Official ❑ US Fish & Wildlife ® Eden Prairie ® Engineer ❑ Jackson Township ❑ Fire Marshal Watershed Districts: ❑ Minnetonka ® Forester El Shorewood ® Park Director E] Carver County El Victoria ® Water Resources ® Lower Riverr ❑ Minnehaha Creek F1 Law Enforcement Adjacent Counties: ® Riley -Purgatory -Bluff Creek ® Hennepin Carver County Agencies: Utilities: El Scott ❑ Community Development ❑ Cable TV - Mediacom ® Engineer School Districts: ❑ Electric — Minnesota Valley F1 Environmental Services ❑ Electric — Xcel Energy E] Eastern Carver County112 ❑ Historical Society El Parks ❑ Magellan Pipeline ElMinnetonka 276 F1Soil &Water Conservation District El Natural Gas — CenterPoint Energy ❑ Phone — CenturyLink Other Agencies: State Agencies: ❑ Hennepin County Regional Railroad ElBoard of Water & Soil Resources Authority ❑ MN Landscape Arboretum ❑ Health SouthWest Transit ❑ ❑ Historical Society TC&W Railroad ❑ El Natural Resources -Forestry ® Natural Resources -Hydrology ❑ Pollution Control ® Transportation CITY OF CHANHASSEN P O BOX 147 CHANHASSEN MN 55317 12/18/2019 3:06 PM Receipt No. 00427515 CLERK: AshleyM PAYEE: Barr Engineering Cc 4300 MArketpointe Drive Suite 200 Minneapolis MN 55435 - Chanhassen Landslide Repair Project- Planning Case No. 20-01 ------------------------------------------------------- Interim Use Permit 425.00 Sign Rent 200.00 Recording Fees 50.00 GIS List 357.00 Total Cash Check 0248746 Change 1,032.00 0.00 1,032.00 0.00 Chanhassen Landslide Repair Project - Planning Case No. 20-01 $425.00 Interim Use Permit $200.00 Notification Sign $357.00 Property Owners List (119 addresses x $3 each) $50.00 Escrow for recording variance documents $1,032.00 TOTAL $1.032.00 Check 0248746 from Barr Engineering Co. $0.00 BALANCE OWED PC- QUaO— D( iEIG COMMUNITY DEVELOPMENT DEPARTMENT CITY OF CHANHASSFN Planning Division – 7700 Market Boulevard Mailing Address – P.O. Box 147, Chanhassen, MN 55317 Phone: (952) 227-1300 / Fax: (952) 227-1110 APPLICATION FOR DEVELOPMENT REVIEW ^ Submittal Date: L -3 �G _1/ PC Date: )' .1I a CrUDate: a ��% 60 -Day Review Dale -( Section 1: Application Type (check all that apply) (Refer to the appropriate Application Checklist for required submittal information that must accompany this application) ❑ Comprehensive Plan Amendment ......................... $600 ❑ Minor MUSA line for failing on-site sewers ..... $100 ❑ Conditional Use Permit (CUP) ❑ Metes & Bounds (2 lots)..................................$300 ❑ Single -Family Residence ................................ $325 ❑ Consolidate Lots..............................................$150 ❑ All Others ......................................................... $425 ❑� Interim Use Permit (IUP) ❑ Final Plat ..........................................................$700 ❑ In conjunction with Single -Family Residence.. $325 (Includes $450 escrow for attorney costs)' 2 All Others ......................................................... $425 ❑ Rezoning (REZ) through the development contract. ❑ Planned Unit Development (PUD) .................. $750 $300 ❑ Minor Amendment to existing PUD ................. $100 ❑ All Others......................................................... $500 ❑ Sign Plan Review ................................................... $150 ❑ Site Plan Review (SPR) ❑ Single -Family Residence ............................... $150 ❑ Administrative ..................................................$100 ❑ All Others ....................................................... $275 ❑ Commercial/Industrial Districts' ......................$500 Zoning Appeal ...................................................... $100 Plus $10 per 1,000 square feet of building area: Zoning Ordinance Amendment (ZOA)................. (_ thousand square feet) 'Include number of existing employees: 'Include number of new employees: ❑ Residential Districts... ...................................... $500 Plus $5 per dwelling unit (— units) ❑ Subdivision (SUB) NOTE: When multiple applications are processed concurrently, the appropriate fee shall be charged for each application. Z Notification Sign (City to install and remove)...................................................................................................................... $200 0 Property Owners' List within 500' (City to generate after pre -application meeting) .................................................. $3 per address I( 19 addresses) Z Escrow for Recording Documents (check all that apply)....................................................................... $50 per document ❑ Conditional Use Permit Z Interim Use Permit ❑ Site Plan Agreement ❑ Vacation ❑ Variance ❑ Wetland Alteration Permit ❑ Metes & Bounds Subdivision (3 docs.) ❑ Easements (_ easements) ❑ Deeds TOTAL FEE: $1,032.00 Section 2: Required Information Description of Proposal: The purpose of the planned work is to repair landslides along a portion of the Minnesota Bluffs LRT Regional Trail that occurred in 2014. Property Address or Location: Minnesota Bluffs LRT Regional Trail Parcel #: 259990600 Legal Description: Sections 34, 35, 36 and 25, T116, R23, Carver County, Minnesota Total Acreage: 7.22 Wetlands Present? ® Yes ❑ No Present Zoning: Select One Requested Zoning: Not Applicable Present Land Use Designation: Select One Requested Land Use Designation: Not Applicab NHp$SEN Existing Use of Property: Minnesota Bluffs LRT Regional Trail RECEIVED ❑Check box if separate narrative is attached. Interim Use Permit Application Attached. 2 2 19 ❑ Create 3 lots or less ........................................ $300 ❑ Create over 3 lots.......................$600 + $15 per lot ( lots) ❑ Metes & Bounds (2 lots)..................................$300 ❑ Consolidate Lots..............................................$150 ❑ Lot Line Adjustment ......................................... $150 ❑ Final Plat ..........................................................$700 (Includes $450 escrow for attorney costs)' `Additional escrow may be required for other applications through the development contract. ❑ Vacation of Easements/Right-of-way (VAC)........ $300 (Additional recording fees may apply) ❑ Variance (VAR) .................................................... $200 ❑ Wetland Alteration Permit (WAP) ❑ Single -Family Residence ............................... $150 ❑ All Others ....................................................... $275 ❑ Zoning Appeal ...................................................... $100 ❑ Zoning Ordinance Amendment (ZOA)................. $500 NOTE: When multiple applications are processed concurrently, the appropriate fee shall be charged for each application. Z Notification Sign (City to install and remove)...................................................................................................................... $200 0 Property Owners' List within 500' (City to generate after pre -application meeting) .................................................. $3 per address I( 19 addresses) Z Escrow for Recording Documents (check all that apply)....................................................................... $50 per document ❑ Conditional Use Permit Z Interim Use Permit ❑ Site Plan Agreement ❑ Vacation ❑ Variance ❑ Wetland Alteration Permit ❑ Metes & Bounds Subdivision (3 docs.) ❑ Easements (_ easements) ❑ Deeds TOTAL FEE: $1,032.00 Section 2: Required Information Description of Proposal: The purpose of the planned work is to repair landslides along a portion of the Minnesota Bluffs LRT Regional Trail that occurred in 2014. Property Address or Location: Minnesota Bluffs LRT Regional Trail Parcel #: 259990600 Legal Description: Sections 34, 35, 36 and 25, T116, R23, Carver County, Minnesota Total Acreage: 7.22 Wetlands Present? ® Yes ❑ No Present Zoning: Select One Requested Zoning: Not Applicable Present Land Use Designation: Select One Requested Land Use Designation: Not Applicab NHp$SEN Existing Use of Property: Minnesota Bluffs LRT Regional Trail RECEIVED ❑Check box if separate narrative is attached. Interim Use Permit Application Attached. 2 2 19 Section 3: Property Owner and Applicant Information APPLICANT OTHER THAN PROPERTY OWNER: In signing this application, I, as applicant, represent to have obtained authorization from the property owner to file this application. I agree to be bound by conditions of approval, subject only to the right to abject at the hearings on the application or during the appeal period. If this application has not been signed by the property owner, I have attached separate documentation of full legal capacity to file the application. This application should be processed in my name and I am the party whom the City should contact regarding any matter pertaining to this application. I will keep myself informed of the deadlines for submission of material and the progress of this application. I further understand that additional fees may be charged for consulting fees, feasibility studies, etc. with an estimate prior to any authorization to proceed with the study. I certify that the information and exhibits submitted are true and correct. Name: Hennepin County Regional Railroad Authority Contact: Jessica Galatz Address: 701 4th Ave. South, Suite 400 Phone: (612) 348-2691 City/State/Zip: Minneapolis/MN/55415 Cell: Email: jessica.galatz@hennepin.us Fax: Signature: Q Date: i�L/13 11 9 PROPERTY OWNER: In signing this application, I, as property owner, have full legal capacity to, and hereby do, authorize the filing of this application. I understand that conditions of approval are binding and agree to be bound by those conditions, subject only to the right to object at the hearings or during the appeal periods. I will keep myself informed of the deadlines for submission of material and the progress of this application. I further understand that additional fees may be charged for consulting fees, feasibility studies, etc. with an estimate prior to any authorization to proceed with the study. I certify that the information and exhibits submitted are true and correct. Name: Contact: Address: Phone: City/State/Zip: Cell: Email: Fax: Signature: Date: This application must be completed in full and must be accompanied by all information and plans required by applicable City Ordinance provisions. Before filing this application, refer to the appropriate Application Checklist and confer with the Planning Department to determine the specific ordinance and applicable procedural requirements and fees. A determination of completeness of the application shall be made within 15 business days of application submittal. A written notice of application deficiencies shall be mailed to the applicant within 15 business days of application. PROJECT ENGINEER (if applicable) Name: Contact: Address: Phone: City/State/Zip: Cell: Email: Fax Section 4: Notification Information Who should receive copies of staff reports? "Other Contact Information: ❑ Property Owner Via: ❑ Email ❑ Mailed Paper Copy Name: Applicant Via: ® Email ❑ Mailed Paper Copy Address: Engineer Via: ❑ Email ❑ Mailed Paper Copy City/State/Zip: ❑ Other' Via: ❑ Email ❑ Mailed Paper Copy Email: INSTRUCTIONS TO APPLICANT: Complete all necessary form fields, then select SAVE FORM to save a copy to your device. PRINT FORM and deliver-to city along with required documents and payment. SUBMIT FORM to send a digital Copy to the city for processing. SAVE FORM PRINT FORM SUBMIT FORM BOARD OF WATER AND SOIL RESOURCES Minnesota Wetland Conservation Act Notice of Application Local Government Unit: City of Chanhassen County: Carver Applicant Name: Jessica Galatz, Hennepin County Regional Railroad Authority Applicant Representative: Sarah Johnson, Barr Engineering Project Name: HCRRA Minnesota River Bluffs LRT Slope Failure Wetland Permit Application LGU Project No. (if any): Date Complete Application Received by LGU: 12/17/2019 Date this Notice was Sent by LGU: 01/10/2020 Date that Comments on this Application Must Be Received By LGU': 01/31/2020 minimum i_� ausmess day comment period for Boundary & Type, Sequencing, Replacement Plan and Bank Plan Applications NCA Decision Type - check all that apply ❑Wetland Boundary/Type ❑Sequencing ❑Replacement Plan ❑Bank Plan (not credit purchase) ®No -Loss (8420.0415) (Incidental 8420.0105 Subp. 2. D.) ❑Exemption (8420.0420) Part:❑A❑B ❑C❑D❑E OF ❑G ❑H Subpart: ❑2❑3❑4❑5 11607 0809 Replacement Plan Impacts (replacement plan decisions only) Total WCA Impact Area Proposed: Application Materials ® Attached ❑Other' (specify): Link to ftp or other accessible file sharing sites is acceptable. Comments on this application should be sent to: LGU Contact Person: Todd Gerhardt E -Mail Address: TGerhardt@ci.chanhassen.mn.us Address and Phone Number: 7700 Market Boulevard P.O. Box 147, Chanhassen, MN 55317 952-227-1119 Decision -Maker for this Application: ®Staff ❑Governing Board/Council ❑Other (specify): Notice Distribution (include name) Required on all notices: ® SWCD TEP Member: Aaron Finke ® BWSR TEP Member: Ben Carlson ® LGU TEP Member (if different than LGU contact): Todd Gerhardt, City of Chanhassen; Andi Moffatt, WSB M DNR Representative: Leslie Parris, Jennie Skancke ® Watershed District or Watershed Mgmt. Org.: Linda Loomis, Lower MN River Watershed District N Applicant (notice only): Jessica Galatz, Hennepin County Regional Rail Authority ® Agent/Consultant (notice only): Sarah Johnson, Barr Engineering; Tyler Conley, Barr Engineering Optional or As Applicable ® Corps of Engineers: ❑ BWSR Wetland Mitigation Coordinator (required for bank plan applications only): ® Members of the Public (notice only): Leslie Stowing, Eden Prairie LGU; Erik Henricksen, City of Chanhassen; Terry Jeffery, RPBCWD ❑ Other: BWSR NOA Form — November 5, 2019 w 1 Signature: Date: This notice and accompanying application materials may be sent electronically or by mail. The LGU may opt to send a summary of the application to members of the public upon request per 8420.0255, Subp. 3. BWSR NOA Form — November 5, 2019 MINNESOTA BLUFFS LRT REGIONAL TRAIL LANDSLIDE REPAIRS MP44MTA OOLWY LW CONTACTS: ENGINEER CON(ACT: M. Pel.'an Ban EZn., U 1300MS.E"` Nl M, Mlmeewia. AN 55135 951833-2919 mpnersan�oanmm ONMER'S REPRESENTATNE WNTAGT: J E. Galati 701 F.n A. Rep 4RaMoeO AJMny M F.0 A. 5..SNe 100 612 a E,l 55115 6,231&M91 .Ieavu.G wt mt . is maw GOPHER STATE ONE CALL CALL BEFORE YOU DIG. 1-00.252-1165 HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY (HCRRA) )CATION IUNTY EN, MN. RELEASEDu u TpFOR DA E RELEASED 1 PLAN: PROJECT LOCATION 9 sm t 1 O SCALEIIN FFET BMR ENGINEERING CO. 43 MMKET ,q GRIVE Guile No MINNE5POUS, MN 5U1 HCRRA MINNEAPOLIS. MN "I TITLE FEET, P-OJECT LOCATION, AND SHEET INDEX G-02 .... LEGEND, NOTES, ABBREVIATIONS, AND ALIGNMENT CONTROL DATA G-03 .... STATEMENT OF ESTIMATED QUANTITIES G-06 .... SITE ACCESS, STAGING, AND TRAFFIC CONTROL -OVERALL PLAN AND NOTES G-05 .... SITE ACCESS, STAGING, AND TRAFFIC CONTROL - PLANS G*6 .... SITE ACCESS, STAGING, AND TRAFFIC CONTROL -PLAN AND DETAILS G-07 .... TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY G -W .... PROJECT LAYOUT PLAN C-01 .... EXISTING CONDITIONS - PLAN G-02 .... EXISTING CONDITIONS - PHOTOS C-03 .... REMOVALS AND TEMPORARY EROSION CONTROL PLAN C-04 .... TEMPORARY EROSION CONTROL DETAILS C45 .... STORM WATER POLLUTION PREVENTION PLAN (SWPPP) C -0e .... STORM WATER POLLUTION PREVENTION PLAN (SWPPP) C-07 .... TRAIL MODIFICATIONS - PLAN AND PROFILE C-08 .... TRAIL MODIFICATIONS - CROSS SECTIONS C-09 .... TRAIL MODIFICATIONS - CROSS SECTIONS C-10 .... TRAIL MODIFICATIONS - TYPICAL SECTIONS C-11 .... SOUTH AREA SLOPE REPAIR - PLAN C-12 .... SOUTH AREA SLOPE REPAIR - SECTIONS C-13 .... SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR - PLAN G14 .... SOUTH AREA CULVERT OUTLET REPAIR- PROFILE AND SECTIONS C-15 .... SOUTH AREA CULVERT OUTLET REPAIR - SECTIONS AND DETAILS L>18 .... STREAMBANK REPAIR- DETAIL C-17 .... NORTH AREA SLOPE REPAIR - PLAN C-18 .... NORTH AREA SLOPE REPAIR - PROFILE, SECTION, AND DETAIL C-19 .... STORM SEWER AND DRAINAGE CHANNEL -PLAN AND PROFILE C-20 .... STORM SEWER AND DRAINAGE CHANNEL -SECTIONS AND DETAILS C-21 .... STORM SEWER AND DRAINAGE CHANNEL -SECTIONS AND DETAILS R-01 .... SEEDING PLAN R-02 .... EROSION CONTROL BLANKET AND MULCH PLAN R-03 .... TREE PLANTING PLAN R-04 .... RESTORATION DETAILS GENERAL NOTES: 1. TOPOGRAPHIC SURVEY INFORMATION SHOWN IN THIS PLAN SET IS A COMBINATION OF DATA FROM: SURVEY CONDUCTED BY BARR ENGINEERING CO. IN JANUARY 2015, SURVEY CONDUCTED BY STONEBROOKE IN JANUARY AH9 AND MRDNR 2011 LIDAR TOPOGRAPHY. IMAGERY; COPYRIGHT PICTOMETRY INTERNATIONAL CORP AND HENNEPIN COUNTY. MINNESOTA, 2015. HORIZONTAL DATUM AND COORDINATE SYSTEM: CARVER COUNTY COORDINATES, MD83 HARN, US SURVEY FEET. a. VERTICAL DATUM: NGVD29. LANDSLIDE REPAIRS CHANHASSEN, MN TITLE SHEET, PROJECT LOCATION, AND SHEETINDEX NOT 90% DESIGN LEGEND I I ABBREVIATIONS I - 790 - EXISTING INDEX CONTOUR 188--- EXISTING INTERMEDIATE CONTOUR -- EXISTING PARCEL LINE - SB EXISTING STORM SEWER CONC. EXISTING FIBER OPTIC - X EXISTING FENCE LINE FES EXISTING CONSERVATION EASEMENT - - - EXISTING STREAM THALWEG -- --- EXISTING STREAM EXTENTS -WT- EXISTING WETLAND - - - - - - - CONSTRUCTION LIMITS - 790 - PROPOSED INDEX CONTOUR -789- PROPOSED INTERMEDIATE CONTOUR - W - PROPOSED STORM SEWER -X - PROPOSED FENCE - - - - CLEARING LIMITS 01600.0111W' SILT FENCE M AC PROPOSED RIPRAP 140.]90 STAGING AREA CB CATCH BASIN 0 U-1 2015 SOIL BORING - CLSM 0 K-1 EXISTING PIEZOMETER CORRUGATED METAL PIPE CONC. O 661 2018 SOIL BORING ELEVATION FES S ST -7 2019 SOIL BORING INVERT ELEVATION MH i WDOT MINNESOTA DEPARTMENT OF TRANSPORTATION NWL 7 e RCP REINFORCED CONCRETE PIPE TRM TURF REINFORCEMENT MAT CMPA CORRUGATED METAL PIPE ARCH 5060+1 048.00 140.4 1070+8 01600.0111W' k M AC 641.950 140.]90 8 10461.0 01121.57 C2 2-71351 1041.0 wm.57 5suQ.0 1M.BT 1000.4 2H11.0T N1832T N18.32T q� 8 d 8 0194." F NI33ZT S 5818171{law 36214" 497.0s 3 M.00 641.621 18£50.31 g 1011630 BM7.BZT 185150]1 SWMA14 16675.17 027 104-00 BW7.@T &98.21 648-021 185120.38 0180.0 um 64BaT 183®]8 58190L51llom - R 183'813 58208111 E 1850213 SMOa.41 8388' 1000.00 64818 643."1 643MT 166566.13 SR12138u 643.MT 16506.13 5 212lM34.51' 1241.94 100o29 sex349¢ 9 i H � � - y • � 3 NOJKWP�M REVISION DESCRIPTION CB CATCH BASIN C.I.P. CAST -IN -PUCE CLSM CONTROLLED LOW STRENGTH MATERIALS CMP CORRUGATED METAL PIPE CONC. CONCRETE EL. ELEVATION FES FLARED END SECTION I.E. INVERT ELEVATION MH MANHOLE WDOT MINNESOTA DEPARTMENT OF TRANSPORTATION NWL NORMAL WATER LEVEL RCP REINFORCED CONCRETE PIPE TRM TURF REINFORCEMENT MAT CMPA CORRUGATED METAL PIPE ARCH SYMBOLS LIYITS OP Sa.TION m- $ECFION IDENT/FIEN 1 S=MN "FENFM'ICS 10 slm zmw a Inrnm 4 SECTION VIEW CALL OUT S/LCHON IDEN3'IFIES (TPP.) 7 SECTION: GRAPHICS STANDARDS + BCAlE 1.1 S&,ION SEl'EXEM'II�f'➢P.) SECTION VIEW TITLE DETAIL IDEIV 17ZR 1 10 DETAIL REFERENCES S1E£T OFiK 6 l0I/.1FD ON DETAIL VIEW CALL OUT DFTA7L IDENTIFIER (TOP.) DETAIL GRAPHICS STANDARDS +o scuE: a+ DETAIL REFERENCES (TTP.) SHM Do is CMlF4-WI 4 GENERAL NOTES: 1. CONTRACTOR SHALL LOCATE AND FIELD VERIFY ALL EXISTING UTILITIES PRIOR TO WORK. 2. ALL EXISTING ROADS, PARKING LOTS, TRAILS, SIGNS, OR SIMILAR SHALL NOT BE DISTURBED DURING CONSTRUCTION. CONTRACTOR SHALL COORDINATE SURVEYS WITH THE ENGINEER TO DOCUMENT PRE -CONSTRUCTION EXISTING CONDITION ISSUES. 3. CONTRACTOR SHALL INSTALL AND MAINTAIN ALL EROSION CONTROL SNIPS PRIOR TO COMMENCEMENT OF GRADING FOR EACH LOCATION DURING CONSTRUCTION. EROSION CONTROL PLANS ARE PROVIDED INSIDE THE PROJECT STORMWATER POLLUTION PREVENTION PLAN(SWPPP). 1. CONSTRUCTION LIMITS AS SHOWN ARE APPROXIMATE FINAL CONSTRUCTION LIMITS TO BE COORDINATED WITH THE OWMER AND STAKE]) IN THE FIELD. 5. CLEARING AND GRUBBING TO BE PERFORMED ONLY WITHIN GRADING LIMITS AND ACCESS ROUTES UNLESS OTHERWISE DIRECTED BY ENGINEER. 6. TREES TO BE CLEARED WILL BE MARKED IN THE FIELD BY ENGINEER. ALL TREES -=6- IN DIAMETER NOT MARKED FOR REMOVAL SHALL BE PROTECTED. 7, TREES IDENTIFIED BY ENGINEER FOR ADDITIONAL PROTECTION SHALL BE PROTECTED AGAINST ROOT COMPACTION, DAMAGE AND DISFIGUREMENT IN ACCORDANCE WITH MODOT SPEC. 2572. PROTECTION OF TREES NOT IDENTIFIED TO BE REMOVED SHALL BE INCIDENTAL S. CONTRACTOR SHALL TAKE PRECAUTIONS TO MINIMIZE THE TRANSFER OF AQUATIC AND TERRESTRIAL INVASIVE SPECIES TO THE MAXIMUM EXTENT POSSIBLE. IVryut GK BARR EN KEEN BNG W iFfMN7E p0VE MINNIAPOUS,MN0135 Pe,moeaan mtmz.am ALIGNMENT CONTROL DATA SP6 HCRRA MINNEAPOLIS. MN LANDSLIDE REPAIRS CHANHASSEN, MN LEGEND, NOTES, ABBREVIATIONS, AND ALIGNMENT CONTROL DATA NOT 90% DESIGN SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR CONTROL DATA -ALIGNMENT'C" TRAIL MODIFICATIONS CONTROL DATA - ALIGNMENT "T" TYPEMD. START STATION STARTNORTHING STARTEASTING STARTSTATION STARTNORTHING STARTEAS TINGRSMEARING PCSTATION LENGTH RADIUS PCSTATION PISTATION ENDSTATION ENDNORTHING ENDEASTING 1� 73 0 m 181801+7 015M1314D7 1006.{9 0256{.4 1.1730 041950 140O0T 18188717 5060+1 048.00 140.4 1070+8 01600.0111W' 0M' M AC 641.950 140.]90 Z 71.0T 10461.0 01121.57 C2 2-71351 1041.0 wm.57 5suQ.0 1M.BT 1000.4 2H11.0T N1832T N18.32T 1014.0 0194." F NI33ZT 101436 5818171{law 36214" 497.0s 6.0 M.00 641.621 18£50.31 WIMA14 1011630 BM7.BZT 185150]1 SWMA14 16675.17 027 104-00 BW7.@T &98.21 648-021 185120.38 0180.0 um 64BaT 183®]8 58190L51llom 848.78 183'813 58208111 846.1)7 1850213 SMOa.41 8388' 1000.00 64818 643."1 643MT 166566.13 SR12138u 643.MT 16506.13 5 212lM34.51' 1241.94 100o29 sex349¢ SP6 HCRRA MINNEAPOLIS. MN LANDSLIDE REPAIRS CHANHASSEN, MN LEGEND, NOTES, ABBREVIATIONS, AND ALIGNMENT CONTROL DATA NOT 90% DESIGN SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR CONTROL DATA -ALIGNMENT'C" TYPEMD. START STATION STARTNORTHING STARTEASTING START NORTHING START EASTING 13EARNG LENGTH RADIUS PC STATION PT STATION I END STATION RADIUS PCSTATION PTSTATION ENDSTATION ENDNORTHING ENOFASTING Lt 040.])])0 1� 73 SB207Llo 1014." 562127.06, S60M+BOE 112"' W% 1006.{9 0256{.4 1.1730 041950 18521{28 5824783C1 UAW 10.00 14791s 1"W.1M 048.00 10N128 562W7a BB�INGNGTH 0M' M AC 641.950 140.]90 140]90 10181.18 0211321 C2 148390 10181.11 0211331 5suQ.0 MAW 68.50 148.390 1r 1= 148310 10127.83 56102+9C5 185582.71 146..50 10121.0 36214" 497.0s 6.0 M.00 148.580 H37.MG 34)A]L 1011630 02057" SP6 HCRRA MINNEAPOLIS. MN LANDSLIDE REPAIRS CHANHASSEN, MN LEGEND, NOTES, ABBREVIATIONS, AND ALIGNMENT CONTROL DATA NOT 90% DESIGN NORTH AREA SLOPE REPAIR CONTROL DATA - ALIGNMENT "N" TYPEINO. START STATION START NORTHING START EASTING 13EARNG LENGTH RADIUS PC STATION PT STATION I END STATION END NORTHING END EASTING L+ 04 1014 10115.02 58M70AIN 51% r T 431D4T2T2 040.00 1014+8 0Ni1.12 12 0419N 1014." 562127.06, S60M+BOE 112"' 240DON 1006.{9 0256{.4 SP6 HCRRA MINNEAPOLIS. MN LANDSLIDE REPAIRS CHANHASSEN, MN LEGEND, NOTES, ABBREVIATIONS, AND ALIGNMENT CONTROL DATA NOT 90% DESIGN DRAINAGE CHANNEL AND STORM SEWER CONTROL DATA -ALIGNMENT "S" TVPENO. STARTSTATION STARTNORTHING STARTEASTING BEARING LENGTH RADIUS PCSTATION PTSTATION ENDSTATION ENDNORTHING ENDEASTNG 7LL1 040.00 15WM.W 582110.0 N0Y1'ME 117.W 1N7,WB 18530+0 58210.17 Ct 1.1730 1655B3.M 5410AT MIETME UAW 10.00 14791s 1"W.1M I�Aal 1851N.M 58407.56 L2 1�12.1M 16501.13 58224.58 9411•N25E 155.65 Ws5 s 18555715 582N0.32 C2 N15216 165355.58 5suQ.0 N 01112£ 5237 109F N15215 7 7.528 5N7= 16562.71 5822a41 L3 SN7.Ws 185582.71 S 53.11 MrISME 150.10 497.0s 1657W6 6"3591 u 141935 1657110a tis=im N30MME M98T 847.755 16675.17 582/5171 LS 64720 {6075.11 58210.71 N7r1346E um a ws 1607.6 626393 SP6 HCRRA MINNEAPOLIS. MN LANDSLIDE REPAIRS CHANHASSEN, MN LEGEND, NOTES, ABBREVIATIONS, AND ALIGNMENT CONTROL DATA NOT 90% DESIGN STATEMENT OF ESTIMATED QUANTITIES ITEM NO. ITEM DESCRIPTION UNIT TOTAL _ ESTIMATED, QUANTITY 2021.501 MOBILIZATION LUMP SUM 1 2051501 MAINTENANCE & RESTORATION OF HAUL ROADS LUMP SUM 1 2301505 CLEARING ACRE 4.30 2101.505 GRUBBING ACRE 4.30 2104502 REMOVE CONCRETE HEADWALL EACH 1 2104502 REMOVE PIEZOMETER EACH 2 2104502 SALVAGE BENCH EACH 1 2104.503 REMOVE WOOD RETAINING WALL UN Fir 31 2104.503 REMOVE CHAIN LINK FENCE UN FT 2446 2104.503 REMOVE SEWER PIPE (STORMI (NORTH PIPE) LIN FT ] 2104.607 SALVAGE RANDOM RIPRAP CU YD 147 2104.601 REMOVE MISCELLANEOUS DEBRIS (NORTH PIPE DEBRIS) LUMPSUM 1 2305504 GEOTEKOLE FABRIC TYPE 5 SQ YD 3616 2105.601 DEWATERING LUMP SUM 1 2105.601 CONSTRUCT -ACCESS ROAD LUMP SUM 1 2105.607 EXCAVATION -SPECIAL CU YD 2824 2105.607 HAUL AND DISPOSE OF CONTAMINATED SOIL CU YD 3671 2106.501 EXCAVATION -COMMON CU YD 19,990 2106523 COMMON EMBANKMENT(CM CU YD 1808 2112.603 SUBGRADE PREPARATION UN FT 1027 2118307 AGGREGATE SURFACING (CV) CUSS SPECIAL CU YD 96 Z130523 WATER (DUST CONTROL) MGAL IS 2211507 AGGREGATE BASE (CV) CLASS 5 CU YD 253 2451307 COARSE AGGREGATE BEDDING (DY) CU YD 9 2501.502 95' SPAN GS PIPE -ARCH APRON EACH 1 25013M 24' CAS PIPE APRON EACH 2 2503.603 24' NOPE PIPE SEWER-0IRECTIONAL DRILLED UN FT 302 2503.603 PLUG FILL AND ABANDON PIPE SEWER LIN FT 115 2507.603 UNING CULVERT PIPE (95" SPAN) SPECIAL LIN FT7 2511304 GEOTEXTIE FILTER, TYPE 4 SQ YD 35 2,512.507 RANDOM RIPRAP CLASS SPECIAL (SALVAGE) CU YD 147 2511307 RANDOM RIPRAP CLASS SPECIAL (R270) CU YD 404 2511507 RANDOM RIPRAP CLASS SPECIAL (R470) CU YD 540 2511307 RANDOM RIPRAP CLASS IN CU YD 292 2511307 RANDOM RIPRAP CUSS N CU YD 128 2511307 GRANULAR FILTER CU YD 101 2511507 GRANULAR FILTER MOD(83) CU YD 405 2511.602 PLACE BOULDER EACH 20 2557.603 INSTALL CHAIN UNK FENCE LIN IT 175 2573301 STABILIZED CONSTRUCTION EXIT LUMP SUM 2 257330.3 SILT FENCE, TYPE MS UNIT 10,422 2574.507 COMMON TOPSOIL BORROW CU YD 1536 2575.504 EROSION CONTROL BLANKET CATEGORY 3N SQ YD 12,440 2575.504 FLEXIBLE CONCRETE GEOGRID MAT SQ YD 1272 2575.504 TURF REIN FORCEMENT MAT CATEGORY 1 SQ YD 2820 2575304 MULCH MATERIAL TYPE 4 SQ YD 10,990 2575305 SEEDING ACRE 7.41 REVISION DESCRIPTION IAMRI9+GIIEERINc co. �� IPOINTe owve MNNFAPOLIS, MN 55{35 HCRRA MINNEAPOLIS. MN LANDSLIDE REPAIRS CHANHASSEN,MN STATEMENT OF ESTIMATED QUANTITIES 90% DESIGN NOT FOR CONSTRL a N I S ol SITE ACCESS NOTES ' ' 'b •, I / J' f { '� f •, •'.QQ. '•l jV i^ F4�r 4 r �; i, . ti „E 1. LOCATIONS OF LITILRIES AND OTHER INFRASTRUCTURE IN HIGHNEW DRIVE AREA NRE ` I 1 �. I.. 3 J - APPROMMATE. VERIFY LOCATIONS PRIOR TO MOBIULNG TO SITE. CONRUCTIXRIS ♦ `/ ♦y F J �•L• ♦{ O �•1 �•� RESPONSIBLE FOR UIIUTY LOCATE AND HEW RECONNNSSANCE. F A T J / ..R i .t�+ ♦ 2 �• 3. SITE ACCESS FROM HIGHVIEW DRIVE PoTENTNL ACCESS ROUTESARESIDWN ON TIE PLANS. IFCONIRACTORNBSIESTOUGE JJI kol ANALTERI'NTE ACCESS R0111£.RMUSTBE RENEVED AFDAPPROVEp BT ENGINEER PRIgt `f A,.f.lu' :F ♦• ' ' ♦ ♦ • „� - +�\� 3. TEMPORARY WETLMO FILLIS ONLY ALLDNED IN THE LOCATIONS SHOWN ON THE PLANS SOMUSE SUBMIT .d+� y NOT PLACE FlLLTL IN WEM1DS,dTC1ES OUISIOE OF THESE ARFAS. / i -.Eyy. �.F�"•, A. SUBT MATERg PROPOSED FOR TEAMORMY FILLTOENGINEER FOR RENEW. T ♦ ` 1 5. MNNTAN FLOWIN gTCNES PND CONTROL WATER gRNNG CIXNSIRLCTON.THBMAT , / PlJy _ .f /� /`. INVwWE INSTA3ATIDNOFMPESANOPOTENDALYPUOPS. • f'f/ w ••' '/' - /~ E ' Kp� //r e. THE FOLL0Y6NG ITEMS ARE INCIDENTALTO PAY ITEM 2051501 MANTENANCE6 RESTORATION/ i'{ ' -"� ¢♦ v~I • •/// ` o Of WAUL ROADS _ ' fii. TRIMMING PND CLEPRING TREES ALONG ACCESS ROITE.. / r!K r\\- ! _' • .'F Tr fit. FURNISHINGANDINGTAWNGGEOTEIIRLEFABMCINNETUWOS .l, 1„11♦ // FA'1� {". // A ` `J 83. FUiNISHINGANDIN6TAWNGTEMPORARYRLLIN NEiLANDS 4 •..X.. / r pNE� // �• '_ ♦ f St. CONTROLUNGWATERAND MNNTNMNG DRVNAGEIN DITCHESTHROIIGIKKR -ir 1- Y P\ �f6r�yyA // ( •�4� /�. •ff1. CONSTRUCTION.••.. • •"�ERpI d I f`{ 4 �y 85. PLACEMENTOFADgTICNALFlLLMMRGRAVELSRMFACINGOU]61DEOFNE]LMO �r� jj]1�Nr� �.% ' ♦ Y DETAILED PLAN •' !� I 'A ' 1� y- MFACACCONfRACTORDEEMSNELESSARYTOACCEWS SITE- ._I+a%\ }� « If' w 4 :'� 66. REMOVAL OF GEOTEXTILE FN3RICAIO TEMPORPRY FlLL FRgA NETLAMBIIPONTNE J �I + '^11���iiiiAAAYYYY�FFfi 11'J'•n/ R {{�� ' j�'/ u yj, SEE ] y– / aT. COMPLETION OF CONSTRUCTION. • '7 X A .� F Nt6T ✓ ' i •L • Gae I * { ♦ d 67. SEEDING IMPACTED NEMANDS UPON THE COMPLETION OF CONSTRUCTION. ✓`1 Y Y e�6 MINNESOTA BLUFFS LRT REGIONAL TRAIL M� ," p 8.8. REGRADING THE TRAL FROM HIGHMEW DRIVE TO THE LANDSLIDE UPON COMPLETION OF •Y J, � ] ` ro}' • ; r �., CONSTRUCTION AND RESTORING THE TRAIL TO PRELONSTRUCTON CONDITIONS OR j)/r p 1 �r/ % •(( BETTER IOIIE SATISFACTION Cf ENg1EER FURISHINGANDINSTAWNGAGGREGATE ` % R✓ A I r Ly ;011, SURFACING SIDYM IXR DETNL30N SIEEFG-03WLL BE PND DOER SEPARATE PAT [ * •. / `/y y i�y�r, {. A i ♦ '� LIEN. .t' .' ' I'^ . y�.. ,9�I�'J+ �. .. '�F `Til'' 89. ALL OCIATE YATH PREPARATION HMOON%AL-EYOOWTRUCI� Aro RESATEANDN OMHIGHs / / ,;� , ., i4� {'4 a\�E I' 't j/� e' ; I f • ♦ �♦ , / ♦ +. DRIVE, IED'MTHACCESS TROUGH MOON VALET AGGREGATE AND FROAMGHWEW _ J pK0 •-1� / tt ^ 'ff/ +� ' • f ��/ t. ORAE. M/JJ HALLA GREENS 1 rJ f. GLeaO 4i ,• // `A . 1 •Y. ♦ Y ' �i+. ]. PAYTIDA 2105.801 CONSTRUCT ACCEdb ROAD IS FOR TIE LONSTRIILTIXN OFAN ACCESS j,'*4 GOLF COURSE I / T pE %ty //f f %! •' ♦1� 1 L-�S ♦ �•! (16'y]I,I6��II` J ROADFRW MGIMEWgRN£IOTEREGONAI TRIAL AIST EAST OF POFEERTRNLI)E .y'TTJ/ r.l �'�~ •� �,' ♦ ,. 1 1-'A •.�'��!._ T. 3*1 fOLLOWBNG T1EMiS AREINODENTAL TO PAYf1EM 3105..M1 CONSlAIICTACCE55 ROAD: IPS- J f f i ;C,�P,• R, N ' T l� 1 i}• 1V J� Y• •/f 71.llRlfIV LOCATE AND AVgDAN(.Eff UDUTIES IN NGNITT OF gLCE56 ROPD. / j • moi• 72 ANY DESIGN NECESSARY FOR ACCESS ROAD. }�w F�� ""/ `A�1 ■�/ d ♦1 / r F I-! I:(�' '/�.T ].3 CLEARING AND GRR8ING PRIOR TO CONSTRUCTION OF ACCESS ROAD OF NECESSARY). �" , . �.� R _ T r n 0 ) •••+++444LLL••{ Y y� ��•�y f ( •.!' _ TY,�, TR. SALVAGING AND REINSTAWNG ANY SIGNS IN CONFLICT YATH ACCESS RGAD. Ya A• •T' tyF. 1 a 4 .A� t" T� 1•.^. I�' • •I I i ,."ef ].5. PROTECTION OR SALVAGING AND REINSTAWNG EASTNG GLLARpRNL [LL['���'; fY't� ,y n t �•'1010 ]6. STRIPPNNG ANDSTOCNPIUNG TOPSOL UNDER FOOTPRINT OF RAMP OF NECESSARY). W j ( A l: � � l - FOR D ETA ILL U FI -AN wy '\ .Ij:• )]. REMOVAL OF 6ITUAINw6PAVEAffNi Of rvELESSARYI. ♦•. o. .• < • t,• SEE/ -2"'\ TL. WATER CONTROL. INCLUDING PIPES OR PUAPS TO MAINTAIN DRNNAGE TFRdIGH YYA "• {' ,�I ,RJ �'+ _l y'�+ �1 (,Y •h ,' ACCESS ROAD WRING CONSTRUCTION. 4 (_ A 't( ✓ G05 i I' - yy/ _ //--a�)+. ]A IMPORT OF FILL TO CONSTRUCT ACCESS ROAD. ' � � f - { ( H • ,l+ `` .Y +[� ].10. MAINTENANCE OF ACCESS ROAD WRING CONSTRUCTIIXN. _SA• • '' i , } •-+.} _, •'A i._* 4 f f~, 4L alt 1.l_ - RRff • ].,1. REMOVK OF iEAPORAIRYFlLL FOR ACCESS ROAp. - } ].12. REPAIR! TIREPLACEMENT CF ANY BITUMINOUS PLACEMENTDAMAf£OOMNG � # A F• .` f. .�1f'kiwi'_l, 1 ].13. INSTALLING TOPSOL,SEED. AND MULCH OR EROSION CONTROL RIANMET TO RESTORE ,J. T A ♦"Y A TO PRE -CONSTRUCTION CONDITIONS OR BETTER TO THE SATISFACTON OF THEjJ� 1. ENGINEER. NORTH REF - :Y4i(` • , -< ,`% A� • �•�..... .iIIS.iIL,i/ ';�Ip90apol l .F� A..l.�tTR/^ •�R� L ' TRAFFIC SIGNS MNDOT ON SIGN SIZE SIGN MESSAGE DWG. N0. SIGN N0. 3 W11-10 W. W Gb RNL J RM -3A 3G.36' CLOSED G� �� G-07 5 Rn¢ 35•R" TRNL CLOSED ' 5a7 DATE I REVISION DESCRIPTION CONSRtIICTION Umff$ + �: �'• '.,O w ♦ � I SIXIfH REPAIR AREA ` .._L ' .` .: "' 'a '� .•++ - - ANTICIPATED RIGH IOF ENTRY. ACCESS ROUTE TO BE FINALIZED WITH PROPERTY r f ✓ ;, OWNER PRIOR TO CONSTRUCTION. t;I.F MOON VALLEY - A . �• a' Y AGGREGATE ,r�tf•r iia• It�n or Y A PLAN OVERALL ACCESS PLAN O 0 3W fiao N 90% DESIGN SCALE IN FEET NOT FOR CONSTRUCTION w.Pn <LiU,r — — FRCpNz 5� AS SHOWN q�:• oEr F,o xs,nucna. — — — — —E r1 1}20,8 LANDSLIDE REPAIRS BARER Pr 23Ro10E1C0T T1N. a CHANHASSEN.MN YLA4YYEPF .Da HCRRA —MINNEAPOUS,101455435 M^P2 MINNEAPOLIS, MN SITE ACCESS, STAGING, AND TRAFFIC CONTROL CNG. NP. REV. REA B C D o t 2 Prt IJYO®i II>7 I1,W'e° BnRR C TORCRLEASED DATE RELEASED G -Oa "�"`4"'m' MTP3 OVERALL PLAN AND NOTES a K Y 3 0 Y d .L .. 9fBTABIUZED CONSTRUCTION EXIT, W-71 SEE •�LOIS10 __ a __ ` OE PARCEL HCRRA LINE ME) COIATRUCTION LIMITS _ ' SILT FENCE\ "1 OF SITE AOOE65 FROM HILI DRI�WTH TY OF EDEN PEA ANON NEPI EDEN PRA p . , ANOHE CIXINTY - —'I .• ... LM �� IAT l —�,•_-IMT �• L.-... LH I 11 FL IKr.• �µe � a - \ \ � � REs.oE TRAIL PER 3 uvav ca m.. 101corvsTRu17101 TEMPORA RV N£TV.ND II'PACT l+�'C PA861NG ArREA 20'NT DTN X O at ACPE6 ';IEE z 100 LENGTH \ v b• .1 '• _. L � � o� JNA +---- -- __"'\•tom`• > � -�__ V... \� pPF` N�P\N W I_ CLOSEC REPAIR OR REPLACE BITCwrvous OF uooN llw coM-S.ZI TI of corvsTRucnory sEE q `\ \ EXISTING GROUND ABTI ENORTH WElWL1XTGi E%ISTING TRAIL E%IBTING SOIRN MERANODIICH TEMPO FIUL REMOVE7---EIMETLANDANDDITCHAT TATCOMPIEIiONOFTOPACINGFIU-114 MDCONSTRUCTION COMPLETION OF CONSTRUCTION, INCUUNNG INSTALLATION OF VET IATA SEED MIX TO DISTURBED AREASAFTER REMONNG FlLL ANp GEOTEXTILE 2DETAIL : TEMPORARY D IT H FILLING NOTTOSfNE L EYJSTNG GRgM 1p TRAIL 30% — 20% �\\ _ __-______ / REGRADCONDITIONS E SURFACE TO PRECpSTRUCTION I J'THCK MB•MINUS AGGREGATE CR BETTER TO SATSFACTION OF ENGINEER SURFACING CLASS SPECIAL NOTES (SEE TABLE FOR GRADATION, 1. W MINUS AGGREGATE SURFACING SHA -1- BE 10(M CRUSHED UMESTONE. 2. LB'MINIIG AGGREWTE SURFACING MIAST COME FRpA HRAEMER MINNGd IMTEPoPIS.INC. OF BURNSMLLE, MN., IN MMR M WTCHCOLOR OF EASTNG TRAIL RELEASED TQ OR TABLE 1 CLOSED \ AHEAD ili\.4 \�S X } 0 at EXISTING GUARDRAIL / SLOPE R. _ (PROTECT OR SALVAGEANDREINSTALL CLEARANCE.WIN FFZS TRIBES PREEERRFDSCL£ARANCE.ZMIN. FORA TREES OIS PREFERRED ` FOU.OWNGCONSTRUCTION) OTHER OBSHEETS 0N. p PROTECT EXISTING SEE PLA FOR IF rji• EIRE HYDRANT OTO.AL BRIPSN ULD BE A MIN RV VARIES BEA MIN_ BOULEVARD VARIES IN M1DTH. BUT y��X�G/,,, UCABU OFY,. SIGN INSTPLIATION NOTAPPUCABLE IN ALL PROTECT EXISTING AVF .(F- UFTSTATION-- /4 F ► EDGE OF SICK. EDGEOf DRIVE ZCNEABOVETRAIL. TRIMTREE GI ROW UNE ROW ONES 231. . 49 GEISE BARD ENCANEERNG CO. ARXETPOINTE ORVE HCRRA - low_ EPF WENT PROJECT No. \Qyf PMWAIN DITCH DRAINA ERTS. ry2' ;fMAINTAINDITCHCRNNAGE MIREAPOUB,MNS M THROUGHPROPDSEDACCESS "� ROAD g1HING CON6TRUCTION )8' DWG. ND. G-06 REv. NP. D IMPACT .. -. •• PLAN AND DETAILS a �iA. ♦Ai� \ ��aa-�"�1_--_ CLOSED Z ' k � CONSTRUCT ACCESS ROAD -- 0 AS NECESSARY FOR - EOUPMENTACCESJ\ 41- 0 o\OF FFR1� j C� \ OP PLAN: SITE ACCESS & STAGING DsSO to° s=IN FEET 2 WS' MINUS GRADATION FOR AGGREGATE SURFACING (CLASS SPECIAL) SIEVE SIZE PERCENTPAsum R' IDS N 76100 fNl ZO.A 11200 6 0 mNOME WDTH AT MA%. Ai SLCPE ON SIOIADER Q SLOPE R. Q CLEARANCE.WIN FFZS TRIBES PREEERRFDSCL£ARANCE.ZMIN. FORA TREES OIS PREFERRED OTHER OBSHEETS 0N. - Ii�TTO SCALE SEE PLA FOR IF OTO.AL BRIPSN ULD BE A MIN RV VARIES BEA MIN_ BOULEVARD VARIES IN M1DTH. BUT UCABU OFY,. SIGN INSTPLIATION NOTAPPUCABLE IN ALL 0 AAEAS. MNL LROBB SLOPE YA. m MIN 3 FARANCE BETWEEN EDGE OF TRAIL ANO LANDSLIDE REPAIRS EDGE OF SICK. EDGEOf MAINTAIN 10VERDCAL CLEAR ZCNEABOVETRAIL. TRIMTREE GI BRANCHES ACCORDINGLY. l 1Pd' 10) STTOPSOIL (TYP ) 3'TYPE SPWEAMOC BffUAINOUS PAVDAEM 8'CUSB SPGGREGATE BASE 1Z SGRIFY, DRY. AFJD RECpAPACT SUBGRAOE MATERIEL AS OIREClEO BY DINER. OlES,, Bff1RMN0U5 SHALL BE PLACED IN ONE UFT. .. CLASBSAGGREGATE BABE SHPLL CONFORM TO MGTSPEG. 3138. I. BUBLBGRADE SHALL BE TEST ROLLED PRIOR TO AGGREGATE BABE INSTALLATION AFID CONFORM 1b MST SPEC.2111. I. YWIERE BO CONSTRUCTED EIGN!I FIEWCLES SHAIL BE CONSTHIICTED FROM I R E E, PAM ETC), p BE S IMNOUB.CONCRETE. PAVERS, ETC). NETsy STRWNG LAYOUT MAY APPLY, (BEE PLAN SLEETS). 4 DETAIL: BITUMINOUS TRAIL RESTORATION - Ii�TTO SCALE � JMp.T DESOV NOT FOR CONSTRUCTION R,pPO,ro �` AS SHOWN LANDSLIDE REPAIRS SPAR 231. . 11113=91113=923110100101404 BARD ENCANEERNG CO. ARXETPOINTE ORVE HCRRA CHANHASSEN,MN EPF WENT PROJECT No. MTP2 SITE ACCESS, STAGING, AND TRAFFIC CONTROL MIREAPOUB,MNS M MINNEAPOLIS, MN DWG. ND. G-06 REv. NP. D PLAN AND DETAILS BARR I i11 PIAN: TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY TP 90% DESIGN I NOT FOR CONSTRUCTION O c E INFEET IIf1FllfEmF.wima g11E(fKlttw.w Ie,.T,..JI,�..�P.. �.�„wP.��T �,+TIw• cu Errr nl a'O — — — — — — — — "°I•°°^a svt A55HOY?' n 1 SPAR PROJECT No. 23101014.04 • +vivmis M���P ulSlR �uwS MTTl %' BARR ENGINEERING fA. A �� <KEnoiNre owvt: HCRRA CHANHASSEN, MN EPv !-I JI. Zi �• "+ � .1 @tom J� i +y 4 MM`2 TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY w.- M:INNE PODS, MNssJas CO'S°^^R°°^^1°^`^ IaromC-IIn cs...pws, rnn.m P° Im i<oP�_an MINNEAPOLIS, MN • fir•' ', °i`�"^ BARR CNG. NP. G-07 R -A - A N0. By CHK PATE REVISION DESCRIPTION :,... ,:,�..,. s I i11 PIAN: TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY TP 90% DESIGN I NOT FOR CONSTRUCTION O c E INFEET IIf1FllfEmF.wima g11E(fKlttw.w Ie,.T,..JI,�..�P.. �.�„wP.��T �,+TIw• cu Errr nl a'O — — — — — — — — "°I•°°^a svt A55HOY?' n 1 SPAR PROJECT No. 23101014.04 • +vivmis M���P ulSlR �uwS MTTl CoxsmucTiox — — — — — — — BARR ENGINEERING fA. A �� <KEnoiNre owvt: HCRRA CHANHASSEN, MN EPv CLIENT PROJECT No. ,_ JvioeeEn +.c.oT•.. _ _ _ _ _ _ _ BAR soneM i +y 4 MM`2 TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY w.- M:INNE PODS, MNssJas CO'S°^^R°°^^1°^`^ IaromC-IIn cs...pws, rnn.m P° Im i<oP�_an MINNEAPOLIS, MN • fir•' RELEASED A B C D 0 1 2 TOFOR lI TR RFI RASFI °i`�"^ BARR I i11 PIAN: TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY TP 90% DESIGN I NOT FOR CONSTRUCTION O c E INFEET IIf1FllfEmF.wima g11E(fKlttw.w Ie,.T,..JI,�..�P.. �.�„wP.��T �,+TIw• cu Errr nl a'O — — — — — — — — "°I•°°^a svt A55HOY?' LANDSLIDE REPAIRS SPAR PROJECT No. 23101014.04 • +vivmis M���P ulSlR �uwS MTTl CoxsmucTiox — — — — — — — BARR ENGINEERING fA. A �� <KEnoiNre owvt: HCRRA CHANHASSEN, MN EPv CLIENT PROJECT No. JvioeeEn +.c.oT•.. _ _ _ _ _ _ _ BAR soneM MM`2 TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY M:INNE PODS, MNssJas CO'S°^^R°°^^1°^`^ IaromC-IIn cs...pws, rnn.m P° Im i<oP�_an MINNEAPOLIS, MN RELEASED A B C D 0 1 2 TOFOR lI TR RFI RASFI °i`�"^ BARR CNG. NP. G-07 R -A - A N0. By CHK PATE REVISION DESCRIPTION :,... ,:,�..,. 1 V ) Iti - t _- - 60 10° °L 4 90%DESIGN NOT FOR CONSTRUCTION LANDSLIDE REPAIRS BPNRmo Ec N. um.+Xw.wmTi X+.°w.vrr�e.P ^"`�"'°"••,f ••EF", �„�'"•�°"'E—_ Pevrtow.Xe -_____- IIWLM001RGTpN6. HCR MINNEAPOLIS, MN SIEETGOT- _ 1 V ) Iti - t _- - nW PFOB._-_-_ I'\I\V\ \ POIBiiMLACS38 ROUfE �_ Jill - �sii-rtE_�s-_•1 TRM. ��•`.._)Aw-i�"�111 ! I III 1 1 -77,77--K, __ _—• yQ1.t_� __`� Yip ___ -iT� __c_�NCE -� `. I I I I � l __-_ �_�-mss__- �>�� ' \ `-� `�1 8ff &@T 41S 10PEflF➢M _ �_ 1c \\\1lI1111 , // / / /J!J /\\ �NEwlalewAr 'ii/ / r / \ \\ \I J / //! / / //,_ \ \I \ 1 c11PNra1\Illlnll\\\ 8EE 81EETw3 r I / / / / IIII / // BEESiffTGta 1 1 ,,,, , //, / ♦vvv1v vv1v111vvv III, l \\\1 / \ ,' Bl)UIIIAIEJICIIWEITTOVREE 1 \ \\ , \ \ ♦ \ / , MOdF1GTd18, / / , 1 III \ (\ 1 / / / \ .' \ ,/ ♦ ,/ / �_ ��i� -' ',�� -�`� /' � / 1 \ 1\ \\\ \��\ II I I /, /'� / ///' //// /� /// IIII \\\\\\\\\\\\\\ \\\\\ \ / / / / / / // 11 COMSIIMILEION I/I18 / , ,.'� �_, _ _ / ,— , �• �'� ;— _— __ / \ \ . \\ 1 / I I / .,. /�./ /// / /// /, J / .—\ 1 1 \ \\ \��\\ i / ,J / ,J i j / 1 1 II / / \ wFMNtilMB sX♦ � _---'_-_ � � %iii' /S �- -� i // /// l/ / / / / / / / / / / / \ III 11flitI I IIII1IIII 1! IIII III1 I 1\ \ 1111j111 1 \ \ \\ / ,^\i i - �/ / l //// /// �� i� _�-_'______-�_-_____ �' __ ___ l _ r� / / / / / . / / `♦ 11 I I 1) / it I,If II IIII 1 /,!I / l,l -�-'--____ \ � _ BEATRICEI. - -_` _ _- /vARCELLRE-� . /J / I,'i / , 1 It I It _ /' , r' ���' �j i/ ///i/ /', i'\1 IIII IIII II ISM,� 1 _ _--'___ i / I/ __ �� / / /, / / , / / / /� �__ 11 I II I I 11 ZNAERRUS !)_r \ \ �___�-�_ �s!_ / / i%�' /' /'/' /'/ / / / / \III 1111111 1\I 1\\ IRREV. TRUST \ \ 1 t \ _ \-�_--__ �' ��_ ,J ���. J) , / \\ \ ' /,/ i '/ i// - III\II Ilk \\ /,� �J/ % l\ / / - / / 1 1 t` 1\ \\ MOONVAU.E1' \ 1 l I / / / / _/,/, / r/i / ' / \ 1 III p\ \l) 11\ 1 SUMMARY. EASEMENT NEE J -_-.-\/ �i q Y / / 1 I \ ! / AGGREGATE \\` \ l \/ / r// �''/ J'�i 1 /-`\ �\ \\I\I )IIII 111111\i tAN00YMEA - REASON FOR E/SEMEM I \ t\I\ �\\\\ \ \\ \I ) 1111\1 1 fll/1/� I /!\ •l 1/ I 11 I I / 1/ //?Y 1 \ ) \`� \\`�-�-�`\�\\ \\\\ \ 1 1\I 1111\111\1 MPMP RT SOUi11 PIPF 01fR£T. STRFAMBWII //II 1! \/ / / I1 , !/t V%/s rI ♦\\\\\\\ \\�\l 111 / // / /j ,'` 1 \11\ 111111111)111\ BFATNKFLZ'MERSOX 10.0.0.EV. TRUST REPN0.S. gUIXRGE rN�HME45TRGIHG MFA )\\1 t 111 1111 1111 ',if \ \ exvsourx smE sirt nrJxss \\\ M°ONvwnnF,GRFf#TE 5OUM 5roEv1F/mss _ /_ ♦_' \..__�__--_`� ����.C�\.. 0��`M \ '�4%;1\\\`\�� \`� \\\\ \\ \\` \\\ \\\\ \\\\\ l\\\ \ � \ l \ I \\ II11 1111\1\\\\ \�� \ \\1 4 \`�\\\\\\�\\mac=v:/i\I II \ \\ �� \\\\Q\\\\\\\\\\\\\ �\\ \\ \/ \ t\I\ \\ %\ \ \J\\\ 51\\ \\ //. 1 PLAN: PROJECTLAYOUT 60 10° °L 4 90%DESIGN NOT FOR CONSTRUCTION LANDSLIDE REPAIRS BPNRmo Ec N. um.+Xw.wmTi X+.°w.vrr�e.P ^"`�"'°"••,f ••EF", �„�'"•�°"'E—_ Pevrtow.Xe — — — — —_ —_ — — — — — — — 13RRIt ENRIIEEItlHG co. ��L sn Cll)(I a•:TraNreorove — MIMEPPIXJS. MN B �""i Xi°�"` Pnimo�_an >mi HCR MINNEAPOLIS, MN CHANHASSEN. MN 23101014.04 t2n3zme wENrPRo.ecrw. Merz PROJECT LAYOUT PLAN REFFA6ED A B C D 0 1 2 mWb SPAR °rw G-08 �„ D NO BY CHrc PPP. GTE I REVISION DESCRIPTION KIM 'E%ISTNG CIWKINK FENCE _ PPPROAIMTE tAND5l1GE UMITG ---.��`_ �__- \ gPPROXJMAlE UW0.SLIOE SPpL1%lE� l\� EXISTNG STREMI THALNEG� I \ � CONSTRUCTION UMITS It mNr,nwE O W4 _ /.i]I//� _ - --------- �� / _ _ _ iell_ IXISIING WETI/JD PARCELUNERYP) t '=1 APPROJIM- SLOPE �� I ON _ E'CSIONJIM-TS 1 > - iLo / I CONSTRUCTOR UMITS �NORTH CROSSING (SEE (SEE PHOTOOTO 5, SHEET G02) 1 1 ---- - I gTE pG0E55 FROM _ - cHPJNLINK FENCE � HIGNVIE`N DRIVE _______________________ -I r IXISTNG BENCH • / � _ / /i iii//�1 I I I �j EY ONCRETEHEODVIAIL EMSTING NOODEN FENCE AND EPHOTOS HOT -.. ✓ / MEHOT0534.SHEET C-031 MODIAAR BLOCI(RETNNING WILLL _ QO 6Ti TEMPORARY REPAIR RIPRAP AR O (bEE PHOTOS IJ, SHEET C-0Zl 6T41 RELEASED TO/FOR E%ISTNG FIBER OPTC CABLE 11\ PLAN: EXISTING CONDITIONS ©y a w 1W GCALE IN FEET Vigsy Clye NS SIIJI BARR ENGINEERINGCO. Ibi3(10 4"�KETP(NNTEDRIVE EPF MINNEAPOLIS, MN 55135 MTM ST-, P S LRT REGIONAL TRAIL v� E%ISTNG IB'gP SO4 CONSERVATIIXJ EASEMENT HCRRA MINNEAPOLI3, MN ST -9 85 6— sa Ss SSS EASING STOMA SEMR NORTH PIPE UPSTREAM INLET (SEE PHOTO e, SHEET C42) GENERAL NOTES. 1. ALL UTILITY INFIXRMTON IS APPROAMATE PND SINII BE FlELD VEMFIED BY CONTPACTOR. LANDSLIDE REPAIRS CHANHASSER MN EXISTING CONDITIONS PLAN 90%DESOV NOTFORCDNSTRUCTON 4z` �Ae v S �h }ifr`.�ry s, s �Y T i•l /Y. �JI �+ti� { 4z` sasses sasses eeeeee��� �Ae v S �h }ifr`.�ry s, sasses sasses eeeeee��� 3 MINNESOTA BLUFFSLRT A^P- --_• REOb.N/1TRA9.yL -�� - -APPROXIMATE UMITS - \ .max -'\ CONSTRIK:TON _ - / �� STAGING MEA - J J / 1 1 / ! / I moi. J iy:$i ii/rf/rL / ( I / J /i I ! '1 N 1 1� / l _ __ _ B%_ __ -- ' _ __ / — — -- — — —— _ _ _ PROPERTY UIE (iYP) REMOVE EXISTING EMOVE PIPE DEBRIS Fil REaSTNG WOMEN FENCEAPPRO%IMATE lAN0GL10E LIMITSAGESTING@ TIHEGRAELNO�=ADJACENTTOBN BLIIFFLREIXDR PXRka8TPoCTSTAFF / f 1 HEaBTING MODULAR = /_- f ___� =-== SILT FENCE (iYP) CONCRETE HEADWALL SEI �SALVAGEAO STFO�UERRE / I EXISTING=PRM FOR REUSE /\ - �- CONSTRUCTION OMITS REMOVE AND DlP EXISTING RQq.ElERS PER ENgNEERS gRECTON� /� MOON VALLEY AGGREGATE OF NORTH PIPE.. SEE SEE C - C-10 FILL EXISTING NORTI PIPE NITI GROUT AfA ABANDONINPUCE. `' 1 SEE GIB vy sla f SALVAGE EXISTING CHNNLINK FENCE MID GATES IAPPR0X.2Hfi LFI AND PLACE IN THE GRAVEL PARXING LOTADLICENTTO BLLiF CREEK DR PARK IDSTRK:T STAFF YMLL IWUL AVMY. CONSERVATONEASEMENT PROTECT EXISTlNGTRAIL i i SITE ACCESS FROM HGHVIEW DRIVE (SEE SHEET G EROSION CONTOL LEGEND -------- CONSTRUCTION UNITS SEDIMENT LOGS SILT FENCE CONSTRIICTpN ENTRANCE EXISTING ID CONTOUt FASTING x'CONTMR — — — — CLEARING LIMITS EROSION 0 SEDIMENT CONTROL NOTES. TION AREAS WHICH HOVE ]. TEMPORARILY IXt PEWAANENRY STABILIZE ALL CONSTRUCTION 1 INT PERIMETER n SSHONN dR TILE PLANS PRIOR TO INSTALL CONTROLATTIELIXA CN NG,IN WHCAI GRADING OR SITE BULLING FI NG AND ULaEAs UNDERGONE FINAL GRAM ECCXME T OF PAN ES. NCEMEMOFANYLaOgNSTAU- Y UNDERWAY AGAINST EROSION DUE TD PLAN. CONSTRUCTION WERATOND ARE NOT ACTIVELY TEORCONBTRIICTONSTRUC 2 BEFORE BEGINNING PORARY ROCK CONSTRUCTION CONSTRUCTION,WHEREVEHICLES WIND AND TO BEGIN AT ANDBECOMPLETIED EACH SEXIT EACHPOINT WHEREEVEMCLEW)VATHE CCNMIRUCTONSITE PR TOUSE DAYSRUNNINGUSE SEE ANDMUICF! EN NG MITHINI XDAYDNS MEED M TIROL TI D/OR SODDING AND COMNIECING CH REMOVAL. OR WICKACROSS ANYER .REOVEALL TENPORM SYNTHETIC, TEMPORARYSCESE STAKINGINGRDABI-E RPo IN ENTRE OR GREATER DIAMETLATE CRACTIVITIESSSFI. ENDIRE 61NCHESTAST ORGRFATERENTRACE OSIONA DSEDMALL RTFIE STEHA EROSIONAFTBJSHN11E HAS CKLEAST AT FEET VADTHOFTI EXTEND THE FEETITO UNDERGONGRADASTABILSIONP WTHPEENTCONTROLDENCEG ENTFINAL UNDERGONEFINALPUFPGUnOF WITH PEOVALI7V TO FABRIC BENEATH THE AGGREGATE TO PREVENT GETIERMKENTRANCEAlFIE THE CONSTRLCTON ZONE USING A GEOTE%TIIE ZONE USING COVER REMOVAL IS ]O)b ESTABL151ED LOVER ODER ST MIUTATON FOR PURPOSES OF THIS EM ESTABLISHED MIGRATION OF SOIL IMO THE ROCK FROM BELOW. DENUDED AREA ]. REMOVEALL SOILS AND SEDIMENTS TRACKED DONTOPUBLIC B. CHANGED TOAPPROJED EROSION 4OVIDE BEMPROVEDBY THEENGINEERFOR RE MOTH SHALLRUCTIO O GSHA UNIREMOVALS BEC1144CE PRIVATE RAVEMENTAREAS.ATHE TO PROVIDEINSTALLATION AND DETAILS FOR ALL PRIORTO ACTOR TO TYPE AND DONE IN A MANNER BE MAINTAINED THRMGHMTTHE DIAEATON OF THE CONSTRUCTION AND DONE INAMANNER DURATION DEIRNCTOR PROPOSED PLTERNATE TYPE OEMCES. SED ALTERNATE TO PREVENT MST BEING BLOWN TO ADJACENT PROPERTIES. e. IF DEWATERING OR PUMPING OF WATER IS NECESSARY, THE CONTRACTOR IS RESPONSIBLE M. INSTALL INLET PROTECTION AT ALL PUBUC AND PRIVATE CATCH BASIN INLETS WHICH RECEIVE FOR MTANNG ANY NECESSARY PERMITS ANDXg APPROVALS PRIOR TO DISCHARGE OF ANY RUNOFF FROM THE OsMRBED MEAS.CONTRACTOR SHALL CLEAN. REMOVE SEDIMENT, OR WATER FROM TIE SITE. IF THE DISCHARGE FROM THE DEWATERING OR PUMPING PROCESS I$ REPLACE STORM DRAIN INLET PROTECTION DEVICES ON A ROUTINE BASIS SUCH THAT TIE TURBID OR CONTAINS SEDIMENT LADEN WATER. IT MUST BE TREATED THROUGH THE USE OF DEVICES ARE FULLY FUMT10 L FOR TIE NEXT RAIN EVENT. SEDIMENT DEPOSITED IN SEDIMENT TRAPS. VEGETATIVE FILTER STRIPS, OR OTHER SEDIMENT REDUCING MEASURES AN)NR PLUGGING DRAINAGE SYSTEMS IS THE RESPONSIBILITY OF THE CCNRRACTOR.HAY SUCH THAT THE DISCHARGE IS NOT VISIBLY DIFFERENT FROM THE RECEIVING WATER. BALES OR s ME NOT ALLOWED FOR INLET PROTECTION. EROSION CONTROL MEASURES IMY BE REQUIRED AT THE DISCHARGE PANT TO ILTERFABRCWRAPPEDGRATE 5, LOCATES OIL OR DIRT STOCKPILES NO LEMS THAN PUBLIC PRIVATE PREVENTS E SCOUREROSIONNROADWA. NGFO MORE THAN SE S. STABILME IFREMNNNGFORMORETHW DERMVEN INST SEED MULLION, AND HER 0.EVETMEM IN TO INBTALLDECE ANS. TRMONFPILES MULCHING. HRROL TINESMYORDRANAULCHING. VEGETATIVE WTHDSIGNTROLBIANKEE TSR-01AWDR SHEETSR-01ANOFAL ACCORDATRACTOR BY CG SILT BARRIERS R INGTHEEPILES,S. EROSION L ARRIERSAROUNDTIE PILED. ERSHALLNEEP ALWOFanT AND ENGINEER 11 gplHCplIRAC INFERS ALLMALLSTOCKFlIES TEMPORARY EROSION MDN CONTROIL MCESINPLACE UNTIL THE fi ANDSDIMEN SJFGRFATERT FOR DIAMETER AT BREAST HEIGHT REMOVED RARING CONSTRUCTION. SEE SHEET R -0x FOR TREE THEIGWI CONTRIBUTING ANAGE PREM STANI iTEMNRARY EROSION AND CEDIMEN YASISANDR REPLACfAffMREIXMPEMENTS. ADAILAS BASIS AND REPLACE DETERIORATED. DAMAGED. qi LONG PLACE SEDIMENT CONTROLDEVICES ROTTED EROSION CONTROL DEVICES MPIEDIATELY. VIAS GPLAN' REMOVALS AND TEMPORARY EROSION CONTROL 00 X �••�1N� y Wo DESIGN NOT FORCONSTRLICl10N I16EnmHnTllaM ms uvvefflrwlwRox am.w.s.l®ueonMPnlAUAwvEA� r — ASSIHDM LANDSLIDE REPAIRS BARR PRasc No 23101014.04 iwEa urs oDilE TRuclwx ------pApp D�1Rli BMR ENGNEE1,,cR Awa MMxErooINrE DRIVE sone 2Do IN 6165 �o ���- Txn PP EPF AKH HCRRA MINNEAPOLIS. MN CHANHASSEN,MN CLIENT PROJECT No. REMOVALS AND TEMPORARY EROSION CONTROL PLAN C-03 D RELEASED A I B C D 0I 1 I2' PcrwTME No. BY Hrc. P. DATE REVISION DESCRIPTION use TocoR acre A XIH w 6 PENETRATE S FT. WIN LBNGMPOST PF�AAFNi LOG T AT FT MAX. SPADING NOW STAN PLASTIC DP TIES SAN. SO LBS MACIBIE WCED MLT FENCE PER MNDOT STD. TENMLE STRENGTH) ON TOP NSEDIMEM LOG •K`D'. SPECHICATON 3585. INSTALLPERNDOT rMIN.3FERFOST IIOW STAKE TO ONLY STD. SPEC. 2511 PENETRATE NETTING. --`-'S'{�•-- GEOTEXTIEFABPoC.36MIN. �' ;,`§t�Nv TWOOD LYAKE ^:.1.•d .v..•_ Immmimmmaj Vr MACHINE 3NCEF"TO 1Y F + �' DEPTH 1PLUsr FLAP) Low ''. V'-±_.��...• _ �\��\�/�\��\. �\\ ��\��\ GRADE NOTES: SECTION VIEW 1. SILT FENCE SHALL BE INSTAl1fO PRIOR TO ANY GRADING WIXRK INTEARFA TO BE PROTECTED AND SNLLL BE MAMTAINED THROUGIDUf TIE CONSTRUCTDN PERDD.MLT FENCEANO ANY ACGARAATED SEGMENT SHALL BE REMOVED IN LONAINLTON VtfT11 TIE FlNM GRADING MD SITE STAMLIIATON. 3. MLT FENCE INSTPIIATON AID MATEPoMSSHALL FEET THE REOUREMENTSOMWWTSPEGFlGTONS ZST3AND 3888. 3. NOHOLESORGAPSSH BEPRESENTINM1NOERSILTFENCE. PREPMEMFAASN DTOSMOOMSURFACEORREAIOV MMS. 4. MEN SEDIMENTBULDUP REACHES IOOF FENCEHEIOW. THE SILTFEWESHWID BE REMOVEOORASEDONDSILTFENCE INSTALLED IFSTREAM aF THE EXISTING FENCEATA SUTABLE DISTANCE. 5. MEN SPLICES ARE NECESSARY MAKE SPLICE AT POSTACOORDING TO BRUCE DETAIL. PLACE THE END POST OF THE SECOND FENCE INSIDE THE END FOSTOF THE FIRST FENCE. ROTATE BOTH POSTS TOGETIER ATLEAST 180 DEGREES TO CREATE A TGW SE WTH THE FABRIC IMTERIAL, CUTTIE FABRIC NEAR TIE BOTTOA OF TIE POSTSTO ACCOMMODATE TIE B INCH FLAP. TEN DRIVE BOTH POSTS AND BURY THE FLM. COMPACT BACKFILL. T \ DETAIL: SILT FENCE - MACHINE SLICED NOT TO SCALE CUPS STAKE ENDS MR) STORM GP/ SEd1AEM L__ PLAN VIEW STAKE END (TYR) SEDBEIRLOG SECTION VIEW NOTES: 1. INLET PROTECTION SHALL M INSTALLED PRIOR W ANY GRADING WORK IN ME AREA TO N PROTECMDCRM EMMLYFDI101MIDGTCIEAMNIMTALIATON.AHDSHALLBE MAINTAINED TNROUGNGUT TE cONSTRLCTION PERIOD. ]. IMTEPoALS SIVML BE SUFFlCIEM tt1gLLOW FLOV NMILE BLOCMNG SEdMEM. NO HOLES Oft GMS SHOLL BE PRESEMINANCER SEDRENTLOG. 3. TIBET PROTECTION SMALLBE CIEAIED IS REOURED. A. FUTEPoALS NDANY ACCUAULAIFD SEOMFMSNML BE REMdJEp INCOUIIICTW WTI TIE FlNM GRAdNGAW SffE STANLWTDN AN DETAIL: INLET PROTECTION - SEDIMENT LOG NOT TO SCALE REVISION DESCRIPTION RELEASED TOFGR SIDE VIEW ON SLOPE SIDE VIEW FLAT FRONT VIEW TOP VIEW NOTES'. 1. INSTAIL SEDEENT LW AI.OIG cOMOIRS (fDNSTANT ELEVATION). 2. NO COPS SHOLL BE PRESEM UNDER SEOMEM LOG. PREPARE MEA AB NEEDED TO SMOOTI6LFEACE OR REMOVE DEBRIS. 1. REMOVE ACGA.MATED SEGMEM VAEN RFACHNG TTI OF LOG IEIG1rt. A MAINTAIN SfdMEM LOG THROIDIDUTTE CONSMIDTON PERDO AN[ REPLACED AS REWIRED. 3 DETAIL: EROSION LOG - STAKING NOT TO SCALE rilp'' F)ffi r fir. d RADIUS RTUNI�" RADIUS AS REQUIRED B"MINIMUM GEGTE%TILE FABRIC (OPRONAL) rswasHEO RocK NOTES'. 1. MAIMMN ENTRANCE IHRWGHdff TIE CONSIRUCTON PERIOD AID REPAIR OR REPLACE AS REGURED TO PREVENTTIUCMNG OFFSITE. 2. REMOVE ENTRMTLE IN CONAAHCTON NIM FlNM GRAONG AID SRE BTABIUNTCN. 4 DETAIL: STABILIZED CONSTRUCTION EXIT NJTTO. Pyepb AS SIq BwR ENGI NEERI NG co. 1 vl veI �MARIElPGN1E DI8VE n..� EPF MWVPI�POU3, MN 55838 4vu. HCRAA MINNEAPOLIS, MN. `Ds SLOPE INSTALLATION NONE: I I, REFEATONMIUFACTWER RECCMIENDAT)NS FOR STAPLE PATTERNS FOR S"EINSTMLATDNS. 2. PREPNESOILWLDOSENRGT t-2NCHESMIDA YSEED(NIDF£BTERERWHEREREWIRED) PNIOR t0 NSTALLNG BLAKKET3. GRONOSHOULD BE MAOOTH AND FREE OF OESN6. 3 BEGIN (A)AT THE TOP OF THE MORE AND HCH -1- THE BLANKETS DOM OR (B) AT ONE EIA OF THE $LCPE /JU ROLL THE BLAN�f3 HORQONTALLY PCRQ53 THE POPE s. TE EDGES OF PARALLEL BLANKETS MUST BE STAPLED INYM APPROXMATELY W OWRIAP,"M THE IRNLL BLANIfET ON TOP. S VALERRWIIO=IS WIST BE SPLICED DdrNR THE SLOPE. PIAGE BIAIiD:TS END OVER ENO (SINGLE SMEIwITH NPPROgMAIELY B"OVERLM. STAFTE TIROUGH OVERIMPED ARFq MPRO(IIMTELY 1Y APART. B BL/MKET MATERMLSSIWL BEM SPEGFMDRAE APPROVEDBV FNGMEER. 5 DETAIL: EROSION CONTROL BLANKET - INSTALLATION NOT TO SCALE TEMPORPAY EROSION COMRW SEEDING NOTES: T CONTMCTORSNYL PERFOPMTEMIVRA Y NGINAOOTONTOTEFPORARYMIILCHN OOSUAESIS TOBFIDRN21DAYS- IMHMMTSTOPaR SETM753B.I,UO ,ROpA,D MID-TEW®MIXTIJRES AS SNOWTI IN 38T8.'BEED", TABLE38]8-1 FOR TEMPORARY SEEDING 2, PERFORM TEMPORARY Mt.L RING TO PROTECT THE SITE FROM EROSION MEN LEFT TOE FOR KbORE THAN ONE WEEK AND DUBNG NONSEEOING PERIODS AND MEN ORSIDE THE SEEDING AND SODDING DOTES. FOR AREAS LESS THAN TWO ACRES, MACH IN ACCORDANCE KITH MnDOT STANDARD SPEGFICATONS BECTON 2575.3M,'RAPID STABILL2ATOi" 90% DESIGN NOT FOR CONSTRUCTION LANDSLIDE REPAIRS --23Wio14.04 CHANHASSER MN iWEtiTFfWECTNo TEMPORARY EROSION CONTROL DETAILS 1.0 GENERAL CONSTRUCTION ACTIVITY INFORMATION' 3.0 PROJECT PLANS AND SPECIFICATIONS: THIS STORMWATER POLLUTION PREVENTION PLAN (SWPPP) HAS BEEN PREPARED IN COMPLIANCE WITH THE MINNESOTA GENERAL REQUIRED FEATURE SHEET NUMBER STORMWATER PERMIT FOR CONSTRUCTION ACTIVITY NO. MNR100001 (GENERAL PERMIT), AS REQUIRED BY THE MINNESOTA • PROJECT LOCATION AND CONSTRUCTION LIMITS G-01 POLLUTION CONTROL AGENCY (MPCA) UNDER THE NATIONAL POLLUTANT DISCHARGE ELIMINATION SYSTEM/STATE DISPOSAL • EXISTING AND FINAL GRADES, INCLUDING DRAINAGE AREA BOUNDARIES, DIRECTIONS C-W,C-14,C-16 SYSTEM (NPDES/SDS) PROGRAM. OF FLOW AND ALL DISCHARGE POINTS WHERE STORMWATER IS LEAVING THE SITE OR TIRE: PROJECT ENGINEER PHONE NUMBER: (612) 3485370 ENTERING A SURFACE WATER • LOCATIONS OF POTENTIAL POLLUTION -GENERATING ACTIVITIES IDENTIFIED IN PERMIT THE PROJECT IS LOCATED IN THE CITY OF CHANHASSEN, CARVER COUNTY, MINNESOTA PROPOSED CONSTRUCTION ACTMTIES • SOIL TYPES AT THE SITE C4)5A WALL TAM PLACE ALONG AND JUST SOUTH OF THE MINNESOTA BLUFFS REGIONAL TRAIL BETWEEN FLYING CLOUD ROAD AND • LOCATIONS OF IMPERVIOUS SURFACES C-0B,G14,C-16 LAKOTA LANE. THE APPROXIMATE CENTROID OF THE PROJECT HAS A LATITUDE OF 40.8IM92 AND A LONGITUDE OF A3.526089. THIS PROJECT INVOLVES EROSION CONTROL, REPAIR AND REGRADING OF LANDSLIDE DAMAGED SLOPES, REPAIR OF DAMAGED CULVERTS, INSTALLATION OF STORM SEWER AND MANHOLES AND SITE RESTORATION. THE PROJECT AS PROPOSED HAS A TOTAL DISTURBANCE AREA OF 7.22 ACRES. EROSION PREVENTION AND SEDIMENT CONTROL MEASURES ARE REQUIRED TO MINIMIZE SEDIMENT FROM BEING TRANSPORTED INTO BLUFF CREEK WHICH IS AN IMPAIRED WATER. REFER TO PROJECT DRAWINGS FOR FURTHER DETAILS. (CSW PERMIT PART IIUA) 1.1 PROJECT SIZE AND CUMULATIVE IMPERVIOUS SURFACE. • THE ANTICIPATED AREA OF DISTURBANCE IS APPROXIMATELY 7.22 ACRES. • THE TOTAL AREA OF PRE -CONSTRUCTION IMPERVIOUS AREA IS APPROXIMATELYO.70 ACRES. • THE TOTAL AREA OF POST -CONSTRUCTION IMPERVIOUS AREA IS APPROXIMATELY 0.70 ACRES. • THE TOTAL NEW IMPERVIOUS AREA IS APPROXIMATELY O ACRES. 1.2 DATES OF CONSTRUCTION: • ANTICIPATED START DATE: TBD ANTICIPATED END DATE. TBD 1.3 CONTACT INFORMATION: NA OWNER: HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY MAILING ADDRESS: 7014TH AVE S. #400 NA CONTACT PERSON. JESSICA GAUTZ TIRE' PROJECT MANAGER PHONE NUMBER: (612) 348-2691 EMAIL ADDRESS: ,ESSICA,GALATZ@HENNEPIN.US ALTERNATE CONTACT PERSON: KRISTINE STEHLY TIRE: PROJECT ENGINEER PHONE NUMBER: (612) 3485370 EMAIL ADDRESS: KRISTINE.STEHLY@HENNEPIN.US OPERATOR / GENERAL CONTRACTOR WILL OVERSEE IMPLEMENTATION OF THE SWPPP): TBD MAILINGADDRESS' CONTACT PERSON: TOTE: PHONE NUMBER: EMAIL ADDRESS. PARTY RESPONSIBLE FOR LONG-TERM OPERATION AND MAINTENANCE OF THE PERMANENT STORMWATER MANAGEMENT SYSTEM' HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY MAILING ADDRESS: 7014TH AVE. S. •400 CONTACT PERSON. JESSICA GALATZ TITLE' PROJECT MANAGER PHONE NUMBER: (612) 348-2691 EMAIL ADDRESS: JESSICA.GAUTZ@HENNEPIS.US WATERS WITHIN ONE MILE (NEAREST STRAIGHT LINE DISTANCE) THAT ARE LIKELY TO RECEIVE STORMWATER RUNOFF FROM THE PROJECT SITE (CSW PERMIT ITEM 5.10) INCLUDE' SPECIAL IMPAIRED PUBLIC WATER WITH WORK NAME OF WATER BODY TYPE") WATER BODY ID M WATER? M WATER? M IN WATER RESTRICTIONS? BLUFF CREEK CREEK 07020012-710 NO YES NO RICE LAKE LAKE 27-0132-00 NO NO NO (1) TYPE EXAMPLES: DITCH, POND, WETLAND, CALCAREOUS FEN, LAKE, STREAM, RIVER (2) WATER BODY IDENTIFICATION (10) MIGHT NOT BE AVAILABLE FOR ALL WATER BODIES. USE THE SPECIAL AND IMPAIRED WATERS SEARCH TOOL AT: HI-IPS.IAWYYYPCASTATE.MN.USMATEWSTORMWATERSPECIAL-AND-IMPAIRED-WATERSSEARCH (3) REFER TO CSW PERMIT SECTION 23. IMPAIRED WATER FOR THE FOLLOWING POLLUTANT(S) OR STRESSOR(S)' PHOSPHORUS (NUTRIENT EUTROPHICATIGN BIOLOGICAL INDICATORS), TURBIDITY, TOTAL SUSPENDED SOLIDS (TSS), DISSOLVED OXYGEN, OR AQUATIC BIOTA (FISH BIOASSESSMENT, AQUATIC PLANT BIOASSESSMENT, AND AQUATIC MACROINVERTEBRATE SIOASSESSMENT) 2.1 SPECIAL AND IMPAIRED WATERS THE MPCKS SPECIAL AND IMPAIRED WATERS SEARCH TOOL WAS USED TO LOCATE SPECIAL AND IMPAIRED WATERS WITHIN ONE MILE (AERIAL RADIUS MEASUREMENT) OF THE PROJECT SITE.BLUFF CREEK HAS AN EPA -APPROVED IMPAIRMENT FOR TURBIDITY AND FISH BIOTA THESE IMPAIRMENTS ARE CONSIDERED CONSTRUCTION RELATED AND REQUIRE ADDITIONAL BEST MANAGEMENT PRACTICES (BMPS) OR PLAN REVIEW FOR COMPLIANCE WITH THE GENERAL PERMIT. (CSW PERMIT ITEM 2.7 AND SECTION 23) ADDITIONAL BMPS OR OTHER SPECIFIC CONSTRUCTION RELATED IMPLEMENTATION ACTIVITIES IDENTIFIED IN AN APPROVED TOTAL MAXIMUM DAILY LOAD (TMDL) INCLUDE IMMEDIATE STABILIZATION OF EXPOSED SOIL AREAS AND CONSTRUCTION OF A TEMPORARY SEDIMENTATION BASIN FOR COMMON DRAINAGE LOCATIONS THAT SERVE AN AREA WITH 5 OR MORE ACRES. (CSW PERMIT ITEM 5.19) 2.2 PUBLIC WATERS WITH WORK IN WATER RESTRICTIONS' THIS PROJECT DOES NOT INCLUDE WORK IN PUBLIC WATERS. (CSW PERMIT ITEM 511) 2.3 WETLAND IMPACTS: THIS PROJECT DOES NOT INCLUDE WETLAND IMPACTS. (CSW PERMIT ITEMS 2.4 AND 2.10, AND SECTION 22) 2.4 ENVIRONMENTALREVIEWANDOTHER REQUIRED REVIEWS: STORMWATER MITIGATION MEASURES ARE NOT REQUIRED ASA RESULT OF AN ENVIRONMENTAL REVIEW (E.G., EAW OR EIS), ENDANGERED OR THREATENED SPECIES REVIEW, ARCHEOLOGICAL SITE REVIEW, OR OTHER LOCAL, STATE, OR FEDERAL REVIEW CONDUCTED FOR THE PROJECT. (CSW PERMIT ITEMS 2.8, 2.9, AND 5.16) 2.5 KARST AREAS OR DRINKING WATER SUPPLY MANAGEMENT AREAS: THIS PROJECT DOES NOT INCLUDE ANY KARST OR DRINKING WATER SUPPLY MANAGEMENT AREAS. (CSW PERMIT ITEMS 16, 19, 16.20, AND 18.10) RF EASED REVISION DESCRIPTION nrt n� ��� TpFGR LOCATIONS OF AREAS NOT BE BE DISTURBED (E.G., BUFFER ZONES, WETLANDS, ETC.) C-0B,C 14,C-06 LOCATIONS OF AREAS OF STEEP SLOPES C -06,C -14,C-16 • LOCATIONS OF AREAS WHERE CONSTRUCTION WILL BE PHASED TO MINIMIZE DURATION NA OF EXPOSED SOILS • PORTIONS OF THE SITE THAT DRAIN TO A PUBLIC WATER WITH DNR WORK IN WATER NA RESTRICTIONS FOR FISH SPAWNING TIMEFRAMES • LOCATIONS OF ALL TEMPORARY AND PERMANENT EROSION AND SEDIMENT CONTROL G -03,G -05,G08 BMPS AS REQUIRED IN PERMIT SECTIONS 8 THROUGH 10 AND 14 THROUGH 19 • BUFFER ZONES AS REQUIRED IN PERMIT ITEMS 9.17 AND 23.11 C-0B,G14,C-16 • LOCATIONS OF POTENTIAL POLLUTION -GENERATING ACTIVITIES IDENTIFIED IN PERMIT C -05,C -14,C-08 SECTION 12 • STANDARD DETAILS FOR EROSION AND SEDIMENT CONTROL BMPS TO BE INSTALLED C-04 AT THE SITE 4.0 BEST MANAGEMENT PRACTICES(BM 4.1 EROSION PREVENTION PRACTICES. 1. BEFORE LAND DISTURBING ACTIVITIES BEGIN, THE LIMITS OF THE AREAS TO BE DISTURBED DURING CONSTRUCTION WILL BE DELINEATED WITH FLAGS, STAKES, SIGNS, SILT FENCE, ETC. 2. TEMPORARY STABILIZATION OF SOILS AND SOIL STOCKPILES: (CSW PERMIT ITEMS 8.4, 8.5, AND 23.9) a. AREAS OF EXPOSED SOIL WILL BE STABILIZED WITH EROSION CONTROL BLANKET, PRESERVATION OF MATURE VEGETATION, MULCH OR EQUIVALENT MEASURES. b. IF PRESENT, SOIL STOCKPILES WILL BE STABILIZED WITH MULCH (SUCH AS STRAW MULCH, EROSION CONTROL BLANKETS OR EQUIVALENT MEASURES. c TEMPORARY STOCKPILES WITHOUT SIGNIFICANT SILT, CLAY, OR ORGANIC COMPONENTS (E.G., CLEAN AGGREGATE STOCKPILES, DEMOLITION CONCRETE STOCKPILES, SAND STOCKPILES) AND THE CONSTRUCTED BASE COMPONENTS OF ROADS, PARKING LOTS, AND SIMILAR SURFACES ARE EXEMPT FROM THESE STABILIZATION REQUIREMENTS. 2. STABILIZATION OF DITCH AND SWALE WETTED PERIMETERS: (CSW PERMIT ITEMS 8.6 THROUGH BE) a. IF SOILS WITHIN EXISTING STORMWATER DITCHES OR SWALES ARE DISTURBED, THEY WILL BE STABILIZED WITH CHANNEL EROSION CONTROL BLANKET, RIPRAP, TURF REINFORCEMENT MAT OR EQUIVALENT MEASURES. b. MULCH, HYDROMULCH, TACKIFIER, POLYACRYUMIDE, OR SIMILAR EROSION PREVENTION PRACTICES WILL NOT BE USED TO STABILIZE ANY PART OF AN EXISTING STORMWATER DITCH OR SWALE WITH A CONTINUOUS SLOPE OF GREATER THAN 2 PERCENT. c THE LAST 200 LINEAL FEET OF LENGTH OF THE NORMAL WETTED PERIMETER OF ANY TEMPORARY OR PERMANENT DITCH OR SWALE THAT DRAINS WATER FROM ANY PORTION OF THE CONSTRUCTION SITE, OR DIVERTS WATER AROUND THE SITE, WITHIN 200 LINEAL FEET FROM THE PROPERTY EDGE, OR FROM THE POINT OF DISCHARGE INTO ANY SURFACE WATER WILL BE STABILIZED WITHIN 24 HOURS AFTER CONNECTING TO A SURFACE WATER OR PROPERTY EDGE. d. STABILIZATION OF THE REMAINING PORTIONS OF ANY TEMPORARY OR PERMANENT DITCHES OR SWALES WILL BE COMPLETED WITHIN 14 CALENDAR DAYS AFTER CONNECTING TO A SURFACE WATER OR PROPERTY EDGE AND CONSTRUCTION IN THAT PORTION OF THE DITCH HAS TEMPORARILY OR PERMANENTLY CEASED. 3. ENERGY DISSIPATION AT PIPE OUTLETS: ENERGY DISSIPATION AT PIPE OUTLETS WILL BE PROVIDEDWITH ONE OR MORE OF THE FOLLOW METHODS: RIP RAP, SPUSH PADS, GABIONS, OR EQUIVALENT MEASURES. (CSW PERMIT REM 8.8) 4. EROSION PREVENTION IMPLEMENTATION TIMELINES: (CSW PERMIT ITEMS 5.4, 8.4 THROUGH 8.6, AND 239) a. STABILIZATION OF EXPOSED SOIL AREAS (INCLUDING STOCKPILES) WILL BE INITIATED IMMEDIATELY TO LIMIT SOIL EROSION WHENEVER ANY CONSTRUCTION ACTIVITY HAS PERMANENTLY OR TEMPORARILY CEASED ON ANY PORTION OF THE SITE AND WILL NOT RESUME FOR A PERIOD EXCEEDING 14 CALENDAR DAYS. b. IF THE EXPOSED SOIL AREAS DRAIN TO A DISCHARGE POINT THAT IS WITHIN ONE MILE (AERIAL RADIUS MEASUREMENT) OF A SPECIAL OR IMPAIRED WATER (SEE SECTION 2.0), STABILIZATION OF EXPOSED SOIL AREAS (INCLUDING STOCKPILES) WILL BE INITIATED IMMEDIATELY TO LIMIT SOIL EROSION WHENEVER ANY CONSTRUCTION ACTIVITY HAS PERMANENTLY OR TEMPORARILY CEASED ON ANY PORTION OF THE SITE AND WILL NOT RESUME FOR A PERIOD EXCEEDING 7 CALENDAR DAYS. c. THE FOLLOWING ACTIVITIES CAN BE TAKEN TO INITIATE STABILIZATION: PREPPING THE SOIL FOR VEGETATIVE OR NON -VEGETATIVE STABILIZATION, APPLYING MULCH OR OTHER NON -VEGETATIVE PRODUCT TO THE EXPOSED SOIL AREA, OR SEEDING OR PLANTING THE EXPOSED AREA. 5. ADDITIONAL EROSION PREVENTION MEASURES. THE FOLLOWING ADDITIONAL EROSION PREVENTION METHODS WILL BE IMPLEMENTED AT THE SITE DURING CONSTRUCTION: (CSW PERMIT ITEMS 8.2, 8.3, AND 8.10) a. SOIL DISTURBANCE WILL BE MINIMIZED WHEREVER POSSIBLE TO AID IN EROSION PREVENTION. b. EXISTING VEGETATKON WILL BE PRESERVED WHEREVER POSSIBLE TO LIMIT EXPOSED SOIL AND THUS WILL SERVE AS NATURAL VEGETATIVE BUFFERS. c EXPOSED SOIL ON STEEP SLOPES (s3H:1 V) WILL BE STABILIZED USING EROSION CONTROL BLANKETS AND SEEDING. d. HORIZONTAL SLOPE GRADING WILL BE UTILIZED TO MINIMIZE EROSION POTENTIAL. 9 TERRACING WILL BE USED TO MINIMIZED EROSION POTENTIAL. �� AaarWw+ BPRRENGiNEEPoNG fA. ,7/,320,8 4300 MAW(ETpOIMDE OPNE EPF INEMlffllWOD3. MN SSAtS AKH 4.2 SEDIMENT CONTROL PRACTICES: 1. DOWNGRADIENT PERIMETER CONTROLS. (CSW PERMIT ITEMS 9.2 THROUGH 96) a. SEDIMENT CONTROL PRACTICES WALL BE ESTABLISHED ON ALL DOWNGRADIENT PERIMETERS AND LOCATED UPGRADIENT OF ANY BUFFER ZONES. PERIMETER SEDIMENT CONTROLS WILL INCLUDE. SILT FENCE, SEDIMENT CONTROL LOGS/ SIOROLLS (FILLED WITH COMPOST, WOOD CHIPS, ROCK ETC.), VEGETATIVE BUFFERS (RETAIN EXISTING VEGETATION WHERE POSSIBLE), OR EQUIVALENT MEASURES. b. PERIMETER SEDIMENT CONTROL PRACTICES MUST BE INSTALLED BEFORE ANY UPGRADIENT LAND -DISTURBING ACTIVITIES BEGIN AND REMAIN IN PLACE UNTIL PERMANENT COVER HAS BEEN ESTABLISHED. It IF SEDIMENT CONTROL PRACTICES HAVE BEEN ADJUSTED OR REMOVED TO ACCOMMODATE SHORT-TERM ACTIVITIES (SUCH AS CLEARING, GRUBBING, OR PASSAGE OF VEHICLES), THE CONTROLS MUST BE RE -INSTALLED IMMEDIATELY AFTER THE SHORT-TERM ACTIVITY HAS BEEN COMPLETED. SEDIMENT CONTROL PRACTICES MUST BE RE -INSTALLED BEFORE THE NEXT PRECIPITATION EVENT, EVEN IF THE SHORT-TERM ACTIVITY IS NOT COMPLETE. d. IF THE DOWNGRADIENT SEDIMENT CONTROLS ARE OVERLOADED (BASED ON FREQUENT FAILURE OR EXCESSIVE MAINTENANCE REQUIREMENT), INSTALL ADDITIONAL UPGRADIENT SEDIMENT CONTROL PRACTICES OR REDUNDANT BAPS TO ELIMINATE THE OVERLOADING AND AMEND THE SWPPP TO IDENTIFY THESE ADDITIONAL PRACTICES. 2. SOIL STOCKPILE PERIMETER CONTROLS: TEMPORARY SOIL STOCKPILES WILL BE SURROUNDED BY: DOUBLE ROWS OF SILT FENCE, SEDIMENT CONTROL LOGS OR EQUIVALENT MEASURES, AND SHALL NOT BE PLACED IN ANY NATURAL BUFFERS OR SURFACE WATERS.(CSW PERMIT ITEMS 9.9 AND 9.10) 3. STORM DRAIN INLET PROTECTION: (CSW PERMIT ITEMS 9.7 AND 9.8) a. INLET PROTECTION BMPS WALL BE INSTALLED AROUND ALL STORM DRAIN INLETS DOWNGRADIENT OF CONSTRUCTION ACTIVITIES. b. STORM DRAIN INLETS WILL BE PROTECTED UNTIL ALL SOURCES WITH POTENTIAL FOR DISCHARGING TO THE INLET HAVE BEEN STABILIZED. c INLET PROTECTION BMPS WILL BE SEDIMENT CONTROL LOG, FILTER SACKS, OR EQUIVALENT MEASURES. 4. VEHICLE TRACKING BMPS: (CSW PERMIT ITEMS 9.11 AND 9.12) a. VEHICLE TRACKING BMPS WILL BE INSTALLED TO MINIMIZE THE TRACKING OUT OF SEDIMENT FROM THE CONSTRUCTION AREA AND WILL INCLUDE. ROCK PADS AND MUD MATS OR AN EQUIVALENT SYSTEM. b. IF SUCH VEHICLE TRACKING BMPS ARE NOT ADEQUATE TO PREVENT SEDIMENT FROM BEING TRACKED ONTO THE PAVED ROAD, STREET SWEEPING WALL ALSO BE EMPLOYED. SEDIMENT WILL BE REMOVED BY SWEEPING WITHIN 24 HOURS. S. PROTECTION OF INFILTRATION AREAS: IF NECESSARY, ADDITIONAL SEDIMENT CONTROLS (EG., DIVERSION BERMS) WALL BE INSTALLED TO KEEP RUNOFF AWAY FROM PLANNED INFILTRATION AREAS WHEN EXCAVATED PRIOR TO ESTABLISHING PERMANENT COVER WITHIN THE CONTRIBUTING DRAINAGE AREA. (CSW PERMIT ITEMS 16.4 AND 16.5) 6. MINIMIZATION OF SOIL COMPACTION AND PRESERVATION OF TOPSOIL. SOIL COMPACTION WILL BE MINIMIZED AND TOPSOIL WILL BE PRESERVED WHERE POSSIBLE. (CSW PERMIT ITEMS 5.24.9.14, AND 9.15) 7. PRIORITIZATION OF ONSITE INFILTRATION AND SEDIMENT REMOVAL: (CSW PERMIT ITEM 9.16) a. PRIOR TO OFFSITE DISCHARGE, INFILTRATION AND SEDIMENT REMOVAL WILL BE IMPLEMENTED ONSITE WHERE POSSIBLE. b. DISCHARGES FROM BMPS WILL BE DIRECTED TO VEGETATED AREAS OF THE SITE (INCLUDING ANY NATURAL BUFFERS) IN ORDER TO INCREASE SEDIMENT REMOVAL AND MAXIMIZE STORMWATER INFILTRATION. IF EROSION IS NOTED TO OCCUR AS THE RESULT OF SUCH A DISCHARGE, VELOCITY DISSIPATION BMPS WILL BE CONSIDERED AND INSTALLED AS NECESSARY TO PREVENT EROSION. S. BUFFER ZONE OR REDUNDANT SEDIMENT CONTROLS TO PROTECT SURFACE WATERS: (CSW PERMIT ITEM 9,17) a. A50 -FOOT NATURAL BUFFER WALL BE PRESERVED IN CONSTRUCTION AREAS DISCHARGING TOA NON-SPECIALMON-IMPAIRED SURFACE WATER OR WETLAND. IF A NONSPECMLMOWIMPAIRED SURFACE WATER OR WETLAND IS LOCATED WITHIN 50 FEET OF THE PROJECTS EARTH DISTURBANCES AND STORMWATER FLOWS TO THE SURFACE WATER, OR MEN BUFFER IS INFEASIBLE, REDUNDANT SEDIMENT CONTROLS WILL BE PROVIDED. b. A 10 001` NATURAL BUFFER WILL BE PRESERVED IN CONSTRUCTION AREAS DISCHARGING TO A SPECIAL OR IMPAIRED SURFACE WATER. IF A SPECIAL OR IMPAIRED SURFACE WATER IS LOCATED WITHIN 1D0 FEET OF THE PROJECTS EARTH DISTURBANCES AND STORMWATER FLOWS TO THE SURFACE WATER, OR MEN A BUFFER IS INFEASIBLE, REDUNDANT SEDIMENT CONTROLS WALL BE PROVIDED. e REDUNDANT PERIMETER CONTROLS WALL BE INSTALLED AT LEAST 5 FEET APART UNLESS LIMITED BY LACK OF AVAILABLE SPACE. 9. USE OF SEDIMENTATION TREATMENT CHEMICALS (E.G., POLYMERS, FLOCCULANTS, ETC.) IS NOT ANTICIPATED AS PART OF THE PROJECT. (CSW PERMIT ITEMS 5.22 AND 9.18) 10. THE PROJECT WILL NOT INCLUDE 10 OR MORE ACRES OF DISTURBED SOIL DRAINING TO A COMMON LOCATION OR 5 O MORE ACRES DRAINING TO A COMMONLOCATION WITHIN 1 MILE OR A SPECIAL OR IMPAIRED WATER THEREFORE TEMPORARY SEDIMENT BASINS ARE NOT REQUIRED. (CSW PERMIT ITEMS 5.6, 9. 13. AND 23.10 AND SECTION 14) 4.3 DEWATERING AND BASIN DRAINING: NO DEWATERING OR BASIN DRAINING WILL OCCUR AS PART OF THIS PROJECT. (CSW PERMIT SECTION 10 AND ITEM 10.5) 4.4 BMP DESIGN FACTORS: THE FOLLOWING BMP DESIGN FACTORS HAVE BEEN CONSIDERED IN DESIGNING THE TEMPORARY EROSION PREVENTION AND SEDIMENT CONTROL BMPS: 1. EXPECTED AMOUNT, FREQUENCY, INTENSITY, AND DURATION OF PRECIPITATION. 2. NATURE OF STORMWATER RUNOFF AND RUN-ON AT THE SITE, INCLUDING FACTORS SUCH AS EXPECTED FLOW FROM IMPERVIOUS SURFACES, SLOPES, AND SITE DRAINAGE FEATURES. 3. STORMWATER VOLUME, VELOCITY, AND PEAK FLOW RATES TO MINIMIZE DISCHARGE OF POLLUTANTS IN STORMWATER AND TO MINIMIZE CHANNEL AND STREAMBANK EROSION AND SCOUR IN THE IMMEDIATE VICINITY OF DISCHARGE POINTS. 4. RANGE OF SOIL PARTICLE SIZES EXPECTED TO BE PRESENT. (a PAGE 2 O 2) HCRRA MINNEAPOLIS, MN 90% DESIGN NOT FOR CONSTRUCTION LANDSLIDE REPAIRS CHANHASSEN, MN STORM WATER POLLUTION PREVENTION PLAN (SWPPP) 50 PERMANENT STORMASATER MANAGEMENT SYSTEM. A PERMANENT STORMWATER MANAGEMENT SYSTEM IS REQUIRED IF THE PROJECT RESULTS IN ONE ACRE OR MORE OF NEW IMPERVIOUS SURFACES OR RESULTS IN A NET INCREASE OF ONE OR MORE ACRES OF CUMMULATIVE NEW IMPERVIOUS SURFACES IN TOTAL OR IF THE PROJECT 15 PART OF A LARGER PLAN OF DEVELOPMENT. (CSW PERMIT ITEM 15.3) St A PERMANENT STORMWATER TREATMENT SYSTEM IS NOT REQUIRED. (CSW PERMIT ITEMS 5.15, 15.415.9, AND BTU) 5_2 THIS IS NOT A LINEAR PROJECT WITH LACK OF RIGHT OR WAY. (CSW PERMIT ITEM 15.9) 5_3 THIS PROJECT DOES NOT DISCHARGE TO A TROUT STREAM (OR A TRIBUTARY TO A TROUT STREAM). (CSW PERMIT ITEM23.12) 6.0 INSPECTION AND MAINTENANCE ATIVITIES. 6.1 PERSONS NTH REQUIRED TRAINING: TRAINED INDIVIDUALS INCLUDE THOSE PARTIES RESPONSIBLE FOR INSTALLING, SUPERVISING, REPAIRING, INSPECTING, AND MAINTAINING EROSION PREVENTION AND SEDIMENT CONTROL BMPS AT THE SITE. TRAINED INDIVIDUALS ARE ALSO RESPONSIBLE FOR IMPLEMENTATION OF THE SWPPP AND COMPLIANCE WITH THE GENERAL PERMIT UNTIL THE CONSTRUCTION ACTIVITIES ARE COMPLETE, PERMANENT COVER HAS BEEN ESTABLISHED, AND A NOTICE OF TERMINATION (NOT) HAS BEEN SUBMITTED. (CSW PERMIT ITEMS 5.20.5.21, AND 11.9 AND SECTION 21) THESE INDIVIDUALS WILL BE TRAINED IN ACCORDANCE WITH THE REQUIREMENTS OF THE GENERAL PERMIT. INCLUDING THE REQUIREMENT THAT THE CONTENT AND EXTENT OF TRAINING WILL BE COMMENSURATE WITH THE INDIVIDUAL'S JOB DUTIES AND RESPONSIBILITIES. BELOW IS A LIST OF PEOPLE RESPONSIBLE FOR THIS PROJECT WHO ARE KNOWLEDGEABLE AND EXPERIENCED IN THE APPLICATION OF EROSION PREVENTION AND SEDIMENT CONTROL BMPS. TRAINED INDIVIDUAL RESPONSIBILITY TRAINING ENTITY' TRAINING DATE ERIC FI ZGERALD PREPARATION OF THE SWPPP UNIVERSITY OF MINNESOTA SEPTEMBER 2017 TBD OVERSIGHT OF SAPPP IMPLEMENTA- TBD TBD TION, REVISION, AND AMIAENDMENT TBD PERFORMANCE OF SWPPP INSPECTIONS TBD TBD TBD PERFORMANCE OR SUPERVISION OF TBD TBD INSTALLATION, MAINTENANCE, AND REPAIR OF BMPS 'TRAINING DOCUMENTATION AVAILABLE UPON REQUEST 82 FREQUENCY OF INSPECTIONS: ATRAINED PERSON WILL ROUTINELY INSPECT THE ENTIRE CONSTRUCTION SITE. (CSW PERMIT ITEMS 11.2, 11.10, AND 23.13) • AT LEAST ONCE EVERY 7 DAYS DURING ACTIVE CONSTRUCTION • WITHIN 24 HOURS AFTER A RAINFALL EVENT GREATER THAN 0.5 INCHES IN 24 HOURS INSPECTION FREQUENCY MAY BE ADJUSTED UNDER THE FOLLOWING CIRCUMSTANCES' • WHERE PARTS OF THE CONSTRUCTION AREAS HAVE PERMANENT COVER, BUT WORK REMAINS ON OTHER PARTS OF THE SITE, INSPECTIONS OF THE AREAS WITH PERMANENT COVER MAY BE REDUCED TO ONCE PER MONTH. • WHERE CONSTRUCTION AREAS HAVE PERMANENT COVER AND NO CONSTRUCTION ACTIVITY IS OCCURRING ON THE SITE, INSPECTIONS CAN BE REDUCED TO ONCE PER MONTH AND, AFTER 12 MONTHS, MAY BE SUSPENDED COMPLETELY UNTIL CONSTRUCTION ACTIVITY RESUMES. • WHERE CONSTRUCTION ACTIVITY HAS BEEN SUSPENDED DUE TO FROZEN GROUND CONDITIONS, THE INSPECTIONS MAY BE SUSPENDED. THE REQUIRED INSPECTIONS AND MAINTENANCE SCHEDULE MUST BEGIN WITHIN 24 HOURS AFTER RUNOFF OCCURS AT THE SITE OR UPON RESUMING CONSTRUCTION, WHICHEVER COMES FIRST. 6.3 INSPECTION REQUIREMENTS: EACH CONSTRUCTION STORMWATER SITE INSPECTION WILL INCLUDE INSPECTION OF THE FOLLOWING AREAS: (CSW PERMIT ITEMS 11.3 THROUGH 11.8) • ALL EROSION PREVENTION AND SEDIMENT CONTROL BMPS AND POLLUTION PREVENTION MANAGEMENT MEASURES • SURFACE WATERS FOR EVIDENCE OF EROSION AND SEDIMENT DEPOSITION • CONSTRUCTION SITE VEHICLE EXIT LOCATIONS FOR EVIDENCE OF OFFSITE SEDIMENT TRACKING • STREETS AND OTHER AREAS ADJACENT TO THE PROJECT FOR EVIDENCE OF OFF SITE ACCUMULATIONS OF SEDIMENT 0.4 MAINTENANCE REQUIREMENTS' MAINTENANCE OF THE FOLLOWING AREAS AND BMPS WILL BE PERFORMED AS FOLLOWS: (CSW PERMIT ITEMS 11.3 THROUGH 11.8) • NONFUNCTIONAL BMPS WALL BE REPAIRED, REPLACED, OR SUPPLEMENTED WITH FUNCTIONAL BMPS BY THE END OF THE NEXT BUSINESS DAY AFTER DISCOVERY OR AS SOON AS FIELD CONDITIONS ALLOW ACCESS. • PERIMETER CONTROL DEVICES WALL BE REPAIRED, REPLACED, OR SUPPLEMENTED WHEN THEY BECOME NONFUNCTIONAL OR THE SEDIMENT REACHES 12 OF THE HEIGHT OF THE DEVICE. • TEMPORARY AND PERMANENT SEDIMENTATION BASINS WILL BE DRAINED AND THE SEDIMENT REMOVED WHEN THE DEPTH OF SEDIMENT COLLECTED IN THE BASIN REACHES 12 THE STORAGE VOLUME. • DELTAS AND SEDIMENT DEPOSITED IN SURFACE WATERS WILL BE REMOVED, AND THE AREAS WHERE SEDIMENT REMOVAL RESULTS IN EXPOSED SOIL WILL BE RE -STABILIZED. THE REMOVAL AND STABILIZATION WALL BE COMPLETED WITHIN 7 CALENDAR DAYS OF DISCOVERY UNLESS PRECLUDED BY LEGAL, REGULATORY, OR PHYSICAL ACCESS CONSTRAINTS. IF PRECLUDED DUE TO ACCESS CONSTRAINTS, REASONABLE EFFORTS TO OBTAIN ACCESS WALL BE USED. REMOVAL AND STABILIZATION WILL TAKE PLACE WITHIN 7 CALENDAR DAYS OF OBTAINING ACCESS. • TRACKED SEDIMENT ON PAVED SURFACES WILL BE REMOVED WITHIN 1 CALENDAR DAY OF DISCOVERY. • AREAS UNDERGOING STABILIZATION WILL BE RESTABILIZED AS NECESSARY TO ACHIEVE REQUIRED COVER. 6.5 RECOROKEEPING REQUIREMENTS: (CSW PERMIT ITEMS 11.11 AND 24.5 AND SECTIONS 6 AND 20) 1. ALL INSPECTIONS AND MAINTENANCE ACTIVITIES WILL BE RECORDED IN WRITING WITHIN 24 HOURS OF BEING CONDUCTED AND THESE RECORDS WILL BE RETAINED WITH THE SWPPP. RECORDS OF EACH INSPECTION AND MAINTENANCE ACTIVITY WILL INCLUDE THE DATE AND TIME, NAME OF INSPECTOR(S); FINDINGS OF INSPECTIONS; CORRECTIVE ACTIONS (INCLUDING DATES, TIMES, AND PARTY COMPLETING MAINTENANCE ACTIVITIES); AND DATE OF ALL RAINFALL EVENTS GREATER THAN 0.5 INCHES IN 24 HOURS AND THE AMOUNT OF RAINFALL FOR EACH EVENT. a. IF ANY DISCHARGE IS OBSERVED DURING THE INSPECTION, THE LOCATION AND APPEARANCE OF THE DISCHARGE (I.E., COLOR, ODOR, SETTLED OR SUSPENDED SOLIDS, OIL SHEEN, AND OTHER OBVIOUS INDICATORS OF POLLUTANTS) WILL BE DOCUMENTED AND A PHOTOGRAPH WALL BE TAKEN. 2. THE SWPPP WILL BE AMENDED TO INCLUDE ADDITIONAL OR MODIFIED BMPS TO CORRECT PROBLEMS OR ADDRESS SITUATIONS WHENEVER THERE IS A CHANGE IN DESIGN, CONSTRUCTION, OPERATION, MAINTENANCE, WEATHER, OR SEASONAL CONDITIONS THAT HAS A SIGNIFICANT EFFECT ON THE DISCHARGE OF POLLUTANTS TO SURFACE WATERS OR GROUNDWATER. a. THE SWPPP WILL BE AMENDED AMEN INSPECTIONS OR INVESTIGATIONS BY THE SITE OWNER, OPERATOR, OR CONTRACTORS OR BY USEPA/MPCA OFFICIALS INDICATE THAT THE SWPPP IS NOT EFFECTIVE IN ELIMINATING OR MINIMIZING THE DISCHARGE OF POLLUTANTS TO SURFACE WATERS OR GROUNDWATER; THE DISCHARGES ARE CAUSING WATER QUALITY STANDARD EXCEEDANCES; OR THE SWPPP IS NOT CONSISTENT WITH A USEPA APPROVED TMDL. E. ANY AMENDMENTS TO THE SWPPP PROPOSED AS A RESULT OF THE INSPECTION WILL BE DOCUMENTED AS REQUIRED WITHIN 7 CALENDAR DAYS. c. AMENDMENTS WILL BE COMPLETED BY AN APPROPRIATELY TRAINED INDIVIDUAL. CHANGES INVOLVING THE USE OF A LESS STRINGENT BMP WALL INCLUDE A JUSTIFICATION DESCRIBING HOW THE REPLACEMENT BMP IS EFFECTIVE FOR THE SITE CHARACTERISTICS, 3, RECORDS RETENTION: THE SAPPED, INCLUDING ALL CHANGES TO IT, AND INSPECTION AND MAINTENANCE RECORDS WILL BE KEPT AT THE SITE DURING CONSTRUCTION BY THE PERMITTEE WHO HAS OPERATIONAL CONTROL OF THE SITE. THE SWPPP CAN BE KEPT IN EITHER A FIELD OFFICE OR IN AN ON SITE VEHICLE DURING NORMAL WORKING HOURS. 4, RECORD AVAILABILITY. THE PERMITTEES WILL MAKE THE SWPPP, INCLUDING INSPECTION REPORTS, MAINTENANCE RECORDS, AND TRAINING RECORDS. AVAILABLE TO FEDERAL, STATE, AND LOCAL OFFICIALS WITHIN THREE DAYS UPON REQUEST FOR THE DURATION OF THE PERMIT COVERAGE AND FOR THREE YEARS FOLLOWING THE NOTICE OF TERMINATION. 7.0 POLLUTION PREVENTION MEASURES. 1. ANY CONSTRUCTION PRODUCTS AND LANDSCAPE MATERIALS THAT HAVE THE POTENTIAL TO LEACH POLLUTANTS WILL BE STORED UNDER COVER (E.G., PLASTIC SHEETING OR TEMPORARY ROOFS) TO PREVENT DISCHARGE OF POLLUTANTS THROUGH MINIMIZATION OF CONTACT NTH STORMWATER. STORAGE OF SUCH MATERIALS WITHIN THE PROJECT AREA WILL BE MINIMIZED TO THE EXTENT POSSIBLE. (CSW PERMIT ITEM 12 2) 2. PESTICIDES, FERTILIZERS, AND TREATMENT CHEMICALS WILL BE STORED UNDER COVER (E.G., PLASTIC SHEETING, TEMPORARY ROOFS, WITHIN A BUILDING, OR IN WEATHER-PROOF CONTAINERS) TO PREVENT DISCHARGE OF POLLUTANTS THROUGH MINIMIZATION OF CONTACT WITH STORMWATER. STORAGE OF SUCH MATERIALS WITHIN THE PROJECT AREA WILL BE MINIMIZED TO THE EXTENT POSSIBLE. CSW PERMIT ITEM 12.3 3. HAZARDOUS MATERIALS AND TOXIC WASTE (EG., OIL, DIESEL FUEL, GASOLINE, HYDRAULIC FLUIDS PAINT SOLVENTS, BE STORED AND DI PRODUCTS, WOOD PRESERVATIVES ADDITIVES, CURING COMPOUNDS, AND ACIDS) WILL BE STORED AND DISPOSED OF IN COMPLIANCE WITH MINNESOTA RULES CHAPTER ]WS INCLUDING SECONDARY CONTAINMENT (AS APPLICABLE). HAZARDOUS MATERIALSWILL BE PROPERLY STORED IN SEALED PR CONTAINERS PREVENT SPILLS, LEAKS, OR OTHER DISCHARGES AND PREVENT PRECIPITATION FROM FALLING ONTO THE CONTAINERS AINERS OR STORED STORED, AND MATERIALS. (CSW PERMIT TENTSPLI AND 1 IT 4, SOLID WASTE WILL BE COLLECTED, STORED, AND DISPOSED OF PROPERLY' IN COMPLIANCE WITH MINNESOTA RULES CHAPTER 7035. THIS INCLUDES STORAGE WITHIN COVERED TRASH CONTAINERS AND DAILY REMOVAL OF LITER AND DEBRIS STORAGE OF SOLID WASTE WITHIN THE PROJECT AREA WILL BE MINIMIZED TO THE EXTENT POSSIBLE. (CSW PERMIT REM 125) 5. PORTAGROUND SO THEY WILL N E LOCATEDAWAYOR 1 FROM 4OCKED OVER SANITARY AND WASTE WILL ED AND DISPOSED OF I TO THE GROUND N THEYWILLNOT TTIPPED,C CHAPTER 70OVER.SANITARYWASTEVWLL BEDISPOSEDOFMI ACCORDANCE WITH MINNESOTA RULES, CHAPTER HAUL PORTABLE TOILETS WILL BE PERIODICALLY EMPTIED AND THE WASTE HAULED OFFSITE BY A LICENSED HAULER. (CSW PERMIT TEM 12.8) 8. VEHICLE FUELING WILL ONLY OCCUR IN DESIGNATED AREAS. SPILL KITS SHED APPROPRIATELY FOR THE AMOUNT OF REFUELING TAKING PLACE WILL BE LOCATED. SPILL KITS WALL BE CLEARLYY LABELED D AND CONTAIN MATERIALS TO ASSIST IN SPILL CLEANUP INCLUDING ABSORBENT PADS, BOOMS FOR CONTAINING SPILLS, AND HEAVY-DUTY PROTECTIVE GLOVES. SPILLS WILL BE REPORTED TO THE MINNESOTA DUTY OFFICER AS REQUIRED BV MINNESOTA STATUTES, SECTION 115.061. (CSW PERMT ITEMS 2.3 AND 12]) a. ANY FUEL TANKS BROUGHT ON-SITE WILL HAVE PROPERLY SIZED CONTAINMENT AND WILL NOT BE TOPPED OFF TO AVOID SPILLS FROM OVERFILLING. FUEL TANKS WALL MEET INDUSTRY STANDARDS (DESIGNED TO HOLD FUEL TYPE, PROPERLY MAINTAINED, NOT ILLEGALLY MODIFIED, NOT MISSING LEAK INDICATOR FLOATS FOR DOUBLE WALLED TANKS, SIGHT GAUGES NOT USED, ETC.) OR BE REMOVED FROM THE WORK AREA. 6. GUIDELINES FOR SPILL PREVENTION AND RESPONSE INCLUDE TAKE REASONABLE STEPS TO PREVENT THE DISCHARGE OF SPILLED OR LEAKED CHEMICALS, INCLUDING FUEL, FROM ANY AREA WHERE CHEMICALS OR FUEL WILL BE LOADED OR UNLOADED, INCLUDING THE USE OF DRIP PANS OR ABSORBENTS UNLESS INFEASIBLE; PERFORM REGULAR PREVENTATIVE MAINTENANCE ON TANKS AND FUEL LINES; INSPECT PUMPS, CYLINDERS, HOSES, VALVES, AND OTHER MECHANICAL EQUIPMENT ONSITE FOR DAMAGE OR DETERIORATION; DO NOT WASH OR RINSE FUELING AREAS WITH WATER; MAINTAIN ADEQUATE SUPPLIES TO CLEAN UP DISCHARGED MATERIALS AND PROVIDE AN APPROPRIATE DISPOSAL METHOD FOR RECOVERED SPILLED MATERIALS; REPORT AND CLEAN UP SPILLS IMMEDIATELY AS REQUIRED BY MINNESOTA STATUTES, SECTION 115.061, USING DRY CLEAN UP MEASURES WHERE POSSIBLE; AND MAINTAIN COPIES OF SAFETY DATA SHEETS (SDSS) FOR HAZARDOUS MATERIALS ONSITE IN LOCATIONS READILY AVAILABLE TO EMERGENCY RESPONDERS 7, IF VEHICLE AND EQUIPMENT WASHING IS NECESSARY. A VEHICLE WASH STATION WILL BE LOCATED IN A DESIGNATED AREA RUNOFF FROM THE WASHING AREA WILL BE CONTAINED IN A SEDIMENT BASIN AND WASTE FROM THE WASHING ACTIVITY WILL BE PROPERLY DISPOSED OF. ANY SOAPS, DETERGENTS, OR SOLVENTS WILL BE PROPERLY USED AND STORED. ANY DETERGENTS AND OTHER CLEANERS NOT PERMITTED FOR DISCHARGE WILL NOT BE USED. (CSW PERMIT ITEMS 2.3 AND 12.8) 8, THE PROJECT WILL NOT RESULT IN CONCRETE OR OTHER WASHOUT ACTIVITIES. IF NECESSARY, A DESCRIPTION OF THE STORAGE AND DISPOSAL OF CONCRETE AND OTHER WASHOUT WASTES SO THAT WASTES DO NOT CONTACT THE GROUND WALL BE ADDED. (CSW PERMIT ITEMS 2.3 AND 12.9) 1. THE AREAS DISTURBED DURING CONSTRUCTION WILL BE STABILIZED WITH PERMANENT COVER UPON COMPLETION OF WORK. PERMANENT COVER MAY BE VEGETATIVE OR NON -VEGETATIVE, AS APPROPRIATE. ESTABLISHMENT OF PERMANENT COVER MAY INCLUDE THE FOLLOWING ACTIVITIES: SEEDING, MULCHING. AND EROSION CONTROL BLANKETS (CSW PERMIT ITEM 517) 2. FOR A CONSTRUCTIO"ITE TO ACHIEVE 'PERMANENT COVER'. THE FOLLOWING REQUIREMENTS MUST BE COMPLETED PRIOR TO TERMINATION OF PERMIT COVERAGE (CSW PERMIT SECTIONS 4 AND 13) a. ALL SOIL DISTURBING CONSTRUCTION ACTIVITIES HAVE BEEN COMPLETED AND PERMANENT COVER HAS BEEN INSTALLED OVER ALL AREAS. VEGETATIVE COVER CONSISTS OF A UNIFORM PERENNIAL VEGETATION WITH A DENSITY OF 7M OF RS EXPECTED FINAL GROWTH. VEGETATION IS NOT REQUIRED MERE THE FUNCTION OF A SPECIFIC AREA DICTATES NO VEGETATION (SUCH AS IMPERVIOUS SURFACES OR THE BASE OF A SAND FILTER). 0. ALL SEDIMENT HAS BEEN REMOVED FROM CONVEYANCE SYSTEMS, INCLUDING CULVERTS. C. ALL TEMPORARY SYNTHETIC EROSION PREVENTION AND SEDIMENT CONTROL BMPS HAVE BEEN REMOVED. BMPS DESIGNED TO DECOMPOSE ONSITE MAY BE LEFT IN PLACE. WITHIN 30 DAYS AFTER THE TERMINATION CONDITIONS ARE COMPLETE, A NOTICE OF TERMINATION (NOT) FORM WILL BE SUBMITTED TO THE MPCA. "� IILf v Be Rn at to fi vC. R° I• RC RDRex IO] Ri Be C YE L IF Rn KD RM °• Ka aC3ton We Lac SF °c W. IDx W W .L.16 F. w m w m n uu •c M Rn Rea Rc Rc uLa Lm Rez alXr w Rce Ye ER u.a L>w '.Rn m� pe . Rc RF a KM Laox LTJ<3! Lel Lxxn un uxe Rm` Hca Ra R°' Lm uxE Wyt La,, .R(a �. w Ko Be Re °p ac Lmx Lain un uu e, RB T :o w n Ka LY( Rei L«a Lav, "•' A n 'm u n - rR UP 4a°a Lxfa Lxxa w R! o , w Lau L.oe Ln•F:. ute _.O RVI LMa RF A RCT LIT D` L. L.aa, .RDS III, Kn Ka3 - m�. 1 . uN' use Rc LFa LSE uTa w m nL�. N°' o LnoF un • Rn n./K. l4a LMa •ex a Kc R° � Ro Lsw tjj um uxF Rc WRn .KP- i Re Lnr L>vE 1 .... K Im a V /'- K. W uv I Rn R9 KCx Kn w W Lr u w ua PROJECT f j ocAnoN w Q sawn SAFC-0MY pa•r�mar xwxmaw.r.a•EaNunox. on RwRTw••� �•Yr m x nye. Qc,•,mY•�.ewY O F,gureI - Fw• w.Nr s..•mo.r wn•aana.M ®Pw. w'H. ar-•^a'v •w"• 0 TOPOGRAPHIC MAP NTH 10.000 20,000 LANDSLIDE REPAIRS W SURFACE WATERS AND SOIL TYPES af•WCINFEET Stl.waLB PoIIWon Prevar ion Plan BID - - - - - - - Carver Count, Minnesota t GCPHEljkrgH ONE 4LIMIL GOPHER STATE ONE CALL: CALL BEFORE YOU DIG. 1-800-252-IIW 90% DESIGN NOT FOR CONSTRUCTION pa•r�mar xwxmaw.r.a•EaNunox. on RwRTw••� �•Yr m x nye. cuENx a txan tww--- PwR•arm. AS srgvM LANDSLIDE REPAIRS �'•••�•�••.,•""",. BID - - - - - - - Z31()ID74'G4 IwcrcuRxNuunLwWREn,R�¢nYuws�nE coxsnxucnw - - - - - D A Dls BARR ENGINEERING CO. awo MARlcEmoINTE IxavE 1L132018 HCRRA CHANHASSEN, MN CLIENT PROJECT No. ,.•h aF.••E.w*. _ _ _ _ _ _ DI"�[CR $0^0 Z00 EPF EwxWEaN.ra - - - - MIMIEAPous, MN suss AKN MINNEAPOLIS, MN STORM WATER POLLUTION PREVENTION PLAN •wvx E. RELEASED A B C D D 1 2 Pr WaromzSn F„w„, aw+• BARR (SWPPP) DV.c REvDu NO BY OHK APP. GATE REVISION DESCRIPTION u� TOrFOR DATE RELEASED mmmz.xzn m°''1,W'380W NCH C -O6 3wdra:2=— o �- �. — —• 1 SOUTH AREA CIRV£RTOUtLET ANOSTA13 THEREPNR, 1 �6EE SHEET U] ` 1 PROPERTY LINE jTYP) ------------ s6. � �y L10 C -1C C--' ---1 1 NORTH SLOPE REPNRAREA,J SEE SHEET C-17 NEW FENCE, SEE//��� QS'i�_______I tl 1� T 'E ,STING. ;� y� O3 _—• DST – _—.— ��— EXISTNG NORTH PIPE) q\ \IS w – \—Ta— STA NEW IXUINAGE GIWREL WITH TRU SEE SHEET CHO _ NE...... SEWER SEE SHEET C-1 B 0 V4 ------ i v2.3 STS �i CON.TROCTION IIMIT. PLM o so F1W N Q 1.� 1 . � sWE W FEET ______–EWSTNGGRgj \ iwvc —\ 1W0 NCO 3-W 4HX w Pte. 5��&as�nrt tt wEw+rE urs 6>w< rreNreo•we 0A¢ REV, SION DESCRIPTION urea. p TRNLGP E CONSERVATION EASEMENT SSW SHS TMO SH)0 BWO 1000 11.00 tNW 1wW PRO ILE: TRAIL MOD, ICATIONS o w 1W 0 5 10 , L JL,_L1a1_ 110RIZ.V LE IN FEET NERT.SGIE IN FEET ¢ PISS LANDSLIDE REPAIRS —_—�°° A SARR ENGINEERING CO p sp y3CO-ETPO1NiE HCRRA CHANHASSEN, MN 1L3=9 EYF — — DRIVE "^� TRAIL MODIFICATIONS PLAN AND PROFILE --R Mi MNNEAPOUS. MN 5SS3s - m MINNEAPOLIS, MN REIEASEp A B C D 0 2 015 14,00 15.00 15-32 90% DESIGN NOT FOR CONSTRL C=07 FG OFFSET 2Wp ■■■N__■■■■ eb G ea iN1 Y1D1B e10 eto \ 0b oto \ eb---------- swro zaD '90 X40 a -b -10 0 t0 b b b 5� me' ■■■N__■■■■ �' Ae 8HDVM BMRENGINEENNGCO. iN1 Y1D1B 1001(EfPoINIE ORNE Fff swro zaD , �INiFMOf15,0M 55135 e(IP1 ■■■■■■���■■■■■■■■■■■, °i"4 eu:R vale me I I ., "Mom emz lm'. \ . M 0 ONEEE!J.'w ■■■■■NME■ M M 0 No 0, ■■■ ...i ■_6■_N■■■I■■■■■■■■■■ eb .. ■■®NOON■■11■■■■■ ■■■E■■■■ME =EM \ 01D, " ■■■■■■■■ 810 I11 ■■■■■■■■■■■■■■■.. am — elpm0 ■■■■■■■■w■m■O■■■NONE MES ■■■■■■■■■■■■■■■ ]BII� -10 me' ■■■■m■NE■■■■■■ FW OB.e. �' Ae 8HDVM BMRENGINEENNGCO. iN1 Y1D1B 1001(EfPoINIE ORNE Fff swro zaD �INiFMOf15,0M 55135 e(IP1 ■■■■■■���■■■■■■■■■■■, °i"4 eu:R vale me I I "Mom emz lm'. \ . M 0 ONEEE!J.'w M M 0 No 0, ■■■ NOR, ■_6■_N■■■I■■■■■■■■■■ eb ■■®NOON■■11■■■■■ ... =EM \ 01D, " ■■■■■■■■ 810 I11 ■■■■■■■■■■■■■■■.. am — elpm0 ■■■■■■■■w■m■O■■■NONE MES ■■■■■■■■■■■■■■■ me' ■■■■m■NE■■■■■■ FW OB.e. �' Ae 8HDVM BMRENGINEENNGCO. iN1 Y1D1B 1001(EfPoINIE ORNE Fff swro zaD �INiFMOf15,0M 55135 e(IP1 ■■■■■■���■■■■■■■■■■■, °i"4 eu:R vale me OMEN ■■■■mumNE■■■■■■■■■■' "Mom emz ommommosms \ . M 0 ONEEE!J.'w 810 / ■■■ NOR, ■_6■_N■■■I■■■■■■■■■■ me' FGOFFSET N60 FG OFFSET SWM ■■■■m■NE■■■■■■ FW OB.e. �' Ae 8HDVM BMRENGINEENNGCO. iN1 Y1D1B 1001(EfPoINIE ORNE Fff swro zaD �INiFMOf15,0M 55135 e(IP1 ■■■■■■���■■■■■■■■■■■, °i"4 eu:R vale me ■■■■mumNE■■■■■■■■■■' "Mom emz I% \ . ■■■!�■m■n■■■■■,, 810 / ■■■ ■_6■_N■■■I■■■■■■■■■■ eb ■■®NOON■■11■■■■■ ... \ 01D, ■■■■■■■■ 810 ■■■i�■�■OE ■■■■■■■■■■■■■■■.. am — elpm0 ■■■■■■■■w■m■O■■■NONE mo■\■■N■■■■■E■■EI ■■■■■■■■■■■■■■■ ]BII� -10 .10 -]0 -10 D 10 111 b b 60 FGOFFSET N60 FG OFFSET SWM wTe sFF co cD FOR Ht�ROET'NBs oN raal sEC110H5, mauMlNc 1% moss uoRE oNmuL suaFncE. nxrmnvua a aEx* �ntwsrxa,e rs swm u w ao PiER„t1G.,.IR 11.,. IMwA. aru�D T11E KlNfemA. IID er Hrc F z -_ = SCRIPTION REVISION DE - - umE, roFaR ■■■■m■NE■■■■■■ FW OB.e. �' Ae 8HDVM BMRENGINEENNGCO. iN1 Y1D1B 1001(EfPoINIE ORNE Fff swro zaD �INiFMOf15,0M 55135 e(IP1 ■■■■■■���■■■■■■■■■■■, °i"4 eu:R vale me ■■■■mumNE■■■■■■■■■■' "Mom emz . ■■■!�■m■n■■■■■,, ■■■ ■_6■_N■■■I■■■■■■■■■■ ■■®NOON■■11■■■■■ ... ., ■■■■■■■■ ■■■i�■�■OE ■■■■■■■■■■■■■■■.. ■■■■■■■■w■m■O■■■NONE mo■\■■N■■■■■E■■EI ■■■■■■■■■■■■■■■ ■■■■■■■■■■uE■EnE■■EN, OEM ■■■■■■■■NN■■■■■ ■■■■■■■■■■■■w5M wTe sFF co cD FOR Ht�ROET'NBs oN raal sEC110H5, mauMlNc 1% moss uoRE oNmuL suaFncE. nxrmnvua a aEx* �ntwsrxa,e rs swm u w ao PiER„t1G.,.IR 11.,. IMwA. aru�D T11E KlNfemA. IID er Hrc F z -_ = SCRIPTION REVISION DE - - umE, roFaR FG OFFSET 8100 ■■■■m■NE■■■■■■ FW OB.e. �' Ae 8HDVM BMRENGINEENNGCO. iN1 Y1D1B 1001(EfPoINIE ORNE Fff swro zaD �INiFMOf15,0M 55135 e(IP1 ■■■■■■���■■■■■■■■■■■, °i"4 eu:R vale me ■■■■mumNE■■■■■■■■■■' emz ■■■ ■_6■_N■■■I■■■■■■■■■■ ... ., ■■■■■■■■ ■■■i�■�■OE ■■■■■■■■w■m■O■■■NONE mo■\■■N■■■■■E■■EI ■■■■■■■■■■uE■EnE■■EN, OEM ■■■■■■■■■■■■w5M M■EN, ■■■■■■■■■■■■■■■■■■■■I,, E■■■■■■■■■■■■■\■SEE■ ■■■■■■■■■■■■■■■■OffE FG OFFSET 8100 FW OB.e. �' Ae 8HDVM BMRENGINEENNGCO. iN1 Y1D1B 1001(EfPoINIE ORNE Fff swro zaD �INiFMOf15,0M 55135 e(IP1 ■■■■■■���■■■■■■■■■■■, °i"4 eu:R vale me ■■■■mumNE■■■■■■■■■■' emz FG OFFSET 8100 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN TRAIL MODIFICATIONS CROSS SECTIONS 90% DESIGN PROJECT No. - b REV Na C-08 D ■■■■■■���■■■■■■■■■■■, ■■■■mumNE■■■■■■■■■■' ■■■ ■_6■_N■■■I■■■■■■■■■■ ... ., ■■■■■■■■ ■■■i�■�■OE ■■■■■■■■w■m■O■■■NONE mo■\■■N■■■■■E■■EI ■■■■■■■■■■uE■EnE■■EN, OEM ■■■■■■■■■■■■w5M M■EN, ■■■■■■■■■■■■■■■■■■■■I,, E■■■■■■■■■■■■■\■SEE■ ■■■■■■■■■■■■■■■■OffE , ■■E■■■■■■OEM■■■■■■ , N■■■■■■■■\•w■■■■ NONE �, ■■■■■■■■■■■'`mM■■■■■' . ■E■E■■■■■■■■■■■■►■EN, HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN TRAIL MODIFICATIONS CROSS SECTIONS 90% DESIGN PROJECT No. - b REV Na C-08 D ■■■■■■���■■■■■■■■■■■, ■■■ ■_6■_N■■■I■■■■■■■■■■ ., ■■■■■■■■ ■■■i�■�■OE ■■■■■■■■w■m■O■■■NONE ■■■■■■■■■■uE■EnE■■EN, ■■■■■■■■■■■■w5M M■EN, E■■■■■■■■■■■■■\■SEE■ ■■■■■■■■■■■■■■■■OffE , ■■E■■■■■■OEM■■■■■■ , HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN TRAIL MODIFICATIONS CROSS SECTIONS 90% DESIGN PROJECT No. - b REV Na C-08 D FG OFFSET 7Mj0 F60FFSET NE X00 850 INNER 'MM immummo Em loommanommommommomm Bb No Emmommom amm MENNEN L 00 MORONI 'INS !0 MEMEMEM mocommom 1 EMEEME 0 EMEMMMENE MORE B10 ERROR= Immomml mom MEN OEM MORE 0 MOOR FG OFFSET 11W0 Mom NO FG OFFSET S�Op FG OFFSET 00 0 MEMO MUMNEEM Min K4 I E%is mommmummu MEMO MENEM ommLom MEMO= EMENEEMMEM FG OFFSET ON milm FG OFFSET NONNI 8 50 FG OFFSET 10P00 0 MEMMEMEM mil FG OFFSET e 17 00 EMEMMOM MEN 0 No SON -00 mil OMEN MEN Poo MEN ME No 00 MEN'' R5 9 MEN 5� •Tigr � L+0 G10 F°R FIMIER CETAILS z3 oNTPNLSEC310NB.Ri0.lIpNCMQA55 90% DESIGN o SLCPE CN TRNLSURFACE. NOT FORCONSTRUC710N f ��aer ¢nm rrwl megwx. seEgKwnax.w .P,..wnP� uamn w.n aar uce•+seo E:IurEFnvaFn TE u✓Bo1� uiEH* 51p covsmucnox r an u[s. rnvr — — — — — — B A M �'�'m "a°"""' BVRRENtuNEERM Co. 4b0 E,POINre DRIVE an +eooesan `...sir smr Ass"or* HCRRAMINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN. MN BARR PRWECT No. 23101014.04 R °'" 1W13=9 u.M, EPF TDENTP WO CT��RW TRAIL MODIFICATIONS CROSS SECTIONSC-09 A B C D 0 1 2 P"P'° BARR. P.W Br HKAPP. DATE REVISION DESCRIPTION TO/FOR OATEREIFABED an raooa'aazn m�ii�' MTp3 �� 1 EAsmw NORTH SIDE 5'MN. SHONLDE / WTRNL SMN.SHGILDER rk 20% 30% ICUMD 4% __—_ T C TOPSOIL AND SEED(1YP) T.. M' MINUS AGGREGATE SURFACING I C A SPECU PREPARE TOP IZ OF SUBGiKC£IN gCGMDONCEf (SEE TABLE I FGR GRAWTMIB MITI MMMT STANDARD 2112 S' TMCI( MnDOT CUSS 5AGGREGATE SASE, 1&096 CRUSHED NOTES TESTROLLSUBGMOEPMCRTOAGGREGATE TYPE5GEOTE MFABRIC ME INSTALLATON IN CCNFGRIAANCE PATI (ATENGINEER5DSCRETION) MMOT STA1 W RD SPEGEICATON 2111. 1 SECTION: TRAIL MODIFICATION (TYPICAL)- STA 5+00 TO 7+75 .wrrosrsLr NORT vm 5. MIN 19TWL VARIES-5'MIN .SM 5' 2. I 5' i Ox — EAsnNc cRaw V TOPSGL AAD SEED(TYP) c euvn��m. n A«uD:w M•uA�° ° rna'rzsiwww�creen TnEu+cor.� MU DN - CLPBS SPECIAL PREPARE PREPARE TOP IZ OF SMSGRADE IN ACCORGANLE (SEE TABLE I FOR GR TON) WTH MnWT STANDARD 2112 BARR P2310101. zOtolola.oa NOTES: e'TMCK MRDOT CLASS 5 AGGREGATE SASE. 100% CRUSHED ]EST ROLL SUBG4OE PRIOR TOAGCAEGATE CLIENT PROJECT W. BASE INSTAL nCN IN COWORMANCE N9T1 TYPE 5 GEOTEXTLE FABRIC MMOT STANDARD SPECIFICATION 2111. (AT ENGINEERS DSLREDON) %21 SECTION: TRAIL MODIFICATION (TYPICAL) - STA 1+75 TO 5+00 AND STA. 7+75 TO 12+00 1pT TO SfAIE R .N°. D SOUTH SIC£ TABLE 1 RIB" MINUS GRADATION FOR AGGREGATE SURFACING (CLASS SPECIAL) 9EVE'=E PERCEMPASSANG LB' tC0 M ]6100 SRO 2050 A000 1620 NOTES: \ 1. 11 IIS MINAGDSIIRFAGNG SIMLL BE », 1 W%CRUSHEO UMEST DMESTONE. `i \ 3. YTMINIM FROM EGATESNING& MATERI \ COME FROM KRAEMEMMINING DER W IA T \ INC. R Of E S TING MN., IN ORDER TO MATCH COLOR OF EASING TRAIL. 90% DESIGN NOT FORCONSTRUC77ON n A«uD:w M•uA�° ° rna'rzsiwww�creen TnEu+cor.� MU DN - &0 — N�°^rt A55MON" — 4A M RGN ,T CR 1v13rzots /2pp MARItETpgN1E p{OyE . EPF BARR suit 2D0 I MIN= ' MNss W NnP2 wmo�I. .w�.n.n M�..a. vry laoDess-an °ian BARR mocv-an .:I>M�m6°„^n°"•'^ MTP2 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIR CHANHASSEN, MN BARR P2310101. zOtolola.oa c°rvsmucnw — — — — — — — — CLIENT PROJECT W. TRAIL MODIFICATIONS TYPICAL SECTIONS wrt REEASED A (3 C D 0 1 2 RE= owG ND C-10 R .N°. D NO eY HK APP. DATE REVISION DESCRIPTION DATE RELEASED i LEGEND RIPRAP TURF REINFORCEMENT MAT FLEXIBLE CONCRETE GEOGRID �.00N6IRIIOIIp1 W15 � i RAKED END SECTON ' --PROPERTY ONE 1 �OYPJ ______ 1 REVISION DESCRIPTION RELEASED o v N TOIFOR MTE REIEASEO TURF REINFORCE\BIf WT J (UTEGg3T 2) SEE 1 _ ---------------- wAND ND SU LINEIINGDNMG CULVED1NAl1-' —_ ANDSIIP LINE IN EAG➢NG CULVERT SEE SIE;.Ef G13 rrPROPOSEDO NAGE CHPNNEL WA FLEABLE \ o GOUM CULVERTOURET NIOgF1CAl10Ns.. SEE SHEET 413 1 PLAN: SOUTH AREA SLOPE REPAIR 2 ---------- 90%DESIGN scuE IN FEET NOT FOR CONSTRUCTO --------------�--y- --__-- __ REALRYBNRAIL ------------------------------- suw ENGINEEwNG co. ImS ms u00 AMRI�IPOINTE DRArE HCRRA CHANHASSEN, MN �• • CUENTPROJ CT. 6KOT ___ LWT �MNNEAPous.NN sass "^� MINNEAPOLIS, MN SOUTH AREA SLOPE REPAIR @rs a�w P.� BARR PLAN W.G. No. RI C-11 �.00N6IRIIOIIp1 W15 � i RAKED END SECTON ' --PROPERTY ONE 1 �OYPJ ______ 1 REVISION DESCRIPTION RELEASED o v N TOIFOR MTE REIEASEO TURF REINFORCE\BIf WT J (UTEGg3T 2) SEE 1 _ ---------------- wAND ND SU LINEIINGDNMG CULVED1NAl1-' —_ ANDSIIP LINE IN EAG➢NG CULVERT SEE SIE;.Ef G13 rrPROPOSEDO NAGE CHPNNEL WA FLEABLE \ o GOUM CULVERTOURET NIOgF1CAl10Ns.. SEE SHEET 413 1 PLAN: SOUTH AREA SLOPE REPAIR 2 90%DESIGN scuE IN FEET NOT FOR CONSTRUCTO LANDSLIDE REPAIRS BARRPROJECT No. suw ENGINEEwNG co. ImS ms u00 AMRI�IPOINTE DRArE HCRRA CHANHASSEN, MN 23101014.04 CUENTPROJ CT. EPF sWrmo �MNNEAPous.NN sass "^� MINNEAPOLIS, MN SOUTH AREA SLOPE REPAIR @rs a�w P.� BARR PLAN W.G. No. RI C-11 kEZIsnNG 7Pa� eno N0 835 830 830 825 EA810G G1001M azo m 815 816 810 \ 810 805 205 BW BW ]B m --§ AI AD 785 780 / e0 775 P5 E%ISTNG 0.YMPGEO HEFDWALL PO 770 765 05 7E0 _ t0�2 1W 750 60 �71 SECTION: SOUTH AREA SLOPE REPAIR 0 20 b SCFIE IN BEET LEwsnNC Tessa LN6wTrw6 ea0 eb 035 6K 610 \ WO \ FAl6nNGGROIM Bis � @9 I30 015 \ et5 eta Eos / e05 eao \ em las 705 lea \ 7w les 7e6 leo 7m Ps T15 770 \ 7m 7fi5 '185 \ 7w 7eo 7ss 7s6 750 50 JO 410 491 -10 0 10 20 x b 50 80 nl 80 b 1W 110 120 130 ib 150 1b �21 SECTION: SOUTH AREA SLOPE REPAIR 0 20 b ....i.... i.... e 1 SCALE IN FEET 90% DESIGN '1/� I'VT FOBRnRaONwTRU�cTION IEIFe.=FARY nuim¢Wx.fipE=siunw,u R!e=BiYa, F7L9.YEp11NYq YY=*LANDSLIDE 1."IT B10 —_ —_ —_ —_ nggpR� e� AS BIgWN REPAIRS n.6A161w..YT«*1.a.u1.YfE76Fn e C o o t z enRB ENGINEEPoNG co. EL&JRO A Dls 4w0 wa�rrolNre owvE R 8DO,m sws �"^�• �51+m..�-n,. , Q��'� 1=1923101014.04 HCRRA MINNEAPOLIS. MN CHANHASSEN. MN � cuENT Pao.lEc7 w. ""md "sTM7 SOUTH AREA SLOPE REPAIR SECTIONS IIIA BnnR Gil D N0. Br HK. nvv. DATE REVISION DESCRIPTION TO MTE RHEeSFSt —� MINNESOTA BLUFFS LRT REGIONALTMIL INSTALL SALVAGED MnMT CLASS N RPRAP AT 31 -OPE TOE R4' MIN. LEPT1 SEE® 1 % _ E:9 END 1 M: t�WMA ARCH PIPIM INSTALLu tBT fIMEND BELTNIN-y DN suP-uNEo E VEE/—,'N PROPERTY UNE mPH 1 1 / 1 1 1 ��'�' �\• \- N165t1� v 1 EXISTING CHANIELl1VALN£G \ \ E 58tWM 1 E%ISTNG 511EPM EXTENTG \\ _ _ _ _ _ - 1 INSTALL SALVAGED MnWT CUSSIV RIPIW BTMTRpM 1 ATSLOPETOEaPMIN. DEPTH) IN 1WIiE,I 1 SE� 1 1 1 I1 NOTES: 1. STMT AND ENO COORDINATES FM SALVAGED RIPW AT SLOPE TOE DELI TEE%TEMS ALONG LENGTH OF CHANNEL VERIFY ALL LOCATIONS IN THE FIELD WITH ENGINEER PPoOR TO INSTALLATION. 1. REAWVEDEBPoSINCHANELASNECES FMMRK DEBRIS REMovAl INGIIENTAL TDsCEWAR MVL INSTALLATION. B. MINORGDRI MAY sENECESSARYoN ITHT POFFPLACED SALVAGED-TOMP SLOPES E TIEJN VATi TOP OF PoPRM. INGDEMAL TO PoFRPP PLACEMENT. INSTALL RIPRM STIWNG BASIN (BOTTOM EL. 7A 85) SEE 2 i VANE suPUNEEMSTINGcuLvrm WTHBr.S am. INCLUDES MN, LENGTH INSIDE EMSTING CIA.VOE EXS YMN.IENGTt dR510E TING CULVERT. SEEecu PROPOSED IX NAGE CHANNEL WTH FLEXIBLE CONCRETEGEOGRID. SEE SHEET419 T—T i11 PLAN: SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR ©y 0 30 AO SLALE IN FEET 90% DESIGN NOTFORCONSTRUCTION N sn ArF.mT Hz w.m ownD.w Y „ ..om.�w.our�v.uo ,IL., ND - - _ — — — — — — -- " AssHovm LANDSLIDE REPAIRS %+ RP21 oNs�P„O�w. 6ARR ENGINEEPoNG Lo. D i fl� � MARE NTEMVE D/` M sl tvlBrmts HCRRA CHANHASSEN, MN _ _ _ _ _ _ = EPF ^+ R.NADi RELEASED —�MIMM A e C D o 1 2 s. My ssuS w��e �ob.x.. vn uwas.aTr :A�„wm'„IDOi MINNEAPOLIS, IAN SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR PLAN tn D'v.< BMR ND Br K MP. OATS REVISION DESCRIPTION TOhOR DATE RELEASEDx , Alm mm RNIS EDGRADE E6BM104MpIM REMOVE E%ISTING LONUEIE NEODNMIl FlLLNMILUS VATH CLSM HIGH DENSITY GRIXnPER MOOT 2519JA2 PV Td 2-0` ANNULUS(ASSUMED) R>6TML 11'DASTM F1554. GRM.ORA35THREADED ROD (GALVJ NMCIXaCAEIE �r/'iy4- B'MIHMUM EPO%Y GROIR EMOED. � EA RON. EIXMLLY SPACEp � NROUND CIRCUAFERENLE. CUT ROD FLU6H VOM NUE. 5101 FURMSH AJOINSTALL55 [!]' CMP EViRl P LINING %ISANG CULVERT.Ld77MCTOR TOO VERIFY SIZE • •. - . MUFITINTHEFELDMONOnFY ENdrEER OF ANY dSCREPANLIES PRIORTOORDERING. E%ISnNG GRw! FIFENISH ALD INSTALL 85[6TGSPIPEAPRON �r_�4cm�r�.B��.�R VEPoFlCADON PORT I EXISTNGGROUTED PV Td 2-0` ANNULUS(ASSUMED) 2137 �0 30 -JO -10 0 10 m 1! 10 5101 EXISTING B SPAN CNPA APPROIL 5' D SECTION, STREAM CHANNEL (20' OTTOM WIDTH( E%ISnNG GRw! �fc_1 �r_�4cm�r�.B��.�R VEPoFlCADON PORT EYJ6nNG SMDPAGK EXISnNG 4- SLOTTED PVC EXI6nN`3R ORIGINAL CONCRETE\ UNGERIMAIN EIEGTIpIppiT wLVERT ..................I ....,....,....,....I 1 90% DESIGN L NdtlZON7ALSLAIE IN FEET VERIICALSWEIN FEET SLME IN FEET EwsnNG GRouT NOT FOR CONSTRUCTION Iran axesv iwT 7.¢ ruN vtaM'w71PrL a 1rmrlMerms.VesmlEm M4tm �. o.ec. aMeNmox Nanxn MlA •1.man ^0f°""'aa"""�"TEA160FTE .MTLsrrEwrw Nsnmwac m 4016"41C10N ' — — — — — — — — — —— — — —_ — _ — — — — PIACED IN VqD =LE BARR ENd1EEPoNG GO. I.roo MARxETPc1NTE duvE Suis mO WNNEAr IJS. AN 55435 fn leooes.a„ . Ies�wrzw' as sHOVM HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN, MN (FEB.. m16) EASnNG7�®IPE CA A113s010 EPF WENT PROECTNP. APPROX. ZS AXH SOUTH AREA CULVERT OUTLET REPAIR PROFILE AND SECTIONS 4WNTue 7W— RELEASED A S C D o 1 2 1 SECTION: CMPA CULVERT SLIP LINE %21 SECTION-. STREAM CHANNEL (30' BOTTOM WIDTH) e 70 m SCAIE IN FEET TBD 716 >m 755 750 70 70 EMsnNa PoPRAP TYPE(GEOT I-EFABRIC O O INSTALLM'OFCOARSEFlLTER AGGREGATE. MN)OT 3101H EMBl9q GEOIFX1lE PLACE SALVAGED. CUSS III.OR D TO FN II ffAM BENEATH FlAREDENDSECTON ASNEEDED TOS Rll ATE COARSE FlLTER AGGREGATEISNIHCEME FL THS END SECnION. MID PLACEMENT IS INGDEMM TO FIPRED END SECnON. I I 1 I I 1 I1A� S iBI81ED GAADE �SOk . EL M0— — EL70A5. 3S FQm RVPAP I 1T'B3GRMMMB®dNG �.. - '- EL rao as BouuErtwossvaE 765 7B0 55 750 745 70 �I o c 1�c a.NC 2137 �0 30 -JO -10 0 10 m 1! 10 mpm- 4 PROFILE: CULVERT OUTLET AND STREAM CHANNEL D SECTION, STREAM CHANNEL (20' OTTOM WIDTH( �fc_1 �r_�4cm�r�.B��.�R rA�..crA!�IA► a m 10 0 10 m o to m ..................I ....,....,....,....I 1 90% DESIGN L NdtlZON7ALSLAIE IN FEET VERIICALSWEIN FEET SLME IN FEET NOT FOR CONSTRUCTION Iran axesv iwT 7.¢ ruN vtaM'w71PrL a 1rmrlMerms.VesmlEm M4tm �. o.ec. aMeNmox Nanxn MlA •1.man ^0f°""'aa"""�"TEA160FTE .MTLsrrEwrw Nsnmwac m 4016"41C10N ' — — — — — — — — — —— — — —_ — _ — — — — — � I tT:lroo�an =LE BARR ENd1EEPoNG GO. I.roo MARxETPc1NTE duvE Suis mO WNNEAr IJS. AN 55435 fn leooes.a„ . Ies�wrzw' as sHOVM HCRRA MINNEAPOLIS, MN %21 SECTION-. STREAM CHANNEL (30' BOTTOM WIDTH) e 70 m SCAIE IN FEET TBD 716 >m 755 750 70 70 EMsnNa PoPRAP TYPE(GEOT I-EFABRIC O O INSTALLM'OFCOARSEFlLTER AGGREGATE. MN)OT 3101H EMBl9q GEOIFX1lE PLACE SALVAGED. CUSS III.OR D TO FN II ffAM BENEATH FlAREDENDSECTON ASNEEDED TOS Rll ATE COARSE FlLTER AGGREGATEISNIHCEME FL THS END SECnION. MID PLACEMENT IS INGDEMM TO FIPRED END SECnON. I I 1 I I 1 I1A� S iBI81ED GAADE �SOk . EL M0— — EL70A5. 3S FQm RVPAP I 1T'B3GRMMMB®dNG �.. - '- EL rao as BouuErtwossvaE 765 7B0 55 750 745 70 �I o c 1�c a.NC 2137 �0 30 -JO -10 0 10 m 1! 10 4 PROFILE: CULVERT OUTLET AND STREAM CHANNEL D SECTION, STREAM CHANNEL (20' OTTOM WIDTH( a m 10 0 10 m o to m ..................I ....,....,....,....I 1 90% DESIGN L NdtlZON7ALSLAIE IN FEET VERIICALSWEIN FEET SLME IN FEET NOT FOR CONSTRUCTION Iran axesv iwT 7.¢ ruN vtaM'w71PrL a 1rmrlMerms.VesmlEm M4tm �. o.ec. aMeNmox Nanxn MlA •1.man ^0f°""'aa"""�"TEA160FTE .MTLsrrEwrw Nsnmwac m 4016"41C10N ' — — — — — — — — — —— — — —_ — _ — — — — — � I tT:lroo�an =LE BARR ENd1EEPoNG GO. I.roo MARxETPc1NTE duvE Suis mO WNNEAr IJS. AN 55435 fn leooes.a„ . Ies�wrzw' as sHOVM HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN, MN 23101014.04 A113s010 EPF WENT PROECTNP. AXH SOUTH AREA CULVERT OUTLET REPAIR PROFILE AND SECTIONS 4WNTue 7W— RELEASED A S C D o 1 2 `° BaRR w+c, C -t4 D NO. By Hn. APP. DATE REVISION DESCRIPTION TdFOR 047E RELEASED 1rn�. .,.,..pa„m,,, AXH EfiSThq GROUND ----------------------------- 3 _____________ 3P ftTN RPPAP SECTION VIEW D '? BJ GRANULAR WOOING 1IMTINI1 DND -RDW _________ ____________ r d )IiK SECTION VIEW C WIUMR 12 83 GRANULNR BEDDING BOULDER ELEVATION POINTS ELEV. E1 ELEV. E2 ELEV 13 USVME )N.30 ]503D )SL30 DS VANE I )4)m 1 M.m MIN �, SECTION: BOULDER CROSS VANE NOT TO SCALE tY"GRANULAR RELEASED BEDDNG ` ELSDNG SUBGRADE RiL� BMR ENDNEERING CO. BAIM4mSNIARI(ED+DMEDRIVE S mB � r.«EaE<aous. rAN ssE3s L_LJ_Bj C I D 1 o 1 1 1 2 _ TO,:IX2 OATS RELEASEO PLAN VIEW 2 DETAIL: STILLING BASIN NOT TO SCALE LANDSLIDE REPAIRS HCRRA CHANHASSEN, MN MINNEAPOLIS, MN SOUTH AREA CULVERT OUTLET REPAIR SECTIONS AND DETAILS TE IMO E%ISTNG STR CR4 L 9096 DESIGN NOT FOR CONSTRUCTION MRRPRWECTW 23101014.04 EASTIA acaE ��/� '• —7 TOP9ol ANDB£ED 0 0 A i E%BIHG SiREM1 BED �AJ FLLWRMID o 0 MTE IAL STREW BED INTERNE � FxGVATFD srREnM BED MATERNE (COMPACT) 0 0 24-7NICKB VACEDRPRW (WDOT CUSS M O O 8- THICK Mn TORMIJMFILTER ExisTIMB TOE OF BANK t DETAIL: RIPRAP TOE PROTECTION ROT To SCALE s a n E a a R 909.. DESIGN NOT FOR CONSTRUCTION ? ��¢naanv rw.Tmsswt¢rEfwrwTlw,on 'REttar W,�.pEW1Epa�a[ORNCfA N. LP£CT RP'w`UTNTIIY/. .uv eFn rear""SRT. u�°"" uIExT °x sra"`"°" .urn 'v�ar rxai �a�e+--Radara. — — — — — — _ D D10 D llPCIS mz.�r BN1R ENDWFERINO co. EmaNrE DRIVE MIhXM S.MNM4M w,. l - "` AS SHOYM HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN. MN BARR P23101OJECT N.. 23101014.04 o iv,wo+s CUENr vRo�ECT rw. o... E� WH STREAMBANK REPAIR DETAIL RTUFOR A B I 2 MRR DNG. N.. Gib REV. N., D No. BVIC HK. MPEV DATE REVISION DESCRIPTION �wea . DATE RELEABEp cn �a MH I 1 I PROPERTY LINE I ==e— I I I _____________ L X/ (lG yC QO' ���' CRUSIEDNRGIN CUSS III PoPRAP /y ! / y / / / / / / / / I f I I FXlSTNG WETANO J I r,E� EXTENTS CONSTRUCTION LI—ITS-1 -------- 1 I PROPERTY NNE G,8 I 1 I PROTECT EASING FENCE I 1 1 i 1 1 I I enD It � 1 1 i___ �-- IS • — INSTALLNEWCMNUWFENCE G�� 1 a�•���• G � 1 9GG^ • • t • 1<bDT • � - 13.00T \ PROPOSED STIXAI SEWER SEEe \ G19 \ \ \ \\ vS -- -- _ PoTENf4LL ACCESS RIXf1E \� MINNESOTA BLUFFS LRT REGIONAL TRNL FILL EMSTNG 18' DIP WITH GRIX AID ABPNDON IN %ACE, SEE 018 PROTECTEASTING IEADWALL FILL ARPA TO EL. BOB ) - (COMMON ENHANpAENi) / E%ISTNG LE 8188 / (VERIFY IN FlELD PPoCR TO / DDWtlSTPENA GRAgNG) CONSERVATgN EASFTO=M BpIIDPRY wTWE FE DESCRIPTION P,R uswll G PLAN: NORTH AREA SLOPE REPAIR I m w 2 SCALE IN FEET PNp tlAa'. PJ.1MVNfi A3ooNm TPaNrE o�PoVE ,v,3rza+s HCRRA SuOe ]80 EPF nm++EnPONs, mN 85!38 I-- I M I MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN NORTH AREA SLOPE REPAIR PLAN 90% DESIGN NOT FOR CONSTRUCTION ENSTNG PROPER UNE FlNE Pp T-. ___ _.__._ _ PLUG VATH MANUFACTURED PLUG OR CAP SPECIFICALLY EILI PODiAFLLI POST DESIGNED AND MANUFACTURED TO BE USED KITH TYPE OF PIPE (IS' DIP) BEING ABANDOIEOOR BUUOEAD END f. 100%BOHIEDNNYL COATED-'BIAOt•. CALVArzEDB VAIN CEMENTGROAT PPoOR TOABNAd11N0 RPE LMTH �. FLOM I-EnLL. I \— CAP EXISTING W DIP h� 1 CRUGiEDNRGIN CV55111 PoPRPP \\ t PROFILE: NORTH AREA SLOPE REPAIR 0 ID 20 SCALE IIN FEET ABNOONEN$TING 16 pP IN PILE Will FLOWABLE FlLL OAOUf HEAOMNII `9 'o P]Irt VMFFRF➢FPIDn1[M1PL�Y 11�IHDc*---•• — -- NRIPPGF W3 �yRg WWNOTNTIIy BIDAL imim F1r PLRveIENTNFurNvrR oxsrRucnox — — — a I.LW�I(ETP�OINN EOWVE w.AOT, — MIMIEAPgJ5,MN 551}5 RE EASED 1 TO/FOR DATE RELEASED HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN NORTH AREA SLOPE REPAIR PROFILE, SECTION, AND DETAIL 90% DESIGN NOT FOR CONSTRUCTION BARRPROJECT NP. 23101014.04 CIBYIER iO CFxIER INE pSi t� ALTERNATE UNE Pp T-. ___ _.__._ _ �r EILI PODiAFLLI POST TW RAIL yC1AYD IIOQ!'FNOM]P/� f. 100%BOHIEDNNYL COATED-'BIAOt•. CALVArzEDB FWSIEDORAOE TEIB.NALPOSLSBENO,CORNEBOFNLLPm-SOD. CIWIIFIK FABRIC(] IWAMPIPE. INE POST54a Lt?SSIO. '(-\\\\ BOTTOM RA3 w TOP MlSHALL BE tSF 55 b. / S &LMf1NG TESLOOP OOP CAPS, AND CpAPDIEM PARIS 9WLLL 8E VNYL CDATED 2 WL TM `LRIISNED NFGIN CUSS III ILPNIIP Ibv 6 0. CTNNIIM FISRIC bHN1 BET ME&I WITH N^AY..KIED Y SELVADETOPHDBO w 1T ~9 ]. FABRIC 31Y11 BE TED BELOW TOP BNL EVERY I2•. _ 40 -10 0 10 70 �]p ]0 0. FENCE SHALL BE OROIINOED. CONCPETE FODTNG(TVP.) 6 B. FFN(:E KIGN.IEM SINLLBE OFFSET! GFIpA EDGE CF %21 SECTION: NORTH AREA SLOPE REPAIR 0+431 TRAL DETAIL RFENCE DESIGN VINYL COATED _ D 10 20 - NOL iD SCME 10. REVEwiINST A W11NENWNG I IIN TAE ENUEER P9LYI TO NSTN1ATpN. ENGNEER MAY N.TER FENLF SCNE FEET NJNGMEM/E%lElltb. `9 'o P]Irt VMFFRF➢FPIDn1[M1PL�Y 11�IHDc*---•• — -- NRIPPGF W3 �yRg WWNOTNTIIy BIDAL imim F1r PLRveIENTNFurNvrR oxsrRucnox — — — a I.LW�I(ETP�OINN EOWVE w.AOT, — MIMIEAPgJ5,MN 551}5 RE EASED 1 TO/FOR DATE RELEASED HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN NORTH AREA SLOPE REPAIR PROFILE, SECTION, AND DETAIL 90% DESIGN NOT FOR CONSTRUCTION BARRPROJECT NP. 23101014.04 I.� Itil S, r •J TRAIL MODIFICATIONS SEE SHEET C�7 WIN ♦s le.4rs �� � � may..=.r e� � • �. PL1 �� - CONSERVATION EASEMEM PMCEL 111E ROCK CIECK (IVP,) ��� PLAN: STORM SEWER AND DRAINAGE CHANNEL 0 30 80 umlts BEATRICE I. sfALE ON IN FEET 4 cGN smucnoN REW. US IRZMERSUST CF,EcK STATCW T ELEy. 1 OQT 750.30 2 0.82 78097 3 1.13 785.80 t 1.98 74383 5 2.W 781.15 8 3.03 7@.N 7 3. 7W55 8 4+13 802.32 � FILLARFA 708100-_" PROPOSED giAINAGE GIAIHEL cz+ FLL24'HDPEMDNEWCHANNELMR TOPLUGGING METRO NORTH 18. OWER TRNL EMBAIM.IEM 2. ENSURE VEGETATON IS AT LEAST 7M ESTAB1131ED IN NEW GIANNEL PRIOR TO ALLOW NG FLOW. 3. INTALL SEED 81ANI ET. AND MULCH Ohl PROJECT GSTURBNNCE I3 COMPLETE AIID IN ACCORDPNCE VBTH RESTORATION DE&GN5PEGFlCAlICNS. p.Bpa Np3 ZMOS a 4.003 8K118 STa aRPROFILE: ' � � � 2! CAS PIPE APRON 0 b 80 0 15 30 I- ' OE NOS 75)�- ... HCMZONTAL SCALE IN R:ET VERTICAL SCALE IN FEET er� 1rHrlxewnwFPrrwTlohce r nM[w vet �R aMamnRaxNOTluTiu.[urumER FlAvrarrnTxluwcaTl. CLIBRT NO — _ — — — — — — � e..ream. fleRR ENGIEEPoNG CO. dS10 MARNETpgNIE p18VE SUM 200 sa. AS SHOWN 1N Taucnory — — — — — — — EFF EFF ST-7-'- Aq1 rNurtnxu• — — — — — — — — F"UO1�'I"°E"N" mom+ EXISTING GROUND I EL 8100 u.vM BARB rc APP. DATE REVISION DESCRIPTIONTGFIXi MTE RELEASED Alw i� 081% - - � �a _ FlMSHEDGRADE 1_B�%-_ -____ FINISHEDGRPLE _ W CAS PIPE APRON ._ BE.3%W) FILL AREA 302 LF. M' HDPE @ 157% { (INSTALLECTON4L RIPRAP 3181818 Mfit1 DRNG o a RO(:K CHECK (7YP) SPAOEDAPPROX. EVERY 50' p.Bpa Np3 ZMOS 8•W S 4.003 8K118 aRPROFILE: STORM SEWER AND DRAINAGE CHANNEL 0 b 80 0 15 30 I- ' ... HCMZONTAL SCALE IN R:ET VERTICAL SCALE IN FEET er� 1rHrlxewnwFPrrwTlohce r nM[w vet �R aMamnRaxNOTluTiu.[urumER FlAvrarrnTxluwcaTl. CLIBRT NO — _ — — — — — — � e..ream. fleRR ENGIEEPoNG CO. dS10 MARNETpgNIE p18VE SUM 200 sa. AS SHOWN 1N Taucnory — — — — — — — EFF EFF Aq1 rNurtnxu• — — — — — — — — F"UO1�'I"°E"N" mom+ MINNEPP0113. MN SK35 .n.lam.mz>m I.�.. e�.,lm�'' I RELEASED A B C D 0 1 2 u.vM BARB rc APP. DATE REVISION DESCRIPTIONTGFIXi MTE RELEASED Alw B�Qts HCRRA MINNEAPOLIS, MN M1005 90%DESIDN NOT FOR CONSTRUCTION CT LANDSLIDE REPAIRS RP2310101. 23101014.04 CHANHASSEN, MN STORM SEWER AND DRAINAGE CHANNEL PLAN AND PROFILE 8351 7351 TABLE OF GNAIRRET RIPRAP AT PVE OUTLETS [- CIASSII CLAS5111 ClA TV d50= 6' d50= 9" d50= 12' b' DEPTX 9' DEPTH BARR PROJECT ND. 23101014.04 12' DEPTH OW OF 72', OEp— GRANUUR 24- DEPTH! GR001t1w FILTER RIPRAP .Ay �j/ EIEYATION FLOW ICU. YD.1 (CD. YD) REv. No. D 4.2 1 11.0 SS 14 12 5.5 22 83 7 DETAIL: RIPRAP OUTFALL NOT TO6GlE -Q RIPRAP _���^' MnOOT GRANULAR FILTER MATERIAL eSECTION: RIPRAP OUTFALL oi.o Sc E NOTES %PE SQ£S URGER lI W111109E SHOWN f✓EWIRE A SPECUL OESKYI. REWIRENEWS FOR RIPRAP SIZE ANO THICKNESS AND FILTER BLANKET SHALL BE DESIGNATED IN THE BANS. Q FM PPEB GREATER TION OR EOLULLTO ]0', lSE 15. 0 DBB1910NE13 tlVEN OII STANDARD PUFFS dTBOAM 5110. le I� ll. - RIPRAP MrO.T.NUTAR FILTERMATERML B SECTION: RIPRAP OUTFALL xOITO� FLOW VP G \ DETAIL: ROCK CHECK 1pT i09CAlE r CUSSNMPRAP NOTES: 1. GNTFIEI'6LECON:REiEGEOGRDATEACHRCCK"CK AS NECESSMY TO IMPROVE GEOGRID FLDALBY AND FORM TRENCH FOR ROC( CHECK. 2. PROVIDE MINIMUM OF SFT. OVERUP OF GEWRID AT BREAK BELOW ROCK CHECK WTH UPSTREAM GEOG D LAYER PLACED ON TOP OFOGMiSfREAM GEWRID. 3. VEFIFY NSTAWTION M'D REWIRED SDA WITH MWUFACTU TER PRIOR i0 NSTALIATICN. Ji � y1 x1° — — — — — — — P�"sTMNP"P" — — — — — — — —— RELEASED A B C I D 1 0 1 2 J� ASHOMm HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN, MN BARR PROJECT ND. 23101014.04 y L 2 6 CUEWPRDJECTW ...+ EVF ANN .Ay �j/ EIEYATION FLOW + . GNC. No. C_20 REv. No. D NO. By K. DATE REVISION DESCRIPTION urNRx M1 FLEXIBLE CONCRETE OEOGRU CU58IV RPTUP (FtFYAW\T IXt/1PP0.0VED EDUAL) 8' 1tl PROVIDE MIN.}FT. OVERLAP CULVERT McRi R BLE CONCRETE GEWR#1 AT BREA(BELOW ROCK CHECK TanTui"T OR APPROVED EDua'7 B SECTION: ROCK CHECK OTTO SGIE A SECTION: ROCK CHECK OT Tog uE 90% DESIGN NOT FOR CONSTRUCTION uo 1+PT IwA Zl—. sso 1 `"ii--` x1° — — — — — — — P�"sTMNP"P" — — — — — — — —— RELEASED A B C I D 1 0 1 2 — BARR ENGINEERING CO. p A p� A3BO MAnKETvoINTE DRIVE D 9 200 — MI INS, S. MN 55135 %+.+alR4van ASHOMm HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN, MN BARR PROJECT ND. 23101014.04 tbi12019 CUEWPRDJECTW ...+ EVF ANN STORM SEWER AND DRAINAGE CHANNEL SECTIONS AND DETAILS 1✓<w+4 BARR GNC. No. C_20 REv. No. D NO. By K. DATE REVISION DESCRIPTION urNRx AKH 1; Rf1 TOPSOIL WITH SEED AND CATEGORY 3 EROSION CONTROL BIAMDT. EXTEND EROSION CONTROL B/At31ET f0 MIN. FROM EDGE OF FLEXB3LE CONCRETE GEOGRD. SEE DE1AL2 FOR KEY F MN. TOP6pL AND SEED BELOW FIEKBLE CONCRETE GEOGRD NOTES: T ALL 0.EMBLE CONgtETE GEOC�TO BE 0.DtAAAT OR A34ROVE0 EOIA4. 2. FlE]OBLE WNpE1E(EWl✓oBTO NE LAONAyINF01®1MM4lL 5p TIE 1R'SIREAM RpI/RIAD OVBLTFE TOP OF TFE COSTFISTREAM ROW AFD INSTALLED M ACCORDANCE WITH EMNIFACTIRER7 3. FORCBBMLIWTALLATIONBfORMATXXESEECETAL2, A. PLALETOPSpLAG01ETONSTALLATDNOFFLEXBLFOONCIEETEGEOGRIDND�TOBE SHOOT" PE UFACTLRETL GUt0El1FH %11 SECTION: DRAINAGE CHANNEL MOFFET. IF THE EDGE OF THE FLEXAMAT FLEXAMAT ME%POSED TO SHEET FLOW. RECESS THE OUTSIDE 2 ROWS OF BLOCKS. GRADE THE CHANNEL SO THE — Cincinnati, OH 45209 OUTSIDE EDGE8 ARE HIGHER 513.772-6689 THAN THE CENTER OF THE allo@Fle%amt.com CHANNEL AND THE FLOW 4 -- CONTAINED WITHIN THE MAT ---------------- ROLL WIDTH LONGER THAN NF OVERLAP I3 BLOCKS) 1S- LENGTH. 2.5' DEEP. F—� OVERLAND FLOWINFILL OVERLAPPED MAT WITH TOP SOIL, 18'. 03 REBAR OR APPROVED ZIP TIE. WHEN THE AREA OUTSIDE THE �flE%ANA)ARMOR IS DISTIIRBE COVER THE SURFACE W ITN STRAW. ONC NFTTIM. ON MEVONT FULLS ALONGE UT TO PREVENT RILLS ALONG iNF OUTSIDE EDGE CONSTRUCTgM NOTES: 1. AN ENGINEER OR MANUFACTURES REPRESENTATIVE SHALL BE ONSITE FOR THE START Of THE INSTALLATION. 2. GUIDE THE SITES SO THAT WATER WILL NOT FLOW ABOVE,BELOW. OR AROUND THE OUTSIDE OF THE AREA PROTECTED WITH FLEXAMAT. ALL SUSGRADE SURFACES PREPARED FOR PLACEMENT OF MATS SMALL Of SMOOTH AND FREE OF ALL ROCKS. STICKS, ROOTS. OTHER PROTRUSIONS, OR DEBRIS Of ANY KIND, 3. APPLY SITE SPECIFIC SEED, INCLUDING NATIVE GRASSES DIRECTLY TO THE PREPARED SOIL PRIOR TO FLEXAMAT INSTALLATION. 8. FLEXAMAT ROLLS ARE AVAILABLE N WIDTHS OF A'. SS, a', 10'. 12'.816'. IT IS THE MANUFACTURERS RECOMMENDATION TO UTILIZE THE WIDEST MATS POSSIBLE TO REDUCE AN ABUNDANCE OF SEANLS OR OVERLAPS. a. TO ACHIEVE WIDER WIDTHS. INSTALL MATS AOACENT TOONE ANOTHER. INSTALL ADDITIONAL UNDERLRYM ENT UNDER ALL ADJOINING MATS. A MINIMUM OF 12' OF UNDERIAYMNET SHALL EMEND UNDER EACH SIDE OF THE MAT AND DIRECTLY AGAINST THE SUBGRADE. X.INSTALL A' P3 REBAR U -ANCHORS OR STAINLESS STEEL ZIP TIES IN 3NCREM ENT$ THE LENGTH OF THE LONGITUDINAL SEAM. S. AT THE BEGINNING OF THE FLEXAMAT, TRANSITION THE INITIAL LEADING EDGE PROPERLY WITH EROSION MATTING OR SOD. IF EXPOSED TO CONCENTRATED FLOWS EMBED L' VERTICALLY INTO THE SUB GRADE TO SERVE MAN ANCHOR TRENCH. THE TRENCH SHALL BE FILLED AND COMPACTED WITH SUITABLE FILL OR OTHER IAS SPECIFIED BY EOR). 6. FOR ADDITIONAL SECTIONS OF MAT. OVERLAP THE DOWNSTREAM SECTION IS- WITH UPSTREAM SECTION OF MAT. PRIOR TO INSTALLING OVERLAP, FLIP UPSTREAM MAT BACK N'. EXCAVATE 225. OF SOIL IS - FROM END OF UPSTREAM MAT. DOWNSTREAM SECTION IS UID IN THE SHALLOW TRENCH. LIGMTLY SPREAD TOPSOIL, SEED AND FERTILIZER OVER INITIAL EDGE. FLIP END OF UPSTREAM MAT OVER THE SOIL COVERED INITIAL LEADING EDGE OF DOWNSTREAM MAT. T. INSTALL IS- U -ANCHORS IN 3' INCREMENTS ACROSS THE OVERLAP. INSTALL ANCHORS DMECTLY BEHIND UDCKS.'U' ANCHORS CONSIST OF 83 REBAR'U. ANCHOR WITH 18' LEGS. B. AT THE END OF THE ARMORED CHANNEL. EMBED THE MAT Ia' INA TERMINATION TRENCH. FILL AND COMPACT TERMINATION TRENCH WIT" SOIL IOETERMINED BY EOR). FLEXAMAT INFORMATION Manufacture': Product Name: Address: Telephone: Email W eOsMe: MGI= Enle p"°°'' Inc. FLEXAMAT Fb%amet 3153 Madison Road <'°..� Cincinnati, OH 45209 STANDARD CHANNEL DETAIL 513.772-6689 allo@Fle%amt.com N T S WW Tle.am°I.Dom � ,I .s .- at �„�, I®F ItLEtr 90% DESIGN NOT FORCONSTRU <'°..� ASSMOWN LANDSLIDE REPAIRS uo NUTi Sun our L¢mEP — — —I BARRENGINEERING CO. 1V 32019 311011011 .04 cFMF�FFBuw,wLa+PFFERMAE nro.�F ws o. a corvsmurnoN %xD MARXETPOINTE DRIVE HCRRA CHANHASSEN, MN CLIENT ho W.F T. _______ srvBe Zoo EPF VE gdrvDV GIF — — MINNEAPoDS. MN SSf35 AKHMINNEAPOLIS, MN STORM SEWER AND DRAINAGE CHANNEL _ A B C D 01IXcK SECTIONS AND DETAILS DWC.Ib. REV. No No. Sv .HK. aaa DATE REviSION DESCRIPTION cFmFF TaFOR DATE RELEASED W.�awm an „„,���2®' AIH C-21 D V NM J"k 11 '�ii/111!1 X1111, 1/111 ir/ /---_— _ - _'— %/ �/f��---`� -------------------- -------------- RFA -DINED Gil T1UIL I r -------------- ------------- `__'____- 1-rl/�i� r•.'ll ' /'iris � ,\ " � a VAAr�;-i� ------- -------------------- 1 1 1 1 1 1 Bio 1'11\ ILII j `/' r $;a __LONA TAIL — MINNESOTA SLUFF LRT REG T----- IA4r SYMBOL AND PA RN LEGEND ♦♦ v � ssD EMsnNC lacolrtouR S ♦\♦ %f i i l / I l Il\\ I`�` \���\\\\\ \\ 578 E%ISnNGYCOMOUR il,/ ♦♦ a _ ' './ / X11 \\�C\=,-�\\\\ \ \\I / /} ♦ �' / / _ VDODLANDEOGE Si � ----- --- CONSTRUCTION UNITS NSTRIIGTION LIMITS J ♦♦♦♦ IMnDOT ]6- 1 SEED MIX ,v ® 211 \\\\\\ GEAPoNG LIMITS ♦\ -� { . /�� 1 " - _ ',j%viii/ NAnVECONSTRUCRON SEED MX (MOOT 31]81) 1 PLAN SEEDING D w in Z NET PRPIRIE SEEDMI% SMIf IN FEET (MOOT 3l� yv- . RESTGRanoN NGTEsvY'�' PoP I. All GROl DISTDRBANDE GENERATED FROM GRADING ACTIVITIES _ SHALL BE DECOMPACTED TO A MIMMUM OEPTH OF IT. STASILIZEU ANO PROPOSED TRAIL RESTORED W1 A MMMLM OF B INDIES OF TOPSOIL, SEED WITH COV ER GOP, AND EROSION CONTROL BLANKET OR STRAW MULCH. TME TOPSDIL USED FOR RESTORATION i BE STOCKPILED FROM GRADING AREAS. 3. SEED ANY DIGTURBEOIAEAS OUTSIDE TIE CONSTRULIION LMIRS'MTH THES UFIEDSEEDMM. 3. M11'EXOTIC INJASNE PIAMSAN3 NEEDS NITWN THE SEEDING AREAS SHALL SE Si NIM IERBIGDE 14 MYS PRIOR TO SEEDING. SIGN4GE INDIDATING THE IISE OF HERBIGDES MUST BE POSTED GJ SITE. X. O111ER81GDE PPPIKATNIN SHALL BE PPPUED BY A DCENSEO APPLIDATOR IIi TIE STATE OF MIINEGOTA. 5. SEm IN ACCORDANCE NRN TIE SPEGFICADONS. SEEDING IS TO THE PLACE RMEDIACS] FDLLGMNG FlNALGRADING RID SGL PIACFMENL TD PREVEM EROSION PND COMPACnON. e. REFER TO SPEGFlMTIONS FOR ADDIDONAL INFOIB.IATON. IN TIE CASE OF ANY DISCREPANCIES IETNEEN THIS DETAIL. PLANS, OR SPECIFIMTIONS. THE SPEGFIMTIONS SHM.L GOVERN. 90% DESIGN —Tnurma—M T Nw3Ce[fRTs�sNt.w5.i4E,N.aE tln1�iuiaRuRvs GIEUT eeR CErtNG LANDSLIDE REPAIRS •�••••••2••3•••1•�0••1•0••_1.4 eO.n ¢1F cPrIEyti No — — — — — — — RELEASED A I B I C I D 0 1 2 B°4•°R NEERING CA. 4300 MPRI(ETPGINIE GINE T��iB''- 1?/132019 HCRRA MINNEAPOLIS, MN CHANHASSEN, MN .04 EPE Cl i No. SEEDING PLAN R-01 REV. N°_ D ND BY N P. DATE REVISION DESCRIPTION LSI TaFOR MTE RELEASED PKH q yrs .o _\; r I' 11 \ \``\ `\ � � =__ =- I ///)///ri ///'--=iJ:/=`�\\ \ - i Il •- �\ 11111 1111 !1111 RI: IIt' ' _ _ __ - _______'__'__ �/¢ \\ -__ --------------- ��>,11 \1\I \11 1111 r''r' ___ - `\•� _ - :9� ��h''�_ r//�/�//'ilii'-0/!/ t / ,0 \\ 1 ����\= `�� \ _ !P � \LII c / 111 I 111 \ 11 I \ \1 4 -��� Illilljl, '// /fl :\II1j�%��_� 'r\a _ _rriI -rLr r ! / I / 1 /� -// /tl�� G _ � � / �/''i'S_=fes i///i __� /�'\ l/ � �� //'/ �r / a "lam\ r \ ��\. Y i��l// tai l`-1 R GNED GRAVEL TRAIL r_____ gA/ BLUFFEGIONALT _ RAIL _ L RT R MINNESOTA -- --- - -- - -- - - - - --- - - - - - - -- - - - 1 \ / lir./%tet /--•\ ♦♦♦ �� -- _ / // /\ :.... \ /\\ l♦ \\ /�//ice ' Ill! 1/l �l l�' SYMBOL AND PATTERN LEGEND / \\ \ ♦ \ .moi, Ill fill 11, qt \ t ♦♦♦�.:.: / . . / i� l III J 16/i//ri/ i Ir \ ♦♦ ♦ \♦ c\'1 ' /. - . • .Y..�.i�. .mo� i ' /!/ / i f / 11 /t I1 11 R\ \,\ \\\,11�\\ p0 to Q 11 67E Z LONTWOIRIR - — — — — — — - CONS1RlICTION WITS / F. ...... f/....... yam. "y l 11 V\1 \\\\\\\\\\\�\\� . l ♦ ..-- ./ice ��i' i I /'/� lr r I1/ 1\\\ \\\\Q\ I ---- CIFARING UNITS / CON6TRUOTION LIMf15 � � f: cIEAFING UMITs �'.♦..- _ - -/ ep/ � �� „�< /� �� lr� / / FlEnIeLECDNCRETE CEOGPoD (FLEItNMT OR APPROVED EGUAy 'v i r��rr_ � -� r /r'r//4�I1�'ri� -_ -l�=_ f1 i///!`� e"� .�•dPi �i//. ERO6ION CONITOLSW110=T 1 PLAN EROSION CONTROL BLANKET MULCH PLAN ('1iD0T W. 3N) 0 60 to 6 I,E IN FEET y �,-, DISp ANCIgRED MI.IDN 90% DESIGN sr aRp�r TrwT msq w. srccriunw.aa I T — — — — — — Fiepoinx �� AS SIpNN LANDSLIDE REPAIRS 23101014.04 u vnre cs wvE c°NsmucnoN — — — — — — --- — — A B c D 1 z a �T OD RARRENGNEERINGCO. a 666 rnnRlIETPDINre DRIVE iY"Y Y 1 Sulo alp 1011 A 13 MN n M �^+- v,Bncy.a„'+ F„,�.m ,r6zi m -»a, V/ld q HCRRA MINNEAPOLIS, MN CHANHASSEN, MN EFF CLIENT PROJECT No. Aa. EROSION CONTROL BLANKET AND MULCH PLAN 9oRR D:vG. No. R-02 REv. Nu A NO BY CHrc APP. DATE REVISIONOESCRIPTION .ma+a pATE RElEA6ED W. i I S 1r111II Ijl� �I�l lJll -_---_-- - \�.-�\� 3 r II)\\\I�\1111 ,�/� _I 11 L 1 Vii_/' ri iii' B'!fl s - � �\ -�✓f' i i _- \ - I r III//////r;rJ� ,r'. r! ` \•�__ � / � ar- -------- --------BEAU=NED -----I -------- _ ---_ __--__-----____ Gi .r/r/I/////i /L�1' � {t ul •Il _ :i��l \t \.`t SYMBOL AND PATTERN LEGEND sB� ENsnNc lGcgngn 5>8 E%ISRNGYCONTOUi TBD CONSTRUCTION LMTB — — — — cLEAPoNc uMlrs 1 \ TBD PoPRAP EA. wnnicans FLENBLE CONCRETE GEOGRID 150.0 4 � 41i r� Quercus elLyatlalis �✓ I is O.0 r CONSTRUCRONLWITS � Sugar Maple q[nsocdwwn N30CIR 150.0 50% /r•'//I �l /J r� f\lr � _/ Nr SYMBOL AND PATTERN LEGEND sB� ENsnNc lGcgngn 5>8 E%ISRNGYCONTOUi TBD CONSTRUCTION LMTB — — — — cLEAPoNc uMlrs 100.c 3% TBD PoPRAP EA. wnnicans FLENBLE CONCRETE GEOGRID 150.0 (FLENN.NTOR APPROVEp EOUAM ® TREE PLWTTING PRFA @1\1\ �/� I - I _ - 1 ------------------------ - — — — — — - ------------ ---------------- 1 PLAN: EROSION CONTROL BLANKET AND TREE PLANTING PLAN 0 W 130 BCNE IN FEET 1. ALLTREESGRFATERTNAII6'd �TBREASTWIGNTREMOVEDMMNG CONSTRUCTION SWILL BE REPLACED AT A 11 RATIO. 3. ESTMIATEDTREEREPLACElAEMOUANDAESAREPRONLIEDINnE U PLANTING SLIEDLIE Fqt NOGNG PWPOSES. 3. ACTUKTREE RE%ACBAEM OIWNDTYWLLVMYFROkI TIE RANTING 6GEWLE BASED ON MIMBER AND SPEGES aF TREEB REMOVED WPoNG CANstRUCng1. a. BOTN CGARACTgt AND ENgTEER SIMLL APPA LOG OFML TREEB GRFATFA TWI6' gAkETERATBREAST 1EIGHT REMOVED GIBING CONSTRUGnONTO OETFRIAINE TREES TO BE PLANTED. 5. APPROXII.WTE PRFl3 FCR TREE PIANTNG PRE SNOPM ONTIE RAN WEW FlF1D STNS LOCATIONS OF PROPOSED TREES IN THE FIELD FOR RENEW AND APPRWAL BY ENGINEER PRIOR TO PUWTING. /r/ ' I i 1 REGIONPLTw`IL Ironwootl OOPMyYsw #10 CwH. 100c H6 TBD 0sxny 5ervl[eL ry gmelorl[hinarbwm Rio Ulx, 100.c 3% TBD AmeHran UMen EA. wnnicans R10 C IR' 150.0 ON TBD NortM1em Pin Oak Quercus elLyatlalis #10 Unc is O.0 3% TBD Sugar Maple q[nsocdwwn N30CIR 150.0 50% TBD Retl Oak Ounns.uba glo Cant 150.0 3% TB0 H.HNRy CRIB ecu Ws Ilio Cult 10O.0 10% TBD NatlwnStraMReOBUE ROOTS ABOVE ROOT FLARE R10 Cart. 15 Mc M TBD Svnmp AS'Iltte Oak Dunces bkv #10(mt. 15 O.c 3% no RIxAC N, PNnlusna4no R10 Cant 1000 a% TBD fallanwaatl Ao'd. tleVtw'tla Bill Cmc ISOs So% TBD FINISH B. ND MIECH TO BE IN CONTACT 5311x1 BASE aF Tobi TRIO MINNESOTA BLUFFL ��'J DETAIL: TREE PLANTING AT TO i21 TABLE: ESTIMATED TREE PLANTING SCHEDULE 90% DESIGN NOT FOR CONSTRUCTION TREE PIANIING NOTES'. oueN* — — — — — Bio — — — — — — — v'sTPOCT'.a 1. REMovE DFAD DR DAIAAGED BRANCIEs. gETNN TLE NATLRPL FORM OF PIFNi. W NOT HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS , gRTIE IFACER 2. IF ROOTFLARE IS IAT EXPoSEO WITHIN THE EPF WENT PROECT N . CONTNIAIE SURFACE SgLTO BASE AKH OF ROOT FWFLAFJE E. 3. qG PLANT HOLES B'MIN. LARGER TINN ROOT Dt'�^ BARR TREE PER SOIEDULE MARS, All -s ms. No BY rc DATE REVISION DESCRIPTION TovPm DATE RELEASED SCARIFY BOTTOM AND SIDES q=HOLE PRIOR LX. ROOT FLARE TO BE AT GRADE TO PLANTING AND NOT COVERED WTII MULCH 5, SET TREE ON UGHRY FIRMED BACKFILL SOIL OR SOUL SO ROOT FLARE IS EVEN WITH FINISH GRADE. PRUNEAIA pEMONE 6. BACgTLL WTH PLANnNG SOIL ANDFlMI SqL POVANTAGEg15AND FIBRWS AROUID ROOTMASS TO MNNTNN PLUMB AND ROOTS ABOVE ROOT FLARE ENSURE NO NR GAPSAROtRaD ROOT MP55. T. CONSTRUCT 3' WATERING BASIN. TIAROUGI Y 3'SHREDDED WATER Wn11N 3 HOURS OF INSTALIATAN. HARONOODMLLCH e. PLADE SHREDDED NARDW000 MULCH(MIYTIOT BNGOENTALTOTREE SPEC 38522 ttPE 8 -WEED SEED FREf INSTALLATIONS SLitEDDEO NMDVAOD)TOA RPGUS OF 2a' AND ADEPTHOFL ARW!O TREE (sqL PREPAA RED AS PER RA10. FINISH B. ND MIECH TO BE IN CONTACT 5311x1 BASE aF GRAS 10. CONTTKGTOR IS RESPONSIBLE Fqi MNNTNMNG TREES IN A PLUMB POSfnp1 WT THE GUARANTEE PERIOD. 1. 1 CONTRACTOR SARY COONTRACTOR TUARANT LENBnNGSUBGRADE EPERIOAS TO MWAI HOUT GUARANTEE PERIOD TO MNNOFTIN AHEALTHY N.Al AT THE PERIOD END OFn1EGUPFANTEEPERIODPIITREES THATARGHTly OR DETEREPLACENIIEALTHY BACKFILLSgt OR UNNGHTLY SHALL BE REPLACED AT CONTRACTORS EXPENSE. DETAIL: TREE PLANTING AT TO i21 TABLE: ESTIMATED TREE PLANTING SCHEDULE 90% DESIGN NOT FOR CONSTRUCTION �''�^�`^•*,WHnN..PtttGTatW n11)GEnw bRCT PSERnaoHuo Tw�IaH quXru�p morE roxuS[txacga.[nv¢ rA .wsoTH= tyaw oueN* — — — — — Bio — — — — — — — v'sTPOCT'.a N=AetXaw BARB a0MAPogNTEDRIVE � SUN 2EWNGLO MIMiFA➢OL15. MN SSa35 a 'HmNa'T' rn �mpml-an �t:Tl `¢.' AssHOWN HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS , R PROJECT No. 2370707x.04 a ,v, B00,B EPF WENT PROECT N . AKH TREE PLANTING PLAN RELEASED A I B I C 1 0 1 1 1 2 3 Dt'�^ BARR DAA R-03 A No BY rc DATE REVISION DESCRIPTION TovPm DATE RELEASED N01 r A WATER _,REINFORCEMENTMAT T JIM e`e4`o o ANCHOR CHECKSLOTNOTES: 1. MCU AT121N.INIEWJ ,BA MUMDCI. TML 2. CIECKSLOTSTOSEPUCEEVERY2GALCNGFLOWUNE. INTERMITTENT CHECK SLOT 1 217, ANCHOR NOTES: 1. PLACE ANCHORS ACCORDING TO ME ABOVE PATIERN. 2. OVERLAP SETKEEN ROLLS IS S IN. MIN". 3. SPUCEBETWEENR 1518IN. MINIMUM t. ALNNYSIMTAIIL%NIBLERGNOF%NSSPACE012'APARTATALL SPLICE& 5. INSTALL %NG DOWN TILE CENIER OF EAGIIMT STAGGEPoNGTHE OUTSIDE PING S. lNkS S GHALLBE PT MINIMUA121N.STEESN ONCE ANCHORS NWSHERS OR 121N. LLSNAPED 1MRE GTMLEG, LONGER ANCHORS MAYBE REOURED FOR LOOSE BGLS. ANCHORS MUST PROVIDE SUFFlGEM GRGINJ PEIET W,TION TO RESIST PULLOUT TRM ANCHOR PATTERN TMA t. PLACE 1AnONNOTES: AMINIMUM TELY OF TO ESPENSLOPE. 2. PLACE AEMENT MTELY 50°60F THE SPECIFIED SEED AND MICE SEEP IMO SOIL PRIM TOPLACEMEMOF TRM. 3, INSTALL ANDANLH T TRMAGSILVERED. AND DI .LOOS)C t. PLACE ALD TRIM TOPSOIL (P SISI -E ED.DRY. LOOSE�OVER TRM ROUGHLY 11N.1HCK OR LY RL TIE TRIM IS IUFSEVISIGO 5. APPLY REMAINING GEEING ON TOP 6SGL Fll1ID TPoA AN)UGILILY RAKE INR) SOIL USING TIE RAT SIDE OF P RPKE. 8. HYDRCMLLCH MAY BE SUBGTINED FOR LIE APPROALII IN STEP G. nAF REINFORfFAEMIMT WPTEHH� frFm ANCHOR TRENCH NOTES: 1. SECIARF PT 121E INTEMALS. MCKFIIL PNp CP1PACT SGL 2. SLOSLOPES.LONSTRULT TOP ANCHOR IRENGI2 FT. RETOLD CREST OF ROPE. 1 DETAIL TURF REINFORCEMENT MAT NL' Ta s ----PBAR .=R ENGINEERING CO.>xR smucn°x — — — — — — — .300 MARKETPGNIE DRIVE DI`1RR MINiEMINNE o PPOUs.MN 55135 RELEASED A 8 C D D 1 2 TGFOR DATE RELEASED ft1 M= TOP ANCHOR TRENCH HCRRA MINNEAPOLIS, MN WEURE AT 121N.INTERVAlS, BALKFILLAND COMPACT SGL EDGE TERMINATION ANCHOR TRENCH LANDSLIDE REPAIRS CHANHASSEN,MN RESTORATION DETAILS 90% DESIGN NOT FOR CONSTRUCTION BARR PROJECT Na. 23101014.04 a MINNESOTA BLUFFS LRT REGIONAL TRAIL LANDSLIDE REPAIRS MINNESOTA COUNTY MAP CONTACTS: ENGINEpe eaNrACT Metl PeMwn Bert EApFbeArq Co. MngpeF. \N 551]5 952%4ID19 eowraw@eE..mn, OWNERS RE% MNTA1 f NTA0 H du C M, G R¢ppYal RailwEAullxnly mtfauNAw.s..s15 612 a b.A111551t5 0lzaazwt er.c..cemo-�ne�ned�.�: CITY OF CHANHASSEN RECEIVED HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY (H(.NfRRA) JCATION )UNTY EN. MN. INDEX OF SHEETS G-01 .... TITLE SHEET, PROJECT LOCATION, AND SHEET INDEX G-02 .... LEGEND, NOTES, ABBREVIATIONS, AND ALIGNMENT CONTROL DATA G-03 .... STATEMENT OF ESTIMATED QUANTITIES G-04 .... SITE ACCESS. STAGING, AND TRAFFIC CONTROL - OVERALL PLAN AND NOTES G-05 .... SITE ACCESS, STAGING, AND TRAFFIC CONTROL - PLANS G-06 .... SITE ACCESS, STAGING, AND TRAFFIC CONTROL - PLAN AND DETAILS G-07 .... TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY G-08 .... PROJECT LAYOUT PLAN C-01 .... EXISTING CONDITIONS - PLAN C-02 .... EXISTING CONDITIONS - PHOTOS G-03 .... REMOVALS AND TEMPORARY EROSION CONTROL PLAN G-04 .... TEMPORARY EROSION CONTROL DETAILS C-05 .... STORM WATER POLLUTION PREVENTION PLAN (SWPPP) C-06 .... STORM WATER POLLUTION PREVENTION PLAN (SWPPP) C-07 .... TRAIL MODIFICATIONS - PLAN AND PROFILE C-08 .... TRAIL MODIFICATIONS - CROSS SECTIONS C-09 .... TRAIL MODIFICATIONS - CROSS SECTIONS C.10 .... TRAIL MODIFICATIONS -TYPICAL SECTIONS C-11 .... SOUTH AREA SLOPE REPAIR - PLAN G-12 .... SOUTH AREA SLOPE REPAIR- SECTIONS G-13 .... SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR -PLAN C-14 .... SOUTH AREA CULVERT OUTLET REPAIR - PROFILE AND SECTIONS C-15 .... SOUTH AREA CULVERT OUTLET REPAIR - SECTIONS AND DETAILS C-16 .... STREAMBANK REPAIR - DETAIL C47 .... NORTH AREA SLOPE REPAIR - PLAN C-18 .... NORTH AREA SLOPE REPA P. IO PROFILE, SECTION, AND DETAIL C_79 .... STORM SEWER AND DRAINAGE CHANNEL - PLAN AND PROFILE C-20 .... STORM SEWER AND DRAINAGE CHANNEL - SECTIONS AND DETAILS C-21 .... STORM SEWER AND DRAINAGE CHANNEL - SECTIONS AND DETAILS R-01 .... SEEDING PLAN R-02 .... EROSION CONTROL BLANKET AND MULCH PLAN R-03 .... TREE PLANTING PLAN R-04 .... RESTORATION DETAILS GENERAL NOTES: DEC 2 0 2019 1, TOPOGRAPHIC SURVEY INFORMATION SHOWN IN THIS PLAN SET IS A COMBINATION OF DATA FROM: SURVEY CONDUCTED BY BARR ENGINEERING CO. IN JANUARY 2015, SURVEY CONDUCTED BY STONEBROOKE IN JANUARY 2019 AND MRDNR 2011 UDAR CHWASSEN PUWNING s TOPOGRAPHY. DPT 2. IMAGERY: COPYRIGHT PICTOMETRV INTERNATIONAL CORP AND HENNEPIN COUNTY. � RICE LAKE MINNESOTAX)15. C 3. DATUMVEY COORDINATE SYSTEM: CARVER COUNTY COORDINATES. NAD83 HTM NAD83 MARN, US SURVEY FEET. IIS TZ on d. VERTICAL DATUM NGV029, GOPHER STATE ONE CALL. CALL BEFORE YOU DIG PLAN: PROJECT LOCATION osoo loco 90% DESIGN N sa4ENFEer NOT FOR CONSTRUCTION iear®mr mr�AMw>.effA'wi✓xw �`i `asmxia.w:nw. Yum®PTRUCT�ON— — — — a crtz eARR ENciREERiRc w. evr AS SIpWII LANDSLIDE REPAIRS H4RR 2310101. 23107014.04 tvtrmts w.. Aaw�nEw.ea„E = _ _ _ _ _ _ y >A1w aworwRrcETroiNre oRrvE swm ma sNN6.SIi5 m. mau an HCRRA MINNEAPOLIS, MN CHANHASSEN, MN EPF cuENrPRwEcrrwr(r( ARPz TITLE SHEET, PROJECT LOCATION, ANDA INDEX a,� �E1 B C D o 1 z.SHEET A11M G-01 D - APP OArE REWSNXJ DESCRIPTION p1rERFya=gsEp LEGEND 790 - EXISTING INDEX CONTOUR -- 758---- EXISTING INTERMEDIATE CONTOUR - - -- EXISTING PARCEL LINE -SS- EXISTING STORM SEWER - FO - EXISTING FIBER OPTIC --- x - EXISTING FENCE LINE S ST-] EXISTING CONSERVATION EASEMENT CONC. EXISTING STREAM THALWEG EL. EXISTING STREAM EXTENTS -wT- EXISTINGWETLAND - - - - - - - CONSTRUCTION LIMITS - 790 - PROPOSED INDEX CONTOUR - 788 - PROPOSED INTERMEDIATE CONTOUR - SS - PROPOSED STORM SEWER -X - PROPOSED FENCE - - - - CLEARING LIMITS CMPA SILT FENCE mlm6 w PROPOSED RIPRAP 1w0A9 STAGING AREA 0 W-1 2015S01LBORING 0 vat EXISTING PIEZOMETER Q SB -1 2018 SOIL BORING S ST-] MIS SOIL BORING ABBREVIATIONS CB CATCH BASIN C.I.P, CAST -IN-PLACE CLSM CONTROLLED LOW STRENGTH MATERIALS CMP CORRUGATED METAL PIPE CONC. CONCRETE EL. ELEVATION FES FLARED END SECTION I.E. INVERT ELEVATION MH MANHOLE wDOT MINNESOTA DEPARTMENT OF TRANSPORTATION NWL NORMAL WATER LEVEL RCP REINFORCED CONCRETE PIPE TRM TURF REINFORCEMENT MAT CMPA CORRUGATED METAL PIPE ARCH SYMBOLS LINITIS OF S£LTION Ml- SBCTION IDIO-l"£R 1 S=ON R£i£R£AC£S 19 SXFLI RCIg1 6 IDL4TF5 OX SECTION VIEW CALL OUT S6 ION IDENTIFIER (TYR) 7 SECTION: GRAPHICS STANDARDS 1 9GV£ 1=1 SELR'ION RSFEREM'SS�TYP.) ""'gLp11G16°"rt SECTION VIEW TITLE DETAIL POENTtPtER 1 +o DETAIL REFERENCES 91Ri dint 6 UM'lf0 Ox DETAIL VIEW CALL OUT DETAIL IDSMIIIER (TYP.) DETAIL: GRAPHICS STANDARDS 171 scAL5:1=+ DLTATL R£1'EMMZS (TPP.) vm aTUL Is cwAo-art w GENERAL NOTES: 1. CONTRACTOR SHALL LOCATE AND FIELD VERIFY ALL EXISTING UTILITIES PRIOR TO WORK. 2. ALL EXISTING ROADS, PARKING LOTS, TRAILS, SIGNS, OR SIMILAR SHALL NOT BE DISTURBED DURING CONSTRUCTION. CONTRACTOR SHALL COORDINATE SURVEYS WITH THE ENGINEER TO DOCUMENT PRE -CONSTRUCTION EXISTING CONDITION ISSUES. 1 CONTRACTOR SHALL INSTALL AND MAINTAIN ALL EROSION CONTROL BMPS PRIOR TO COMMENCEMENT OF GRADING FOR EACH LOCATION DURING CONSTRUCTION. EROSION CONTROL PLANS ARE PROVIDED INSIDE THE PROJECT STORMWATER POLLUTION PREVENTION PLAN ISWPPP). 4. CONSTRUCTION LIMITS AS SHOWN ARE APPROXIMATE FINAL CONSTRUCTION LIMITS TO BE COORDINATED WTTH THE OWNER AND STAKED IN THE FIELD. 5. CLEARING AND GRUBBING TO BE PERFORMED ONLY WITHIN GRADING LIMITS AND ACCESS ROUTES UNLESS OTHERWISE DIRECTED BY ENGINEER. 6. TREES TOM CLEARED WILL BE MARKED IN THE FIELD BY ENGINEER. ALLTREES= B' IN DIAMETER NOT MARKED FOR REMOVAL SHALL BE PROTECTED. ]. TREES IDENTIFIED BY ENGINEER FOR ADDITIONAL PROTECTION SHALL BE PROTECTED AGAINST ROOT COMPACTION, DAMAGE AND DISFIGUREMENT IN ACCORDANCE W@1 MODOT SPEC. 2572. PROTECTION OF TREES NOT IDENTIFIED TO BE REMOVED SHALL BE INCIDENTAL. 8. CONTRACTOR SHALL TAKE PRECAUTIONS TO MINIMIZE THE TRANSFER OF AQUATIC AND TERRESTRIAL INVASIVE SPECIES TO THE MAXIMUM EXTENT POSSIBLE. ALIGNMENT CONTROL DATA NORTH AREA SLOPE REPAIR CONTROL DATA - ALIGNMENT'N' TYPEA60. SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR CONTROL DATA- ALIGNMENT 'C' TRAIL MODIFICATIONS CONTROL DATA -ALIGNMENT T' Lt TYPEMO. STMT STATIgN START NORTHING TYPEMD. START STATION START NORTHING START EASTING BEARING LENGTH RADIUS PC STATION PT STATION END STATION END NORTHING END EASTING Ll MWOOT INW141 SMSM13 16539.0 +WW 19N' lm 5629].9 1w0.WT 18189.48 mlm6 w l3 1w0A9 1mm" NIO]IL9 1w9 174M 105181.]0 56211321 µ74m 11160111 wlT .w CI 2�74.9T lI)S4* w "IEN.57 WIW14T 1118T IODOW NIILNT NIamT 18511µm wlslgM L1 4.18MT ioimm 501818.M N32A3L 1µ.N 195119m S .34 Bg18TT /851508/ 5611pi.OL n B 7mT 16]15034 5819µM N38'STI'(E 91A' IOOO.W S .82T 5H98ZT 6 9B.B2i 1051 m 58188251 u 5w5.9T I9 m s619254 5 m 11om e.W.m 1s 13 se20a7A1 tl 8w .m 19550213 S9ID8IA1 µ49361]E mm lm.W S .m Bw3A9 9w349 165588.13 M12180 LS & MT 195566.13 58212188 30851' 1301.9T 1891058 582309.92 NORTH AREA SLOPE REPAIR CONTROL DATA - ALIGNMENT'N' TYPEA60. SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR CONTROL DATA- ALIGNMENT 'C' LENGTH RADIUS PC STATION PT STATION END STATION END NORTHING ENO FASTING Lt TYPEMO. STMT STATIgN START NORTHING START FASTING BEARING LENGTH RADIUS PC STATION PT STATIN! END STATION END NORTHING END EASING Lt Ow DW 185905.]3 58209.10 6W'5W3E 6585 iN]JI9 16539.0 0.9.95C 19N' lm 5629].9 C1 OwOABC 186Ntl 9 58209]53 sll0 9E 81.M' m.W ObBmC 1w9 1w089C 105181.]0 56211321 n 1.5oa9c 166151.71 58211]51 S'P w 36.1e �6a 1•sn39c 1M11 6 U9659C 191nm 56210248 n U58..1TT. 191nm 36216246 SR' m SOm 35W 1w959C N32A3L H3]A3C 195119m S .34 NORTH AREA SLOPE REPAIR CONTROL DATA - ALIGNMENT'N' TYPEA60. START STATION START NORTHING START EASTING BEARING LENGTH RADIUS PC STATION PT STATION END STATION END NORTHING ENO FASTING Lt MOO.00N 168115ffi SRTAAI9L SM'YAIE ST1T MS]1R! 1851WAB 56µ3)A2 LZ Ow]ZM 1tl1Wm 56212].]03 SBD'0150E 142 2w0AXN t6W3e.19 SRS1.R 90% DESIGN NOT FORCONSTRUCTION DRAINAGE CHANNEL AND STORM SEWER CONTROL DATA -ALIGNMENT'S' TYPENO. STARTSTATKNN STARTNORTHING STARTEASTING BEARING LENGTH RADIUS PCSTATION PTSTATION ENDSTATION ENDNORTHING ENDEASTING Lt 0 .Orlg 1852M.W 5821109 NXI'Mr4BE Ulm iN]JI9 16539.0 5819.4) C1 1µ]m5 16539.0 55219.4] TIIIV]35E MAW t00.W 147m5 14 148 1w2145 18642/43 5 4111 12 1M2.149 165LI/.4J 5922'1]58 N14TW3E 131.W 3N9319 18555535 592249Y! a 5+15x15 19559.9 5 mm NNTIN ww 1mm 3x15815 3.x559 3w� 185682.]4 5B22mA1 L3 SHT535 155583.]4 50x5941 N=1S49E 159.48 1K2A3b 189/OBm 5893581 LI µ9),9g 19ROB59 SW.U591 µ9998'40E M.87 9 7.M 16595.11 59349.]1 u ew7m 1659]5.71 59249.]1 µ3T4358'6 959 S .ws 15Ww.W 5 m 90% DESIGN NOT FORCONSTRUCTION xCO1S""""OH "S10µ'" LANDSLIDE REPAIRS 23101014.04 =�'®�Abiw�NlAaav [o m9r®w..PARra� 119w.s a-"` - - - - - BARR ENGINEERING p x �R aSoe MARRercolNTF DRIVE lv!i 19 HCRRA CHANHASSEN. MN g1ENT PRDA[cT No. _ 0 a,., D/",�R MINNE MINNEAPoLIS, MN 55!35 MIP! MINNEAPOLIS, MN LEGEND, NOTES, ABBREVIATIONS, - RBIEwRm A e C D D 1 z •- on.1 -a ?7 ewx+ BARB MG No REv NO. BI c..ARF DATE REVISION DESCRIPTION 9 � `6' 'M'-'fO' AND ALIGNMENT CONTROL DATA G-02 D mFoR ANTE R6L6AgeD .000+6 8 F{ t a R O 43 STATEMENT OF ESTIMATED QUANTITIES 90Y DESIGN NOT FORCONSTRUCTION TOTAL ITEM NO. ITEM DESCRIPTION UNIT ESTIMATED QUANTITY 2021.501 MOBILIZATION LUMP SUM 1 2051.501 MAINTENANCE &RESTORATION OF HAUL ROADS LUMP SUM 1 2101505 [LGRING AUE 4.30 2101.505 GRUBBING ACRE 4.30 2106.502 REMOVE CONCRETE HEADWALL EACH 1 2100.502 REMOVE PIEZOMETER EACH 2 2109.502 SALVAGE BENCH EACH 1 2104.503 REMOVE WOOD RETAINING WALL UN FT 31 2104.503 REMOVE ODUN LINK FENCE UN FT 2446 2104.503 REMOVE SEWER PIPE (STORM) (NORTH PIPE) UN FT ] 2101.607 SALVAGE RANDOM RIPRAP CU YD 197 2104.601 REMOVE MISCELLANEOUS DEBRIS (NORTH PIPE DEBRIS) LUMP SUM 1 2105504 GEUE%I1lE FABRICTYPES 50 YD 1616 2105.601 DEWATERING LUMP SUM 1 2105.601 CONSTRUCT ACCESS ROAD LUMP SUM 1 2105.607 EXCAVATION -SPECWI NYD 2824 2105.607 HAUL AND DEPOSE OF CONTAMINATED SOIL NYD 36)1 2106.501 IXGVATON-COMMON CU YD 39,990 21116.523 COMMON EMBANKMENT(M NYD iB08 2112.603 $UBGRADE PREPARATION UN R 1112] 2118.507 AGGREGATE SURFACING (CV) CLASS SPECIAL N M % 2130.523 WATER (DUST CONTROL) MGAL 15 22315W AGGREGATE BASE (CV)CLASS 5 NYD 259 2451.507 COARSE AGGREGATE BEDDING (CY) CID TO 9 2501.502 95" SPAN GS PIPE-ARCH APgON EACH 3 2501.502 24'GS PIPE APRON EACH 2 2503.fiO3 24' HOPE PIPE SEWER-DIRECTIONAL DRIUFD UN FT 302 2503.6A3 PLIIGflLLAND ABANDON PIPE SEWER DN FT 115 7507.603 LINING CULVERT PIPE (95° SPAN) SPECIAL UN R 7 2511.506 GEOTE%DIE FIVER, TYPE 54YD 35 2511507 RANDOM RIPMPCGTS SPECIAL (SALVAGE) NYD 147 2511.507 RANDOM RIPRAP [LASS SPECIAL (AZnI) a) YD 9M 2511.50] RANDOM gIPgAP CLASS SPECIAL (R4]0) NYD 510 251150] RANDOM RIPRAP CLASS III NYD 292 251L507 RANDOM RIPRAP [IASSN CU YD 178 2511.507 GRANULAR FILTER NYD 101 251150] GMNULM FILTER MOD (83) NYD 405 2511.602 PGCE BOULDER 255].603INSTALLCNAINUNKFENCEIJS2573.501STA8IUZEDCONSTRUCf10NE%R2 2573.503SILTFENCE,TYPEMSIOp22 EEACH30 2574507COMMONTOPSOILBORROW3536 25]5.504EROSIONCONTROLBGNKETGIEGORY3N12.490 25]5.504FLE%IBIE[ONUETEGEOGRIDNUT 1T]2 2575TUgFREINFOR[EMENiMATUTEGORY22820MULCHMATERULTPE4 10,990 2575.505 SEEDING ACRE msrmv� vx�u .raw yqy, ai[ - - - - - - - - gELLhgEp A D C D 0 1 2 p D� �^^'�"'�"�` R.1Rwman Nwum BARR ENGINEERING CO. a3oo w�wcemolN�E MIME UINNE�woLIS. NN s M an 6u�Iml w--3601 As sNnxN HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN. MN z3i D7D14.D4 ttR]lN1B cu nPRo.IECT No. o� N1P: STATEMENT OF ESTIMATED QUANTITIES 5 a No eY wlE REVISION DESCRIPNON ^' annR MG.N°. C-03 REV. N°_ D TOTdi MTERLIEASED Mn� 411P2 7.91 SITE ACCESS NOTES'. 1, LOCAPONS OF UTILITIES AND OTHER INFRASTRUCTURE IN HIGHWEW DRIVE AREAME APPROXIMATE. VERIFYLOC MSMIORTOMMILIZINGTOSITE.CONTRACTORIS RESPONSIBLE FOR UTILITY LOCATE AND FIELD RECONNAISSANCE- Z POTENTIALACLESBRp SMESIg MJ EP S. IFCONTRACTORWISHESTOUSE M ALTERNATE ACCESS RARE, R MUST BE R VlAooED AND MPRXA£D BY ENGINEER FDOR TO USE. 3. TEMPORARY WETLAND FILL IS ONLY ALLOWED IN THE LOCATIONS SHONTJ ON THE PLANS. GO U NOT PCE FILL IN WERANDSIDITCHES OUTSIDE OF THERE AREAS. <. SUBMIT MATERIAL PROPOSED FOR TEMPORARY FILL TO ENGINEER FOR REVIEW 5. MNNTUN FLOW IN DITCHER MD CONTROL WATER DURING CONBTRULTON. THIS MAY INVOLVE THE INSTNLITON OF PIPES ANO POTENMLLY PUMPS. 6. THE FOLLOWING ITEMS ME INCIDENTAL TO PAY ITEM 2051501 MAINTENANCE SRESTOMTION OF HAUL ROADS: fil TRIMMING AND CLEANING TREES ALONG ACCESS NUUFE. 82 FURNISHING AND INSTALLING GEOTEX'N E FABRIC IN WETLANDS 63 FURNISHING MO INSTALLING TEMPORARY FILL IN WETLANDS 620 CONTROLLING WATER AND MNNTANNG DRAINAGE IN DITCHES MROUGI CONSTRUCTION. B.S. PLACEMENT OF ADDITIONAL FILL ANDIOR GRAVEL SURFACING OUTSIDE OF WEIWIp MEAS AS CONTRACTOR DEEMS NECESSARY TO ACCESS THE SITE. 8.8. REMOVALOF GEOTEXTILE FABRIC AND TEMPORARY FILL FROM WETLANDS UPON THE ,,.FLETKMi OF CWSTRUCTIGN. 6.7. SEEDING IMPACTED WETLMOS UPON THE COMPLET OW OF CONSTRUCTION BB. REGRADING THE TRAIL FROM HIG1MEW DRIVE TO THE LANDSLIDE UPON COMPLETO44 OF CCNSTAUCTION AND RESTORING THE TRNL TO PRE CONSTRUCTION CONDITIONS OR BETTER TO THE SATISFACTIONOFEWINEER FURNISHING AND INSTALLING AGGREGATE SURFACING SHOWN ON DETAIL 3 O SHEET G,06 WILL SE PAID UNDER SEPARATE PAY ITEM 6.8. ALL COORDINATION PREPNUTx3N CONSTRUCTION, AND RESTORATION ACIMDES AS LAUD MATH ACCESS THROUGH MOON VALLEY AGGREGATE AND FRO]HMAIVIEW MINE 2. PAY ITEM 21MWI CMSTRUCTACCESSROADIS FMTHE CONSTRUCTION M ANACCESS ROAD FROMHIGMEW ORNE TO THE REGKNW. TRAIL JUST EAST OF PIONEER TRAIL THE FOLLOWING ITEMS ME INCIDENTAL TO PAY REM 21M WI CONSTRUCT ACCESS ROM 7.1. UTILITY LOCATE AND AVINDANCE OF UxLITIES N VI "OF ACCESS ROAD 72 MY DESIGN NECESSARY FOR ACCESS ROAD 73. CLEARING AND GRUBBING PRIOR TO CONSTRUCTION M ACCESS ROAD OF NECESSVRYI TA. SALVAGING AND REINSTALLING ANY SIGNS IN CONFLICT WITH ACCESS ROAD. TL PROTECTION OR SALVAGING AND REINSTALLING EXISTING GUMORNL. T.B. STRIPPINGANO STOLKPWNG TOPSOIL UNDER FOOTPRINT M NAME OF NECESSARY) OU . T.T. REMOVAL OF BITUMINOUS PAVEMENT IIF NECESSARY). Tl WATER CONTROL . INCLUDING PIPES M PUMPS TO MNNTNN DRAINAGE THROUGH ACCESS ROAD DURING CONSTRUCTION. TB. IMPORT OF FILL TO CONSTRUCT ACCESS ROAD. 710, MAINTENANCE OF ACCESS ROAD WRING CONSTRUCTION. 7.11. REMOVAL OF TEMPORARY FILL FOR ACCESS ROAD. T12 REPAIR OR REPLACEMENT OF ANY BITUMINOUS PLACEMENT DA GED WRING CONSTRUCTION. 7.13. INSTALLING TOPSOL SEED, NA MULCH M EROSION CONTROL BLANKET TO RESTORE TO SEE CONSTRUCTION COROTICNS M BETTER TO THE SATISFACTION OF THE TRAFFIC SIGNS OTY MNOOT SIGN SIZE SIGN MESSAGE DWG. NO. 23101014.04 SIGN NO. FEE CLIENT PROJECT No. DWG. NP. REv. No 3 -1111 )"0'.36' R=L EO A B C 0 D 1 ] GIN 3 R2o-3P Is'a% RUL a05E0 AHEAD G-06• G07 TRAIL uMED 5 R11.2 bX16 G� t Gm ]�W•F] !FII .: •i + 9 boo pl ♦, A A. 'fAO MINNNESI;FA BLUFFS LRT REGIONAL TR:, . - 7 Y 1 ' ♦ i� RJMf J HALLA GREENS GOLF COURSEy RM �I r S I •'>OEi �y � U SITE ACCESS FROM S' 1 p♦• A ] OR DETAILED PLAN Air?, SEE L ` A 4.-z 4, ' % . . ` - t f� .• �♦ �' 0 1' fir. �' � ..Y, . IL s. y A C. p `6pit (• T CONSTRUCT L�FF aa a .144 A ' 9WIHREPM2ARFA ANTICIPATED RIGHT OF ENTRY. AMESS♦ ` • !� _ ! - C;, .ROUTE TO BE FINALIZED WITH PROPERTY -F 1 OWNER PRIOR TO CONSTRUCTION 1 MOON VALLEY Y- 11A/ Y \d � ♦� •'y+ AGGREGATE_I /y/_ /FyY�ilill'� 5• a'&.fes a .u— fill T , J 1 4, A ' • •I �R�♦ t r •may qww. - I �~ G PLAN: OVERALL ACCESS PLAN D 300 eeD N SONE N FEET +y ,y ll �jr 90% DESIGN NOT FOR CONSTRUCTION m�6 Wm .d6 A lure ® arta rwaso� mmmlwE "°F'°"" BARR ENGINEERING CO. BARR AJOIIMMK[TPOINTE DRIVE M NNEAPOLIS. MN 55035a `^�'•I'^° T, =an �*aooerz-n `° F^.I�I�Lm� ASBHONN lzl] 19 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN 23101014.04 FEE CLIENT PROJECT No. DWG. NP. REv. No MTP2- D.+.+N SITE ACCESS, STAGING, AND TRAFFIC CONTROL OVERALL PLAN AND NOTES R=L EO A B C 0 D 1 ] BMR G-04 D xo ev NK MP. DOTE REVISION DESCRIPTION wTF RmE. DATF RELEASED , MfP2 rSEL FENCE 1- � 1 -----, _--- ------ a u ------- _____ .ai i POTENOPL HSEMENT PREA IAPPRO% 173ACRE 3 EGRRA yr k v - TW— _ 3 —� ---- -- —=--- I a . 't . OWNER. BEPTRICE I.2 ERSDN IRREV. TRUST MOON VALLEY AGGREGATE 'I I 1 I fs I T G BEP i 1 TW— _ 3 —� ---- -- —=--- I a . 't . OWNER. BEPTRICE I.2 ERSDN IRREV. TRUST MOON VALLEY AGGREGATE 'I STE I 2 PLAN: SITE ACCESS & STAGING scuE IN EEEr 2 i • 4 J I li1B� ar. 90% DESIGN NOT FOR CONSTRUCTION — mm. N"'°°" BNw Er«;wEEwNc co. av°Muuo:-rRwNTE ORIVT: Sr1e 200 S 3 �awaysn '��"�""LANDSLIDE lml to HCRRA MINNEAPOLIS. MN 1�PLAN. SITE ACCESS & STAGING _ -' -' T G uTix R SITE ACCESS, STAGING, AND TRAFFIC CONTROLrnvc PLANS A B C D 0 1on BMRREVISION G-05 RID 3 RESTOPE ra LPER oaa+._olmLETo oEc sTPucro TM`c MTE RELEAR®a.2l�ffi, F —. o FPE P�PEEyLINEMPI ,Ei✓.no e.,uvo,,n. _3� .� _T.__ _ _ — Tur'---ir cons.:_':.. ". ��_. .zrl®'L• N!' �� __ 1 . �k�t ..c __ � „`--.'_�.�-+-�M� ✓^.�� _ - '- -_'� ----. \�u STE I 2 PLAN: SITE ACCESS & STAGING scuE IN EEEr 2 i • 4 J I li1B� ar. 90% DESIGN NOT FOR CONSTRUCTION — mm. N"'°°" BNw Er«;wEEwNc co. av°Muuo:-rRwNTE ORIVT: Sr1e 200 S 3 �awaysn '��"�""LANDSLIDE lml to HCRRA MINNEAPOLIS. MN REPAIRS231o1o1a.64 CHANHASSEN,MN uTix R SITE ACCESS, STAGING, AND TRAFFIC CONTROLrnvc PLANS A B C D 0 1on BMRREVISION G-05 RID DESCRIPTION TM`c MTE RELEAR®a.2l�ffi, MTP2 _ -MINNESOTA BLUFF LRT REGIONALTRAI 1T WT TEMPORARY WETlAN01MPACT 001 ACRES. SEE 2 ~ ,•4 1` t15� TRAILS ENO ROAD -, -----a 1. LENGTH CONSTRUCTION. LIMITS a v !( HCRRA PARCEL LINE(TYP.) ` BILE FENCE• SEE STABILIZED CONSTRUCTION EXIT, BEE m CLOSED '. y REBTORETRAILPERe UPON COMPLETION OF CONSTRUCTION� _ �•••. ,� Gas HCR ...a F ` TRAIL cwseo `1 G E%ISTINGGROUND EYJSTI NORTH WEfLANpIDITCH EXISTING TMII EXISTING BOUTX W£TIANp,DITCJ -------------------- TEMPORARY FILL REMOVE INBTALLMM"OT TYPE 5 GEOTEXTILE FABRIC PRN]R ATCOMPLETIONOF TO PLACING FILL IN WETOAND CONSTRUCTION REMOVE AT COMPLETION OF CONSTRUCTION RESTORE WETLAND AND DRCX AT COMPLETION OF CONSTRUCTION. INCLUDING INSTALLATION OF WETLAND SEED MIX TO DISTURBED AREAS AFTER REMOVING FILL AND GEOTEXTBE 2 DETAIL: TEMPORARY WETLAND/DITCH FILLING NOT TO SCALE r L \ EXISTING GRWNO � 1a TRAIL 20% REGRPDE SURFACE TO %iELONBTRUCTMMI CONDUNINSJ 3• THICK N' MINUS AGGREGATE / OF BETTER TO SATISFACTION OF ENGINEER SURFACING CLASS SPECIAL NOTES_ (SEE TABLE FOR GRADATION) I. 3'J MINUS ACA'AEAATE SURFACING SHIML SE 100% CRUSHED LIMESTONE. 3. WMINUSAG4REGATESURFALINGMUSTCDAEFROMKRAEMERMWWGS MATERIALS, INC OF SURNSVILLE MN., IN ORDER TO MATCH COLOR CF EXISTING TRAIL DETAIL: GRAVEL TRAIL RESTORATION TO.E TABLE 1 AS NECESSARY FOR EOUIPMENTACCESS .AhIA 191 RAIL CLOSED AXEAD - •. ,f .�.. f PLAN: SITE ACCESS 8 STAGING 0 10 50 i0° BCA3 IN FEET a 318' MINUS GRADATION FOR AGGREGATE SURFACING (CLASS SPECNL) BEVE SUE PERCEHTPASSING w 1W M A100 PO AW JOBS 10'40 PROTECT EXISTING Y.n FIRE HYDRANT rW WTLWLAI EMPOR Rt 00]ACRES. SE A \ 'Doll170 Ot Of Rs NOTES. OE OE �j�`�,y�`F✓ Q Y Q PREFERRED T CLEARANCE, 2 MIN. FORM TREES OR SITE ACCESS FROM HIGF F '.1► DRIVE - COORDINATE A( HCRRA WITH CITY OF EDEN PRA p- C ND AHENNEPIN COUNTY �FNTi�I. 1 AS NECESSARY FOR EOUIPMENTACCESS .AhIA 191 RAIL CLOSED AXEAD - •. ,f .�.. f PLAN: SITE ACCESS 8 STAGING 0 10 50 i0° BCA3 IN FEET a 318' MINUS GRADATION FOR AGGREGATE SURFACING (CLASS SPECNL) BEVE SUE PERCEHTPASSING w 1W M A100 PO AW JOBS 10'40 PROTECT EXISTING Y.n FIRE HYDRANT rW WTLWLAI EMPOR Rt 00]ACRES. SE A \ 'Doll170 Ot Of Rs NOTES. m 7WIDTHATMA%. H65LLPE ON SHWLOER Q 3A MAXIMUM SLOPE(H:V) OUTSIDE OF Z SHOULDER Q PREFERRED T CLEARANCE, 2 MIN. FORM TREES OR OTHER OBSTRUCTION. 14 SEE PLAN SLEETS FOR TRNL STRIPING. IF APPUICABLE ?j BOULEVARD VARIES W VII BUT SHOULD BE A MIN. OE ,OE OF Y, SIGN INSTOLIATXIN NOT MRICABLE IN P11 �$ I&UX GROSS 3%. MA%.CLEAR ® CE BETWEEN EDGE OF TRAk /JID NCE �RIMINTAG i EMIN DGED SIGN EDGE OF SIGN. MAWTAN11a VERTICAL CLEAR ZONE ABOVE TRAR. TRw TREE Is BRANDIES ACLORIDNGLY. I- B'TOPSDI (tYP.I 4 DETAIL: BITUMINOUS TRAIL RESTORATION NOT ro scALE T TYPE SP WEA]AOC BRUMINOUS PAVEMENT W CLASS S AGGREGATE BASE IT SCARIFY, DRY. AND RECOMPACT NApE SUBK MATERIAL AS DIRECTED BY OWNER OTE$ BITUMINOUS SHA1L BE PLACED IN ONE OFT. CLASS 5 AGGREGATE BASE SHALL CONFORM TO LfiWT SPEC. 3130. SUSGRADE SHALL BE TEST ROLLED PRIOR TO AGGREGATE BASE INSTALLATION AND CORI TO LMOOT SPEC. 3111. WHERE BCOLEVARD 1S t TO 3' (MM.1. BOULEVARD SHALL SE CONSTRUCTED FROM IMPERVB0US MATERIAL(IE. BITUMINOUS. CONCRETE. PAVERS. ETD. SPECIAL STRIPING IAYpR MAY APPLY. (SEE PLAN SHEETS). 90% DESIGN / PROTECTEXISTING ♦ LIFT STATION / XICN/NEW piNE LANDSLIDE REPAIRS ROW LINES OE OE ,OE BARR ENGINEERING 1L1'yN19 PgOTE IN EXISTING CULVERTS, DRCHOSED AGE �RIMINTAG i ACC THRWGH PROPOSED ACCESS � HEADS CONSTRUCTION 1 CO . p D� 1330 MAaaETPONTE DRIVE i Er L 'vACT - E z CHANHASSEN,MN DENT PaaEcr ra. �\ZZ T TYPE SP WEA]AOC BRUMINOUS PAVEMENT W CLASS S AGGREGATE BASE IT SCARIFY, DRY. AND RECOMPACT NApE SUBK MATERIAL AS DIRECTED BY OWNER OTE$ BITUMINOUS SHA1L BE PLACED IN ONE OFT. CLASS 5 AGGREGATE BASE SHALL CONFORM TO LfiWT SPEC. 3130. SUSGRADE SHALL BE TEST ROLLED PRIOR TO AGGREGATE BASE INSTALLATION AND CORI TO LMOOT SPEC. 3111. WHERE BCOLEVARD 1S t TO 3' (MM.1. BOULEVARD SHALL SE CONSTRUCTED FROM IMPERVB0US MATERIAL(IE. BITUMINOUS. CONCRETE. PAVERS. ETD. SPECIAL STRIPING IAYpR MAY APPLY. (SEE PLAN SHEETS). 90% DESIGN LANDSLIDE REPAIRS iwrled`auME* BARR ENGINEERING 1L1'yN19 2.31Bi Bi4-B� b CO . p D� 1330 MAaaETPONTE DRIVE HCRRA CHANHASSEN,MN DENT PaaEcr ra. M BARR su�N— waE _ -- MINNEAPOLIS. MN SSC]5 MTP3 MINNEAPOLIS, MN SITE ACCESS, STAGING, AND TRAFFIC CONTROL _ RELEASED A B C D 0 1 2 �P""Xi°�"` o..M.s BARq p1^'0 -No' REu NO - No. BY cHe Avv onre REVISION DESCRIPTION PLAN AND DETAILS G-06 p „�, TaFOR DATEREIEAR® REVISION R" D M O U U V TprWR GTE REtE5E0 0 ,00 1110 SCAtf N F)£f om4saoma. S� B/rRR ENGINEERING W. 4J MARrcErFp1NTE oRNE Suit" MINNEAFOUS. MN 55135 0�par LANDSLIDE REPAIRS HCRRA CHANHASSEN, MN MINNEAPOLIS, MN TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY 90% DESIGN )RCONSTRUCTIOA BARB PR0.IECT No. 23101014.04 z -- G -07 .G-07 - - • I I9-f Y• i J REVISION R" D M O U U V TprWR GTE REtE5E0 0 ,00 1110 SCAtf N F)£f om4saoma. S� B/rRR ENGINEERING W. 4J MARrcErFp1NTE oRNE Suit" MINNEAFOUS. MN 55135 0�par LANDSLIDE REPAIRS HCRRA CHANHASSEN, MN MINNEAPOLIS, MN TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY 90% DESIGN )RCONSTRUCTIOA BARB PR0.IECT No. 23101014.04 z -- G -07 .G-07 ,I/lt 1AV1V/ vV �>�/jlI/IIIA %�/� A\ \II♦_I -%!y/ 4 ° 00 90% DESIGN 9f1E"F�T NOT FOR CONSTRUCTION FTm'bHUAIOTIUTIWApAT — LANDSLIDE REPAIRS BARR231011�NP1.4 D PnOR>unlHe�MmO�,AxnoT� sATFn PaPmtA wt®,wE ENGINEERING CO 6300 MnRNETPOIN]E ONNE MMI NEAPJLIS. MN 55I35 �^+'•+^'� - - Imn.,l�xlm, �,�rr b,R HCRRA MINNEAPOLIS, MN CHANHASSEN. MN _ / / Ill //// // / / � \� • � _ / / / //✓/ I I I //j: \ \3- PROJECT LAYOUT PLAN _BUIL MOOIFlGTIONB \ N 1661 C80] / - 8EE811EETG07 _ IDwG G� REv D By NO. ev MTE REVISION DESCRIPTION -�—— _ _ — _ � -_ - _ - _C �- f \ / / 1 CONSTRUCTION LIMITS �, I \I POTENrIFL ACCESS ROUTE -- \ 1 ' NEW FENCE _ "STING FIBER OPTIC LINE -- 1 I OX UF FSSRT REGIONAL TRAIL a� , �.yB1065 N= - MINNESOTA BLUF-acBe7eS_&Ys- -. ST1 _ RR3 • • — _ _ - EXISTING FENCE _ FILL EXISTING NORTH PIPE r GRWi W WRH _ - _ N IN PLACE SH SEE �� l _ � y :T-'—=—"—' 3i _ � l /NEW STORM SEWER SEESHME/,SLOPE REPAID _ /^�� _ � ;. i \ �e1o�-�=. � _ _=- / � { SEE SHEET 19 9EESNEETGII /� / POTBmAL ACCESS ROUTE NEW DRNN4GE / / X1, r'f/ CHANNEL // / ///////1111REESIEETO13 \ `L[i/i///%// I/��//1////\\\\\11l�1I/! SOUTH AREA CULVERT OUTLET 1 I I I f ! f /III / ) a \\ I 1 \ \I 1 \ \\\\ MODIFICATIONS, I 111 I I I 1 / I / /•- \ \ 11111\I\ \\\\\\`\\\\\\ �� 1 / / CONSERVATION EASEMEN] \ ♦ 1�' / / ��� /:i J 1 11\�\\�����\\�\\\�; \ Sy /^//� ' /// 1\\\\1\l\�\ \\ \ \ \11\ /1 y COt81RUC1TDNLYTS - - / /// / / / '_♦ \\\ / / / __-_ - -- --_ -__-___-_____'_____ _____ / _ - '- - _-- __ �--_ --_-____ IIIr�� /1j11111 - \-�_�` PNEG81lE/ r _�--_ - ZWIERSON _1 '\ l - _ ------ y 1� _ _".II IRREV. TRUST � I \ � \�__- _ __ � � _� / / / _ 11 1 1 1.. '- . \ 1 \tee //� / �/. // / // / /// 11 111 l �/ 1 /iiit/ / I / //// / _//'/ / // \ 1 1 \ 1 1111/`/;1` i � 1 I\\\ � ♦ \� t /��' _�- i / // / /_�/ / /r// // / // _. � \ \111 \\\\ \\�\1' f / / �'/ _ r// // //I/ i;-��' / \ \ \ 1 \ (111111///!: 1 \��_� / / / ♦ / /' / / / ///// / / / /\ 1 \\\\ \ \1 \\�`,,, MDONVALLEY ��oi�, / / / • / ///i.:�/ \ 1 I \ \ \/ /I ILII �/ / / / I I 1 ! . 1` \\\ r ADDI>EGATE :I\\\\ i / / /-''f/ i ./I /// - /. \\\ 11111\\11N \i; 1�\''1, -OF ANTICIPATED EASEMENT NEEDS �ER REASON FOR EOLTLEASEMENT / ^'// /I///% 1 \ /^\ ♦ /rte \ ) 1 I 1 \ II) /''/ 1 _ _/�-/ ! I \ \ \�-_ \ \� ^��\\ \\ \ \\ \ / / /' / / 1 11 I I 1111 1111 MP0.APAi WU1H PIPE OUREr, STRFAMBANK 1R0.0.EV.lRUSi REPAIRS, DRAINAGECU NELMGINGAREA MOW MSIDESITEAccu �\ scum sloe vrt]snR I ' i �/i -__/ \ \ \=' \ \___•__ \��ti o��\\\\\I \\�_'��//Il\ \ _\ \��\l \\\\� 1\\ 1 \\\�l \\\\t \\��\\\\ \\ ♦\\\ 1 \\ I I II 11\I\ 1\\\\\\\1�\\ ___-_�_ _ '\__ \�- �� - ------------- --_-_-_`_ - 9HSIEETGII - _-� - I 1 \ - / / \-_ _ -�` SITE AGLE OSHVEM �� wIGW EW �>�/jlI/IIIA %�/� A\ \II♦_I -%!y/ �- f \ / / 1 CONSTRUCTION LIMITS �, I \I POTENrIFL ACCESS ROUTE -- \ 1 ' NEW FENCE _ "STING FIBER OPTIC LINE -- 1 I OX UF FSSRT REGIONAL TRAIL a� , �.yB1065 N= - MINNESOTA BLUF-acBe7eS_&Ys- -. ST1 _ RR3 • • — _ _ - EXISTING FENCE _ FILL EXISTING NORTH PIPE r GRWi W WRH _ - _ N IN PLACE SH SEE �� l _ � y :T-'—=—"—' 3i _ � l /NEW STORM SEWER SEESHME/,SLOPE REPAID _ /^�� _ � ;. i \ �e1o�-�=. � _ _=- / � { SEE SHEET 19 9EESNEETGII /� / POTBmAL ACCESS ROUTE NEW DRNN4GE / / X1, r'f/ CHANNEL // / ///////1111REESIEETO13 \ `L[i/i///%// I/��//1////\\\\\11l�1I/! SOUTH AREA CULVERT OUTLET 1 I I I f ! f /III / ) a \\ I 1 \ \I 1 \ \\\\ MODIFICATIONS, I 111 I I I 1 / I / /•- \ \ 11111\I\ \\\\\\`\\\\\\ �� 1 / / CONSERVATION EASEMEN] \ ♦ 1�' / / ��� /:i J 1 11\�\\�����\\�\\\�; \ Sy /^//� ' /// 1\\\\1\l\�\ \\ \ \ \11\ /1 y COt81RUC1TDNLYTS - - / /// / / / '_♦ \\\ / / / __-_ - -- --_ -__-___-_____'_____ _____ / _ - '- - _-- __ �--_ --_-____ IIIr�� /1j11111 - \-�_�` PNEG81lE/ r _�--_ - ZWIERSON _1 '\ l - _ ------ y 1� _ _".II IRREV. TRUST � I \ � \�__- _ __ � � _� / / / _ 11 1 1 1.. '- . \ 1 \tee //� / �/. // / // / /// 11 111 l �/ 1 /iiit/ / I / //// / _//'/ / // \ 1 1 \ 1 1111/`/;1` i � 1 I\\\ � ♦ \� t /��' _�- i / // / /_�/ / /r// // / // _. � \ \111 \\\\ \\�\1' f / / �'/ _ r// // //I/ i;-��' / \ \ \ 1 \ (111111///!: 1 \��_� / / / ♦ / /' / / / ///// / / / /\ 1 \\\\ \ \1 \\�`,,, MDONVALLEY ��oi�, / / / • / ///i.:�/ \ 1 I \ \ \/ /I ILII �/ / / / I I 1 ! . 1` \\\ r ADDI>EGATE :I\\\\ i / / /-''f/ i ./I /// - /. \\\ 11111\\11N \i; 1�\''1, -OF ANTICIPATED EASEMENT NEEDS �ER REASON FOR EOLTLEASEMENT / ^'// /I///% 1 \ /^\ ♦ /rte \ ) 1 I 1 \ II) /''/ 1 _ _/�-/ ! I \ \ \�-_ \ \� ^��\\ \\ \ \\ \ / / /' / / 1 11 I I 1111 1111 MP0.APAi WU1H PIPE OUREr, STRFAMBANK 1R0.0.EV.lRUSi REPAIRS, DRAINAGECU NELMGINGAREA MOW MSIDESITEAccu �\ scum sloe vrt]snR I ' i �/i -__/ \ \ \=' \ \___•__ \��ti o��\\\\\I \\�_'��//Il\ \ _\ \��\l \\\\� 1\\ 1 \\\�l \\\\t \\��\\\\ \\ ♦\\\ 1 \\ I I II 11\I\ 1\\\\\\\1�\\ ___-_�_ _ '\__ \�- �� - ------------- --_-_-_`_ - 9HSIEETGII - _-� - I 1 \ - / / \-_ _ -�` SITE AGLE OSHVEM �� wIGW EW �11 PLAN: PROJECT LAYOUT 4 ° 00 90% DESIGN 9f1E"F�T NOT FOR CONSTRUCTION FTm'bHUAIOTIUTIWApAT — LANDSLIDE REPAIRS BARR231011�NP1.4 D PnOR>unlHe�MmO�,AxnoT� sATFn PaPmtA wt®,wE ENGINEERING CO 6300 MnRNETPOIN]E ONNE MMI NEAPJLIS. MN 55I35 �^+'•+^'� - - Imn.,l�xlm, �,�rr b,R HCRRA MINNEAPOLIS, MN CHANHASSEN. MN .�BARR la... FA C;IENTPROJECTNI, RSM LITPl PROJECT LAYOUT PLAN REIEAS® A B C D 0 1 2.. d,P„ r+A� IDwG G� REv D By NO. ev MTE REVISION DESCRIPTION TO'FpY "Ia"° PATE RETE VRED MTPx I 1 - I 8T 1 X Ilf E%1B11NC CHAINLMI(FENCE _8p S 3. _ �_ '- -_ 8B5 _ \ v _ E%IB1W0 810�� 1111 EXISTING FIBER OPrIC GBIE l �ST-0\\ ��\1 _ _ 4U MPRO%Y\TE WDSILELMI3 _ __ _ - { \ 11 B00 / i/ / / — /,\lt�: W zz E%ISTING WET -IND 1. PARCEL LINE GYP �� - _ \ r � �____ii�i�'� _ ••\�\�. � RSLIMSLO� EROSION LIT /J ' CONSTRUCTION LIMITS L�-r- - NOILTN RPE LNOShf1G FROM HIGNVIE`/`I DRIVE —sem _3r ST 9 SSL ss s ss ss `sEXISTING STORM SE'NER kM TEMPORARY SCENE RIPRAP AREA / /o 1,,\ (SEE PHIPEUPSHEET CT2)T 1 �Jj (SEE PHOTOS 14. SHEET C-03) /, 1 Il / (SEE PHOTOS SHEET CA]) PZ 1 STd // /� ///f // / % �/ L ST, � IXI6TING STREAM THALWEG \ / ���� 1111 111 1111 llll 1I�1 ' \ CONSERvnnDN EA -HENT ` EXISTING STREAM E%TENT9 ''_' �, 5J / / /l 1 1 l\\\ \\\\\\\\ \ /i IBFATRICEI.2WIERSON-�C=s—= IRREV.7RUSTi' GENERAL NOTES: FEW ME IEW B,ICONTR CTOR,10XIMATE ANO SHALL eE FIELD VERIFIED BY CONTRACTOR, 'ilii // ,i/ ,'j I/ ///I/ �_/i'/////J \ \ 1\ 1 11 , x;111 ,/>ll\ t 1 I 1 \I\\\'\\\ \-\� /�'' -�' ice/ J/ / / �--/, % ///�-• - - ���i/i// /�/l/ i/iii/ iJ l� \\\\ 11 I 1 1 _ \/ - ✓II VIII `J 4 / / 1 \� 1��1 \IWNVALLEY `•� _� 'iJ/ , _//// /%%ii' i ,. \ 111 >�---__- __ r ._. f / l I 4.\\. ,_�_�\\\\♦ \\\\ \I /i l / -. /- I / /� '-_ //r. \4\ (aJ/ /i- \ \\_���-��¢\ i4 - / ! L`—�\I _ _�4 \ ♦\�D 1\\111\1 / i � __ "I/ IL - �-�_� / If v A _ v ♦ A A A 1 - .-_ _� �-'�/// 4�/G '� oo1 )AI 4•\/ -- _ A v v4• vw � 1\._ �--�'c' iAV A -____ -. Av A Av VA lA V AIVA tAAA vv vv AvvA v4 v v �_'' _ .. //ii.--��/fN/ii �`_i/ 4\ ♦4\\ \\\\ \-____5=_s�-%/% I\ \ \`♦ nom\ \\\\ \\\4 \\\\ \\\\\ \ \4\ � - " - - _ _ -_ ,. \\ .J\\?I l\ - �_ .L, Jam'___- �`- \.`. ,.1_. \\. .1\\ ♦:.\ \\\\\.U).�:�.\ �\:�\. \ _ GPLAN, EXISTING CONDITIONS 4 ° M 40 90% DESIGN NOT FOR CONSTRUCTION aENCIUEERIUG Lo. °•, lvtarmle LANDSLIDE REPAIRS 01014.04 p A p� um ETPOIUTE ORrvE HCRRA CHANFWSSEN. MN LDFRr PRo,IECT MP. DM-liiS MwNEAPous. MN BsassMrPz MINNEAPOLIS, MN A B C D B 1 2 "°�^�� ,N,a„nn P,+..a Es;;j CONDITIONS NO. By HK.APP DATE REVISION DESCRIPTION i1tEOIFOItm BATE RElF,A9® PI. .mr"'"'� a'N'NX.1 A..= -e Mm PLAN 1. D 8T 1 X Ilf E%1B11NC CHAINLMI(FENCE _8p S 3. _ �_ '- -_ 8B5 _ \ v _ E%IB1W0 810�� EXISTING FIBER OPrIC GBIE �ST-0\\ ��\1 _ _ 4U MPRO%Y\TE WDSILELMI3 _ __ _ - --_ \MSTING CONCRETE HEADWALL _ EXISTING WOODEN FENCE - MOOUTAR BLOCK RETAINING WALL \�ST-7 _(SEE PHOTOS 2A SHEET CL2) ��� R APPRO%IMATE LANDSLI°ESPoLflIE —) —sem _3r ST 9 SSL ss s ss ss `sEXISTING STORM SE'NER kM TEMPORARY SCENE RIPRAP AREA / /o 1,,\ (SEE PHIPEUPSHEET CT2)T 1 �Jj (SEE PHOTOS 14. SHEET C-03) /, 1 Il / (SEE PHOTOS SHEET CA]) PZ 1 STd // /� ///f // / % �/ L ST, � IXI6TING STREAM THALWEG \ / ���� 1111 111 1111 llll 1I�1 ' \ CONSERvnnDN EA -HENT ` EXISTING STREAM E%TENT9 ''_' �, 5J / / /l 1 1 l\\\ \\\\\\\\ \ /i IBFATRICEI.2WIERSON-�C=s—= IRREV.7RUSTi' GENERAL NOTES: FEW ME IEW B,ICONTR CTOR,10XIMATE ANO SHALL eE FIELD VERIFIED BY CONTRACTOR, 'ilii // ,i/ ,'j I/ ///I/ �_/i'/////J \ \ 1\ 1 11 , x;111 ,/>ll\ t 1 I 1 \I\\\'\\\ \-\� /�'' -�' ice/ J/ / / �--/, % ///�-• - - ���i/i// /�/l/ i/iii/ iJ l� \\\\ 11 I 1 1 _ \/ - ✓II VIII `J 4 / / 1 \� 1��1 \IWNVALLEY `•� _� 'iJ/ , _//// /%%ii' i ,. \ 111 >�---__- __ r ._. f / l I 4.\\. ,_�_�\\\\♦ \\\\ \I /i l / -. /- I / /� '-_ //r. \4\ (aJ/ /i- \ \\_���-��¢\ i4 - / ! L`—�\I _ _�4 \ ♦\�D 1\\111\1 / i � __ "I/ IL - �-�_� / If v A _ v ♦ A A A 1 - .-_ _� �-'�/// 4�/G '� oo1 )AI 4•\/ -- _ A v v4• vw � 1\._ �--�'c' iAV A -____ -. Av A Av VA lA V AIVA tAAA vv vv AvvA v4 v v �_'' _ .. //ii.--��/fN/ii �`_i/ 4\ ♦4\\ \\\\ \-____5=_s�-%/% I\ \ \`♦ nom\ \\\\ \\\4 \\\\ \\\\\ \ \4\ � - " - - _ _ -_ ,. \\ .J\\?I l\ - �_ .L, Jam'___- �`- \.`. ,.1_. \\. .1\\ ♦:.\ \\\\\.U).�:�.\ �\:�\. \ _ GPLAN, EXISTING CONDITIONS 4 ° M 40 90% DESIGN NOT FOR CONSTRUCTION aENCIUEERIUG Lo. °•, lvtarmle LANDSLIDE REPAIRS 01014.04 p A p� um ETPOIUTE ORrvE HCRRA CHANFWSSEN. MN LDFRr PRo,IECT MP. DM-liiS MwNEAPous. MN BsassMrPz MINNEAPOLIS, MN A B C D B 1 2 "°�^�� ,N,a„nn P,+..a Es;;j CONDITIONS NO. By HK.APP DATE REVISION DESCRIPTION i1tEOIFOItm BATE RElF,A9® PI. .mr"'"'� a'N'NX.1 A..= -e Mm PLAN 1. D PHOTO 1: EXISTING SOUTH (LOOKING C PHOTO 3: EXISTING SOUTH PIPE OUTLET (10/29/2019) PHOT04: EXISTING SOUTH PIPE OUTLET (10/29/2019) PHOTO 5: EXISTING NORTH PIPE DOWNSTREAM OUTLET 90% DESIGN NOT FOR CONSTRUCTION �n.Mv[o�'wR aCP - p,pupnm /S SIgMI LANDSLIDE REPAIRS BMRPROJECT Ib. 23101014.04 F ,,.._ — — — — — — Bi1RR ENGINEERING CA. .,, MAaaETFOINrE GarvE �}Z s�xao NwNE4PGLls, rvry ssa3s �d n.nn `1'g""'-�' rrt 1]H3lA1B HCRRA MINNEAPOLIS, MN CHANHASSEN, MN — — — — — — — ,,.., EPF Cl1ENT MOJECT No. — — — — — — — o.m, N,Pz EXISTING CONDITIONS PHOTOS aEIE�ISEfl A B C D 0 1 z me., Buw Grit W C-02 aEv D No. Br MTE REVISION DESCRIPTION ToroR MTE aHFA8E0 �momm, / - y_ __-- �s\�V�_--�/_h+ /I ////1i/ ---_ i. �\� \ !�_ / -♦ 1 111 IIl ll I r - _-_-- -___ _---___ - - , (r _---- %/// --- —_--__ - ___- III 1111 X111 lI//'//' _- _ _- #� - o--- `. ,// r /i/%i�iii ii///'i/J \ �\ ) ♦_,Y+/�_- _�-� � `'\\ - �-�-__ � i/ii- 'J ��_�_�� �\ /�/ lJl \ \ l I r ' // � v _ ___ � / J. / // j/ /i / p /+� ♦n -_�-_ � � _ _ \ _ � _&b � -� -/ /,/' _moi/` /' / / ! /// i / _. 1\11 I J'�/ _ \ �/--5�- !:'iii/ AAAA ///! /�f/n t 1 /i• 1111 `//�, �i\\�\ _ --_>BO _ - —� _ice,=-__- y0\ �� \l l <�\ \ °\ `II ///' AAAA �/' / / r/ SIN _a-.___�_ ,G_ � -'_ /iG/rri////ll/r/111 :Til 11/ /ii `\ \11 \\//�-fPo:\+\ - _'-��53 ��_ �—�6'P�f l � � t 1 \ .-0\\ / / ir'///i /'✓/�/' dRy�= �i'i%�S<l-'B81?'20 \�`\ \ \\-��� -�--_ _ ��_.. ///Gr///�/iv//1/!/11ir11iAhir�r/-' '' /// r/// /' f!✓fr y> jr%•/,//i11/////p(�\r/iJjl` 1 U\/1I/!1( / 1ii� ?_ . tom`/ _%='i-:�,/i i/ 'i_ '///ir// /if//,r/Ji//m /: �P=ROPB.gI0Ie\>'7L0\NQ/Ed. '(oT�=Y\P- .) {p /hvam-_=�___� __ c _ --_o____]_1_�0\ 0; �_/ �/°-_=�a=�--__. /_' ._ .O'- _�_ ` =�-_\c_-1 �l ! /- ''-_�\.\i\ _\ t `: Q I/ /q1I. \ lX!1`1\/1\\11\ / / 1i�,f �rI��1,. ��\``_ N\�l1i11_/'/—'// ///��////,��,�//i �lcf/ //,,/'��;l� ii _ / / \\ t ISFXISIING \ illIl/ I p`�BfU�\ _ _ ((!/ ./f / _ _i\\I1(\\ I/mr/� _ ___ ~ �\ Ary \['J'�/ SITE ACCESS FROM HIGHVIEW DRIVE 1 \`\ - EE \ _ _ I I / / / /1/ // % //! \ / <• \\ ` '-; I // %/ U .ALS - -... REMOVE EXISTING WOODEN FTE ENCE ' � � i � _ _ \ ` PROCT - IXISTING BEACH ANO PLACE IN -. i - -�/ < _ - - __ -11E f,AAVEL PARNMG LOTAO.NCENi TO / J BENCHES AWAYAWAY.IRGT3TAFF MINNESOTA BLDFF - <a - _ - _ _ _ — —• B - _ SIRTREGIONAL TRAIL _ REMOVE E%POSEOPORTI OFNORTHPIPE. SFEGI I l .REMOVE EXISTING MODULM / / _ BLocK gEruraxG -_+ - _ •- - • • f`��. 1 `F ILL -EASTING NORTH MOM LIMITS -• � - _ SEE 8 PIK MP TE UNOSLIDE � \ G1 &] _ / W \REMOVE EXISTING SILT FENCE (TVP) Al CONCRETE HEADWALL SEE I - f I EROSIONC 01-IPGEND /SALVAGEANDSTOCKPILE- / EXISTING RIPRAP FOR REUSE CONSTRUCTION UMRS _Sli EMOGATES SEDIMENT LOGS SWAGE E%ISPNGND PLACE IN THE PMXl %.3N6LFINIDP TO IN TMEEEK DR. PLS d SILT FENCE PAflIBNGLOTT STAFF TLL BLUFF GREEK Ofl. \\>MSTRICT STAFF WILL HMIL AWAY � \\ V 1 / / �� CONSTRUCTION ENIMNCE CONSERVATION EASEMENT '\ \\\ \ - - ExlsngcmWNTara t A AV CONSTRUCTION LIMITS s - - IXISTNGYCONTOUR PIEZDVENIDOI6POSEE%IS -_0METEHS PEO ENGINEER5 OIRECTN]N I/ - CONSTRUCFW STAGINGARIEfi, _�_1_ _/ {�f' _ J/i, / ///! / / \\ EROBIONd SEOIMEMCONTROL NOTES: i.�J / %I Illl /W/ `\ _ _ __� OI�Jf/' !/ii/ 111/ // i. TEMPORMILY UNDERGONE FINAL STABILIVE MEASIN WHICH GRADING OR SITE / t/ / I \ F I 1 1` >\\'�--_ _ �= _ -�%// ' '! /! /i%''/ \ 1. INSTALL PERIMETER EROSION CONTROL ATTXE LOCATIONS SHOWN ON THE PIRSS PRIOR TO f 1 1 11 / /, / , l /// ' CONSTRUCTION FINAL E RA IONS ARE NOT ACTIVELY MDER FA AGAIN T EROSION ROSIh N DU 1 /J / ! //1 I \\ \_-��\ - -- - ' / •' THE COMMENCEMENTOFMf(tAND OIBTURBANLE OR CONSTRUCTION ACTNITE3. r//! /i/ I / 1\\ \ "- !J^� = - __ / ,/f CONSTRUCTION OPEPA➢ONS ARE NOT pCTNELY UNDERWAY AGAINST ERO310NOVETO MIN. '// 2. ENTRANCBEFORE E INNINGAT PCONSTRUCTION.INWHEREINSTES MIT THE ROCKCONSin PRION WIND AND RUNNING WATER. STABILIZATION TO BEGIN IMMEDIATELY AND BE COMPLETED //'\ ` I /� < 1\ 1 _ \ __%4 _-=-/,-i�)/, ENTRANCE AT EALX POINT WHERE VEHICLES EXIT THE CONSTRIILTION SITE PRIOR TO WITMINIADAYS. USE SEED AND MULCH, EROSION CONTROL WOLOING, ANI SOCKNAK O IJ �_ 1/ // /•.•/i/ // // \\ t Ij\ _ J //l 'AAAA COMMENCING ANY CLEARINGIGRUBBING,REMOVAL. OR EARTXWORK ACTIVITIES, USE 2 INCH / /r / 'l \ \ 1 %" 1\� '� // / ' OR GREATER DIAMETER ROCK IN A LAYER AT LEAST 6 INCHES THICK ACROSS THE ENTIRE STAKING IN GREEN SPACE AREAS. REMOVE ALL TEMPORARY SYNTHETIC STRUCTURAL. 1111 \ t \ ` \ 1 /- �// / / WIDTH OF THE ENTRANCE. EMENDTHEROLKENTMNCEATLEASTWFEETINTOTHE NOBIODEGMDABLE EROSION AND SEDIMENT CONTROL DEVICES AFTER THE SITE HAS NL �/ , / • I j _ \ \ / / / �! // / / r _/ / CONSTRUCTION ZONE USING UNDERGONE FINAL STABHUV TION AR H PERMMEM VEGETAMN ESTABLISHMENT, FNN. 0.TEXTILE FABRIC BENEATH THE AGGREGATE TO PREVENT 6TABILIUTON FOR PURPOSES OF THIS REMOVAL IS 70% ESTABLISHED COVER OVER MIGRATION OF 601LIMO THE ROCK FROM BELOW 1. DENUDED AREA. REMOVE ALL SOILS AND SEDIMENTS TRACKED OR OTHERWSE DEPOSITED ONTO PUBLIC AND B. CHANGES TO APPROVED ERO.SpN CONTROL PLAN MUST BE APPROVED BY FIRE ENGINEER p q PgNATE PAVEMENT ggEgS, ATA MINIMUM flEMOVAL SHALLBE ONCE JULY. SWEEPING SXALI PRIOR TO IMPLEMENTATION. CONTRACTOR TO PROVIDE INSTALIAnON AND DETMLS FOR ALL / '\] {) 1 / } I I / 1t o/Y/I' / I S 1 \ lam\ \�-� \\\\\\\\11 / BE MAINTAINED THROUGHOUT THE DURATION OF THE CONSTRUCTION AND DONE IN A MMNER If 11 , / 1 l l 1 y+{i �, +`,1+1 I PROPOSED ALTERNATE TYPE DEVICES. -_\ TO PREVENT DUST BEING BLOWN TO ADJACENT PROPERTIES, 1 ��\ f \ 9. IF DEWATERING DR PUMPING OF WATER IS NECESSARY. THE COV.kCTOR IS RESPONSIBLE 1 ♦. INSTALL INLET PROTECTION AT ALL PUBLIC AND PRIVATE CATCH BASIN INLETS WHICH RECEIVE log '/' / RUNOFFFROATHEDISTURSEDAREAS. CONTMCTORSHALLCIEANREMOVESEDIMENT.OR WATER FFOR ROM THE Si NECESSARY HE DISCHARGE HARS AROM EDEW TERING RTODISING PROLE ANY DEVICES A ROUTINE WATER FROM SIFTENTI-A HARGEFRR IT MUST BE TREATEDftPUMPIN TILEUE OF -'/ '' �'- S IS REPLACE REFULLRAININLET PROTECTIONFORHEXTRIO EVENT SEDIMENT THAT THE TURBIDNT RIMS. VGETAITEVITER WATER OR MUST BETREATEDTHROUGH TILEUSE -� /�� i �i�i' DEVICES ARTFULLY NINAGE YFOOTHE IS THE RESPONSIBILITY NEVEV SEDIMEV CONTRACTOR NTRA T IN t`_\\q \ MDDN VALLEY � ` � SEDIMENT TRIMS. VEGETATIVE FILTER STRIPS, OR OTHEfl SEDIMENT REDUCING MHSURES i �� / j//_`\\\ \\\\\\\�\ce �-/ ILII �_-_/ \\``'\\\\�\�\�\\\C MOSORFIL GINGBRICWR3YSTEM5LE MENTALLOWEDOFTHEET PROTECTIONSUCH THAT THE DISCHARGE ONTRONOT VISIBLY DIFFERENT FROM THE THERECEIVING DICHARGEEq. �' / J &LATE SFILTER FABRIC WRAPPED GRATES ARE NOT ALLOWED FORT PUBLIC OR PRWN. ��� /!(%��- _ l l{ \O__ -�` \\h •\�\ \\\\ \\O \\\ \ \\ \ 6. LOCATE SOL OR DIRT STOCKPILES NO LESS TRAIN 25 FEET FROM MYPUBLOOR PRIVATE PREVENTS OUR EROSK)N ME/SUflES MAY BE REWIRED AT THE 015CHARC£POIV TO _ - T / `\ O\, ` (/ /\�\� \� ! �l\\ \\il\\\\\\ \\ \.� PREVENT SCWREROSON. \\11\\\\ \\ \\ \\\\ \\ ` ROADWAY Ofl OgAIMGE fi4WNEL. IF REMVNING FOR MORE THM SEVEN DAYS.STABILIZE ID, INSTALL SEED. EROSION CONTROL BLANKET. MULCH, AND OTHER REVETMENT IN \\ THE STOCIOILES BY MULCHING VEGETATIVE COV ER TARPS, OR OTHER MEANS. CONTRO EROSION FROM ALL STOCKPILES BY PLACING SILT BARRIERS MOUND THE PILES. BOTH COANLEV/ITR AND NINEER SAUL KEEP A LOGANDF AL "' - , \ �• \ �\ ���= _ _ �_=\\�-- \i \\\ 1)11 \ \\\ \\\\\ \\�\� � 1L BOM CONIFNCTOR AND ENGINEER SXNL KEEPALOG OF ALL TREES GNE.UFA INANa \ / -_�- t ���\)/\ l \\\ \\\\ 6. MAINTAIN ALL TEMPORARY EROSION AND SEDIMENT CONTROL DEVOEB IN PLACE UNIILTXE DIAMETER AT BREAST HEIGHT REMOVED DURING CONSTRUCTION. SEESHEETRMFORTREE CONTRIBUTING DR.VNAGE AREA HAS BEEN STABILUED. INSPECT TEMPORARY EROSION AND gEPLACEMEM REQUIREMENTS. 1 • �\ / ' - \ `�_ �_� \\\ \ \ \ \\\\\ SEDIMENTCONTROL DEVICES ON A MLTB Y BASIS REPT DETEORATED. DAMAGED. OR ROTTED EROSION CONTROL DEVICES a.E1EUTATELY. 1Q PLAN: REMOVALS AND TEMPORARY EROSION CONTROL - D W Hat . .scue NFEET �" 90% DESIGN NOT FOR CONSTRUCTION __._......_..._. _ _.__ o Iw�- - �T"�•+ MMAIAYtA' MITA NAE — .—_1 RELEASED j A a C D o t i "�`°°"" �p BMRENGINEERINO CO. D � A9COZE-IE ENNTE OVVE D Summo MINNEAPOLIS. MNSSaS` �P-+X-+-� .b.s„ N„ �•�pOH`�� F^°'�1.1.1 PI.Iem�-a„ —m„ 1!/1yN19 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN, MN 28NUNDN.04 EPF CLIENT PROTECT No, - AIOI REMOVALS AND TEMPORARY EROSION CONTROL PLAN R'+IF-a BARR D NO. BY DATE REVISIONDEWRI"- l GATE RELEASED MH DOWNSTREAM VIEW SECTION VIEW NOTEb'. 1. SILT FENCE SHALL BE INSTALLED PRIOR TO ANY GRADING OING WORK IN THE AREA TO BE PROTECTED AND SHABE MAINTAINED THROUGHOUT THE CONSTRUCTION PERIOD. SILT FENCE AND ANY ACCUMUUTED SEDIMENT BHALL BE REMOVED IN CONJUNCTION WRH THE FINK GRADING AND SITE STABILUATON. 2. SILT FENCE INSTALLATION AND MATERIALS SHALL MEET THE REQUIREMENTS OF WUDOT SPECIFICATIONS 2573 AND 3986. 3. NOIK%ES OR GAPSSWYI BE PRESENT IW11N0ER SILTFENCE. PREPARE pgEAgS NEEOEDTO SMOOT"SURFACE OR REMOVE DEBRIS. 4. WHEN SEDIMENT BUILD UP REACHES IG OF FENCE HEIGHT, THE SILT FENCE SHOULD BE REMOVED OR A SECOND SILT FENCE INSTALLED UPSTREAM OF THE EXISTING FENCE ATA WRABLE DISTANCE. 5. WHEN SPLICES ARE NECESSARY MAKE SRICE AT POST ACCORDING TO SPLICE DETAIL. PLACE THE END POST OF THE SECOND FENCE INSIDE THE END POST OF THE FIRST FENCE. ROTATE BOTH POSTS TOGETHER AT LEAST IM DEGREES TO CREATE AFIGHT SEK WITH THE FABRIC MATERIAL LLT THE FABRIC NEAR THE BOTTOM OF THE POSTS TO ACCOMMODATE THE 61NCH FIFA. THEN DRIVE BO TH POSTS AND BURY THE FIM. COMPACT BACKFRL. T DETAIL: SILT FENCE - MACHINE SLICED Norro SCALE cURB STAI(E END$(TYPI STGRM GRI -.1 SEDIMENT L__ PLAN VIEW SIDE VIEW ON SLOPE WOOD STAKE SEDIMENT LOG WOOD STAKE TO ONLY ( PENETRATE NETTING U SIDE VIEW FLAT 12' MINIMUM L OVEIMPENDS WOOD) STNS FRONT VIEW TOP VIEW HOME L IxsrALL SEDIMENT LOG KORA CONTWRS ICOxSTANT ELEVATxND. 2. NOGMSSHALLREPRESENTUNDERSEDIMENTLOG. PREPAREMEAASNEEDEOTO SMOOTH SURFACE ON REMOVE DEBRIS. 3. MMOVEACCUMUI MOMDIMEMWHENREACHING150FLOGHEIGHT. 4. MAINTAIN SEOBENT LOG THNOI1GMg1fl THE CONSTRUCItON PERgO AND RE➢AB1 aR REPLACED M REQUIRED 3 DETAIL: EROSION LOG - STAKING STAKE END(TYP)� CURB SEDIMENT LOG _ NOTED $OKE SECTION VIEW NOTES I. INLET PROTECTION SHALL BE INSTALLED PRIOR TO MY GRADING WORK IN THE MEA TO BE PROTECTED TOR H IMMEDIATELY FOLLOWING CATCHBASIN INSTALLATION. AND SHALL BE MNMAINFD THROUGHOR THE COMBIRUCTNNI PERM 2. MATERIALS SHALL BE SUFFICIENT TO ALLOW FLOW WHILE BLOOMS SEDIMENT. NO RULES O3 GAPS SHALL BE PRESENT NWImER SEDIMENT LOG. 3. INLET PROTECTION SHALL BE CLEANED 7S REQUIRED. 4, MATERIALS AND MY ACCUMUIATED SEDIMENT SHALL BE REMOVED IN CONJUNCTIONWITH THE FINAL GRADING AND SITE STMILWTON. \ DETAIL: INLET PROTECTION - SEDIMENT LOG \- / HOT TO SCALE F%P/JlU FO1 NRNING �' RADIUS AS REOHRFD (EMINIMUM GEOTEXDLE FABRIC (OPTIONAL) - I' T WASHED ROCK NOTES' 1. MNNTAIN ENTRANCE THROUGHOUT THE CONSTRUCTION PERIOD MD REPAIROR REPLACE AS REQUIRED TO PREVENT TRACKING MRSTE 2. REMOVE ENTRANCE IN CONJUNCTION WITH FINAL GRADING AND SIZE STABILIUTKKN. 4 DETAIL: STABILIZED CONSTRUCTION EXIT NDrroSCALE SLOPE INSTALL TION NOTEr: �, o 1. REFERTO MANUFACTURER RECOMMENDATIONS FOR STAPLE PATTERNS FOR SLOPE INSTKIFNE MS 2. PWPMEMLBYLQUSENINGTOPI2MCHESMDA YSEM(MDFE Ml0. WHEREREOUIRED) PWOR TOINSTALLING BLANKETS. GRONND BHDULD BE SMOOTH AND FREE OF DEBRIS. 3, KGN(A)ATTNETOPOFTHEBLO MDR LTNEBLV11 MOW M(B)ATCNEMN THE SLOPE AND ROLL THE BLANKETS HO UDONTALLY ACROSS THE SLOPE. 4. THE EDGES OF PARALLEL BUNKETS MUST SE STAPLED WIT" APPROXIMATELY W OVERLAP. WITH THE UPHILL BLANKET ON TOP, 5- WHEN BIA M MUST SE SPLICED DOWN THE SLOPE, PLACE BLANK£IS END OVER END (SHINGLE s:YlElwrtH APPRotlAUTELV B'OVERLM. STA MRWGHOJERIMPEDAREAAPPRWIMATELY IT MMT. B BI.MMETMATERNL9 SHALL SEM SPECIFIED OR IS APPROVED BY ENGINEER. 5 DETAIL: EROSION CONTROL BLANKET- INSTALLATION NOTTOSLKf TEMPORARY EROSION CONTROL SEEDING NOTES. I. CWTPACTOR SHALL PERFORM TEMMSAW SEEDING IN ADOPTION TO TEMPORARY MULCHING ON GRADEDNISTURBED AREAS WHEN ME SITE IS TO BE LEFT IDLE FOR LONGER THAN 21 DAYS IN ACCORDANCE WITH WOOF STANDARD SPECIFICATIONS SECTION M75.38.1. USE COVER CROP MO MID-TERM STAIMTKTNM MED MIXLWES AS SHOWN IN WYE. SEED. TABLE 38761 FOR TEMPORARY SEEDING 2, PERFORM TEMPORARY MULCHING TO PROTECT THE SITE FROM EROSION MEN LIFTIDIE FOR MORE THAN ME WEEK AND WRING NONSEEONG PERIODS AND WHEN OUTSIDE THE SEEDING MD WOOING GATES. FOR AREAS LESS THAN TWO ACRES, MULCH IN ACCORDANCE WITH MMOT STANDARD SPECIFICATIONS RECTION 25753 M,' 11)STMBIADCM Me DESIGN NOTFORCONSTRUC77ON — 5 FT. MIN. LENGTH POST SEDIMENTLOG LANDSLIDE REPAIRS 23187014.04 RraenrlELx1367� NAT[tX A H,N1.n,,,,E AT 4FT. MAX. SPACING BARN ENGINEERING fA. aim MANNETPeXNTE DNNE D� N,�� � MINNEAPDLI5. Mx 38L38 F6.� � I o3=7—,w 12ITyA10 WOODSTN(E CHANHASSEN, MN PLASTIC LP TIES (MIN. W L&S SEDIMENT LOG 0.1EM PROJECT No. Mdy Ala TEMPORARYEROSIONCONTROL MACHINE SLICED SILT FENCE MR MW00T STD. TENSILE STRENGTH)CN TCP I 2 A 8DATE BONN - may. NP. D 41 MAX, SPECIFEC,2573095, INSTALL MR MHNOT 8'MM.J PER PoBT WOOD STAKE TO ONLY ANETTING.GEDMKFIE T�D)a� aELFABm Aw bTD. SPEC, 2573 'STAKEO FABRIC, W MIN. ONLYFLOW ENETRATE�rnNcMACMNE SUCE V TO IT FLS, EPTH (RU06 FLAP)GRAPERUNOR 4PENETRATE FLOW DIRECTIONMACHI i 3 O4Y pB I DIEPTH Ptus Ir FLAP) ^E DOWNSTREAM VIEW SECTION VIEW NOTEb'. 1. SILT FENCE SHALL BE INSTALLED PRIOR TO ANY GRADING OING WORK IN THE AREA TO BE PROTECTED AND SHABE MAINTAINED THROUGHOUT THE CONSTRUCTION PERIOD. SILT FENCE AND ANY ACCUMUUTED SEDIMENT BHALL BE REMOVED IN CONJUNCTION WRH THE FINK GRADING AND SITE STABILUATON. 2. SILT FENCE INSTALLATION AND MATERIALS SHALL MEET THE REQUIREMENTS OF WUDOT SPECIFICATIONS 2573 AND 3986. 3. NOIK%ES OR GAPSSWYI BE PRESENT IW11N0ER SILTFENCE. PREPARE pgEAgS NEEOEDTO SMOOT"SURFACE OR REMOVE DEBRIS. 4. WHEN SEDIMENT BUILD UP REACHES IG OF FENCE HEIGHT, THE SILT FENCE SHOULD BE REMOVED OR A SECOND SILT FENCE INSTALLED UPSTREAM OF THE EXISTING FENCE ATA WRABLE DISTANCE. 5. WHEN SPLICES ARE NECESSARY MAKE SRICE AT POST ACCORDING TO SPLICE DETAIL. PLACE THE END POST OF THE SECOND FENCE INSIDE THE END POST OF THE FIRST FENCE. ROTATE BOTH POSTS TOGETHER AT LEAST IM DEGREES TO CREATE AFIGHT SEK WITH THE FABRIC MATERIAL LLT THE FABRIC NEAR THE BOTTOM OF THE POSTS TO ACCOMMODATE THE 61NCH FIFA. THEN DRIVE BO TH POSTS AND BURY THE FIM. COMPACT BACKFRL. T DETAIL: SILT FENCE - MACHINE SLICED Norro SCALE cURB STAI(E END$(TYPI STGRM GRI -.1 SEDIMENT L__ PLAN VIEW SIDE VIEW ON SLOPE WOOD STAKE SEDIMENT LOG WOOD STAKE TO ONLY ( PENETRATE NETTING U SIDE VIEW FLAT 12' MINIMUM L OVEIMPENDS WOOD) STNS FRONT VIEW TOP VIEW HOME L IxsrALL SEDIMENT LOG KORA CONTWRS ICOxSTANT ELEVATxND. 2. NOGMSSHALLREPRESENTUNDERSEDIMENTLOG. PREPAREMEAASNEEDEOTO SMOOTH SURFACE ON REMOVE DEBRIS. 3. MMOVEACCUMUI MOMDIMEMWHENREACHING150FLOGHEIGHT. 4. MAINTAIN SEOBENT LOG THNOI1GMg1fl THE CONSTRUCItON PERgO AND RE➢AB1 aR REPLACED M REQUIRED 3 DETAIL: EROSION LOG - STAKING STAKE END(TYP)� CURB SEDIMENT LOG _ NOTED $OKE SECTION VIEW NOTES I. INLET PROTECTION SHALL BE INSTALLED PRIOR TO MY GRADING WORK IN THE MEA TO BE PROTECTED TOR H IMMEDIATELY FOLLOWING CATCHBASIN INSTALLATION. AND SHALL BE MNMAINFD THROUGHOR THE COMBIRUCTNNI PERM 2. MATERIALS SHALL BE SUFFICIENT TO ALLOW FLOW WHILE BLOOMS SEDIMENT. NO RULES O3 GAPS SHALL BE PRESENT NWImER SEDIMENT LOG. 3. INLET PROTECTION SHALL BE CLEANED 7S REQUIRED. 4, MATERIALS AND MY ACCUMUIATED SEDIMENT SHALL BE REMOVED IN CONJUNCTIONWITH THE FINAL GRADING AND SITE STMILWTON. \ DETAIL: INLET PROTECTION - SEDIMENT LOG \- / HOT TO SCALE F%P/JlU FO1 NRNING �' RADIUS AS REOHRFD (EMINIMUM GEOTEXDLE FABRIC (OPTIONAL) - I' T WASHED ROCK NOTES' 1. MNNTAIN ENTRANCE THROUGHOUT THE CONSTRUCTION PERIOD MD REPAIROR REPLACE AS REQUIRED TO PREVENT TRACKING MRSTE 2. REMOVE ENTRANCE IN CONJUNCTION WITH FINAL GRADING AND SIZE STABILIUTKKN. 4 DETAIL: STABILIZED CONSTRUCTION EXIT NDrroSCALE SLOPE INSTALL TION NOTEr: �, o 1. REFERTO MANUFACTURER RECOMMENDATIONS FOR STAPLE PATTERNS FOR SLOPE INSTKIFNE MS 2. PWPMEMLBYLQUSENINGTOPI2MCHESMDA YSEM(MDFE Ml0. WHEREREOUIRED) PWOR TOINSTALLING BLANKETS. GRONND BHDULD BE SMOOTH AND FREE OF DEBRIS. 3, KGN(A)ATTNETOPOFTHEBLO MDR LTNEBLV11 MOW M(B)ATCNEMN THE SLOPE AND ROLL THE BLANKETS HO UDONTALLY ACROSS THE SLOPE. 4. THE EDGES OF PARALLEL BUNKETS MUST SE STAPLED WIT" APPROXIMATELY W OVERLAP. WITH THE UPHILL BLANKET ON TOP, 5- WHEN BIA M MUST SE SPLICED DOWN THE SLOPE, PLACE BLANK£IS END OVER END (SHINGLE s:YlElwrtH APPRotlAUTELV B'OVERLM. STA MRWGHOJERIMPEDAREAAPPRWIMATELY IT MMT. B BI.MMETMATERNL9 SHALL SEM SPECIFIED OR IS APPROVED BY ENGINEER. 5 DETAIL: EROSION CONTROL BLANKET- INSTALLATION NOTTOSLKf TEMPORARY EROSION CONTROL SEEDING NOTES. I. CWTPACTOR SHALL PERFORM TEMMSAW SEEDING IN ADOPTION TO TEMPORARY MULCHING ON GRADEDNISTURBED AREAS WHEN ME SITE IS TO BE LEFT IDLE FOR LONGER THAN 21 DAYS IN ACCORDANCE WITH WOOF STANDARD SPECIFICATIONS SECTION M75.38.1. USE COVER CROP MO MID-TERM STAIMTKTNM MED MIXLWES AS SHOWN IN WYE. SEED. TABLE 38761 FOR TEMPORARY SEEDING 2, PERFORM TEMPORARY MULCHING TO PROTECT THE SITE FROM EROSION MEN LIFTIDIE FOR MORE THAN ME WEEK AND WRING NONSEEONG PERIODS AND WHEN OUTSIDE THE SEEDING MD WOOING GATES. FOR AREAS LESS THAN TWO ACRES, MULCH IN ACCORDANCE WITH MMOT STANDARD SPECIFICATIONS RECTION 25753 M,' 11)STMBIADCM Me DESIGN NOTFORCONSTRUC77ON — LANDSLIDE REPAIRS 23187014.04 RraenrlELx1367� NAT[tX A H,N1.n,,,,E _ _ _ _ _ — — — BARN ENGINEERING fA. aim MANNETPeXNTE DNNE D� N,�� � MINNEAPDLI5. Mx 38L38 F6.� � I o3=7—,w 12ITyA10 TIIiRM MINNEAPOLIS, MN. CHANHASSEN, MN EPF 0.1EM PROJECT No. Mdy Ala TEMPORARYEROSIONCONTROL RNMR,E I 2 A 8DATE BONN �.NA. C-04 may. NP. D ND BY APP DATE REVISION DESCRIPTION T�D)a� aELFABm Aw 1.0 GENERAL CONSTRUCTION ACTIVITY INFORMATION' THIS STORMWATER POLLUTION PREVENTION PLAN (SWPPP) HAS BEEN PREPARED IN COMPLIANCE WITH THE MINNESOTA GENERAL STORMWATER PERMIT FOR CONSTRUCTION ACTIVITY NO. MNRI00001 (GENERAL PERMIT), AS REQUIRED BY THE MINNESOTA POLLUTION CONTROL AGENCY (MPGA) UNDER THE NATIONAL POLLUTANT DISCHARGE ELIMINATION SYSTEMBTATE DISPOSAL SYSTEM(NPDES5DS) PROGRAM. THE PROJECT IS LOCATED IN THE CITY OF CHANHASSEN, CARVER COUNTY, MINNESOTA. PROPOSED CONSTRUCTION ACTIVITIES WILL TAKE PLACE ALONG AND JUST SOUTH OF THE MINNESOTA BLUFFS REGIONAL TRAIL BETWEEN FLYING CLOUD ROAD AND LAKOTA LANE. THE APPROXIMATE CENTROID OF THE PROJECT HAS A LATITUDE OF "Al 94192 AND A LONGITUDE OF -93.526089. THIS PROJECT INVOLVES EROSION CONTROL, REPAIR AND REGRADING OF LANDSLIDE DAMAGED SLOPES, REPAIR OF DAMAGED CULVERTS, INSTALLATION OF STORM SEWER AND MANHOLES AND SITE RESTORATION .THE PROJECT AS PROPOSED HAS A TOTAL DISTURBANCE AREA OF 722 ACRES. EROSION PREVENTION AND SEDIMENT CONTROL MEASURES ARE REQUIRED TO MINIMIZE SEDIMENT FROM BEING TRANSPORTED INTO BLUFF CREEK, WHICH IS AN IMPAIRED WATER REFER TO PROJECT DRAWINGS FOR FURTHER DETAILS. (CSW PERMIT PART IIIA -1) 3.0 PROJECT PLANS AND SPECIFICATIONS: • PORTIONS OF THE SITE THAT DRAIN TO A PUBLIC WATER WITH DNR WORK IN WATER REQUIRED FEATURE SHEET NUMBER • PROJECT LOCATION AND CONSTRUCTION LIMITS G-01 • EXISTING AND FINAL GRADES, INCLUDING DRAINAGE AREA BOUNDARIES, DIRECTIONS C ,CQ 14,G16 OF FLOW AND ALL DISCHARGE POINTS WHERE STORMWATER IS LEAVING THE SITE OR • THE TOTAL AREA OF PRE -CONSTRUCTION IMPERVIOUS AREA IS APPROXIMATELY 0.70 ACRES. ENTERING A SURFACE WATER TITLE: PROJECT ENGINEER • SOIL TYPES AT THE SITE C -05A • LOCATIONS OF IMPERVIOUS SURFACES C4)6,G%,G16 • LOCATIONS OF AREAS NOT BE BE DISTURBED (E.G.. BUFFER ZONES, WETLANDS, ETC) C-06.G14,G16 LOCATIONS OF AREAS OF STEEP SLOPES C-06.G14,G16 LOCATIONS OF AREAS WHERE CONSTRUCTION WILL BE PHASED TO MINIMIZE DURATION NA OF EXPOSED SOILS 1.3 CONTACTINFORMATION: • PORTIONS OF THE SITE THAT DRAIN TO A PUBLIC WATER WITH DNR WORK IN WATER NA 1.1 PROJECT SIZE AND CUMULATIVE IMPERVIOUS SURFACE: RESTRICTIONS FOR FISH SPAWNING TIMEFRAMES • THE ANTICIPATED AREA OF DISTURBANCE IS APPROXIMATELY 7.22 ACRES. • LOCATIONS OF ALL TEMPORARY AND PERMANENT EROSION AND SEDIMENT CONTROL C -03,G -05,G-06 • THE TOTAL AREA OF PRE -CONSTRUCTION IMPERVIOUS AREA IS APPROXIMATELY 0.70 ACRES. BMPS AS REQUIRED IN PERMIT SECTIONS 8 THROUGH 10 AND 14 THROUGH 19 TITLE: PROJECT ENGINEER • THETOTAL AREA OF POST -CONSTRUCTION IMPERVIOUS AREA ISAPPROXIMATELYO.70 ACRES. • BUFFER ZONES AS REQUIRED IN PERMIT ITEMS BAT AND 23.11 C-0B.G14,G18 • THE TOTAL NEW IMPERVIOUS AREA IS APPROXIMATELY 0 ACRES. •NSOF POTENTIAL POLLUTION -GENERATING ACTIVITIES IDENTIFIED IN PERMIT C-06,G14,G16 1.2 DATES OF CONSTRUCTION: SECTION • ANTICIPATED START DATE: TBD ANTICIPATED END DATE: TBD • STANDARD DETAILS FOR EROSION AND SEDIMENT CONTROL BMPS TO BE INSTALLED C-04 AT THE SITE 1.3 CONTACTINFORMATION: OWNER: HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY MAILING ADDRESS: 7014TH AVE. S. #400 CONTACT PERSON: JESSICA GALATZ TITLE: PROJECT MANAGER PHONE NUMBER: (612) 31&2691 EMAIL ADDRESS: JESSICAGALATZ®HENNEPIN.US ALTERNATE CONTACT PERSON: KRISTINE STEHLY TITLE: PROJECT ENGINEER PHONE NUMBER: (612) 3466370 EMAIL ADDRESSKRISTINE.STEHLY@HENNEPIN. US OPERATOR I GENERAL CONTRACTOR (WILL OVERSEE IMPLEMENTATION OF THE SWPPP): TBD MAILING ADDRESS: CONTACT PERSON: TITLE: PHONE NUMBER: EMAIL ADDRESS: PARTY RESPONSIBLE FOR LONGTERM OPERATION AND MAINTENANCE OF THE PERMANENT STORMWATER MANAGEMENT SYSTEM: HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY MAILING ADDRESS: 7014TH AVE. S. VIN CONTACT PERSON: JESSICA GALATZ TITLE: PROJECT MANAGER PHONE NUMBER: (612) 348-2691 EMAIL ADDRESS: JESSICAGALATZ@HENNEPIS.US 2.0 RECEIVING WATERS: WATERS WITHIN ONE MILE (NEAREST STRAIGHT LINE DISTANCE) THATARE LIKELY TO RECEIVE STORMWATER RUNOFF FROM THE PROJECT SITE (CSW PERMIT ITEM 5.10) INCLUDE: SPECIAL IMPAIRED PUBLIC WATER WITH WORK NAME OF WATER BOOV TYPE III WATER BODY ID IN WATER?PI WATER? PI IN WATER RESTRICTIONS? BLUFF CREEK CREEK 0702(1012-710 NO YES NO RICE LAKE LAKE 27-0132-00 NO NO NO (1) TYPE EXAMPLES: DITCH, POND, WETLAND, CALCAREQUS FEN, LAKE, STREAM, RIVER (2) WATER BODY IDENTIFICATION (ID) MIGHT NOT BE AVAILABLE FOR ALL WATER BODIES. USE THE SPECIAL AND IMPAIRED WATERS SEARCH TOOL AT: HTTPSJAVWW.PCA.STAM.MN.USM'ATEILSTORNIWATERSPECIAL-ANGIMPAIRED-WATERSSEARCH (3) REFER TO CSW PERMIT SECTION 23. IMPAIRED WATER FOR THE FOLLOWING POLLUTANT(S) OR STRESSOR(S): PHOSPHORUS (NUTRIENT EUTROPHICATION BIOLOGICAL INDICATORS), TURBIDITY, TOTAL SUSPENDED SOLIDS (TSS), DISSOLVED OXYGEN, OR AQUATIC BIOTA (FISH BIOASSESSMENT, AQUATIC PLANT BIOASSESSMENT, AND AQUATIC MACROINVERTEBRATE BIOASSESSMENT) 2.1 SPECIAL AND IMPAIRED WATERS: THE MPCAS SPECIAL AND IMPAIRED WATERS SEARCH TOOL WAS USED TO LOCATE SPECIAL AND IMPAIRED WATERS WITHIN ONE MILE (AERIAL RADIUS MEASUREMENT) OF THE PROJECT SITE.BLUFF CREEK HAS AN EPA -APPROVED IMPAIRMENT FOR TURBIDITY AND FISH BIOTA. THESE IMPAIRMENTS ARE CONSIDERED CONSTRUCTION RELATED AND REQUIRE ADDITIONAL BEST MANAGEMENT PRACTICES (BMPS) OR PLAN REVIEW FOR COMPLIANCE WITH THE GENERAL PERMIT. (CSW PERMIT ITEM 2.7 AND SECTION 23) ADDITIONAL BMPS OR OTHER SPECIFIC CONSTRUCTION RELATED IMPLEMENTATION ACTIVITIES IDENTIFIED IN AN APPROVED TOTAL MAXIMUM DAILY LOAD (TMDL) INCLUDE IMMEDIATE STABILIZATION OF EXPOSED SOIL AREAS AND CONSTRUCTION OF A TEMPORARY SEDIMENTATION BASIN FOR COMMON DRAINAGE LOCATIONS THAT SERVE AN AREA WITH 5 OR MORE ACRES. (CSW PERMIT ITEM 5.19) 2.2 PUBLIC WATERS WITH WORK IN WATER RESTRICTIONS: THIS PROJECT DOES NOT INCLUDE WORK IN PUBLIC WATERS. (CSW PERMIT ITEM 5.11) 2.3 WETLAND IMPACTS: THIS PROJECT DOES NOT INCLUDE WETLAND IMPACTS (GSW PERMIT ITEMS 2.4 AND 2.10, AND SECTION 22) 2.4 ENVIRONMENTAL REVIEW AND OTHER REQUIRED REVIEWS: STORMWATER MITIGATION MEASURES ARE NOT REQUIRED AS A RESULT OF AN ENVIRONMENTAL REVIEW (E.G., EAW OR EIS). ENDANGERED OR THREATENED SPECIES REVIEW, ARCHEOLOGICAL SITE REVIEW, OR OTHER LOCAL, STATE, OR FEDERAL REVIEW CONDUCTED FOR THE PROJECT. (CSW PERMIT ITEMS 2.8, 2.9, AND 5.16) 2.5 KARST AREAS OR DRINKING WATER SUPPLY MANAGEMENT AREAS: THIS PROJECT DOES NOT INCLUDE ANY KARST OR DRINKING WATER SUPPLY MANAGEMENT AREAS. (CSW PERMIT ITEMS 16.19,1620, AND 18.10) RE EASED REVISION DESCRIPTION ww ,�. TaFOR 4.0 BEST MANAGEMENT PRACTICES (BMPS 4.1 EROSION PREVENTION PRACTICES: 1. BEFORE LAND DISTURBING ACTIVITIES BEGIN. THE LIMITS OF THE AREAS TO BE DISTURBED DURING CONSTRUCTION WILL BE DELINEATED WITH FLAGS, STAKES, SIGNS, SILT FENCE, ETC 2. TEMPORARY STABILIZATION OF SOILS AND SOIL STOCKPILES: (GSW PERMIT ITEMS 8.4, 8.5, AND 23.9) a. AREAS OF EXPOSED SOIL WILL BE STABILIZED WITH EROSION CONTROL BLANKET, PRESERVATION OF MATURE VEGETATION, MULCH OR EQUIVALENT MEASURES. b. IF PRESENT, SOIL STOCKPILES WILL BE STABILIZED WITH MULCH (SUCH AS STRAW MULCH, EROSION CONTROL BLANKETS OR EQUIVALENT MEASURES. c. TEMPORARY STOCKPILES WITHOUT SIGNIFICANT SILT. CLAY, OR ORGANIC COMPONENTS (E.G., CLEAN AGGREGATE STOCKPILES, DEMOLITION CONCRETE STOCKPILES, SAND STOCKPILES) AND THE CONSTRUCTED BASE COMPONENTS OF ROADS, PARKING LOTS, AND SIMILAR SURFACES ARE EXEMPT FROM THESE STABILIZATION REQUIREMENTS. 2. STABILIZATION OF DITCH AND SWALE WETTED PERIMETERS: (CSW PERMIT ITEMS 8.6 THROUGH 8.8) a. IF SOILS WITHIN EXISTING STORMWATER DITCHES OR SWALES ARE DISTURBED, THEY WILL BE STABILIZED WITH CHANNEL EROSION CONTROL BLANKET, RIPRAP, TURF REINFORCEMENT MAT OR EQUIVALENT MEASURES. b. MULCH, HYDROMULCH, TACKIFIER, POLYACRYLAMIDE, OR SIMILAR EROSION PREVENTION PRACTICES WILL NOT BE USED TO STABILIZE ANY PART OF AN EXISTING STORMWATER DITCH OR SWALE WITH A CONTINUOUS SLOPE OF GREATER THAN 2 PERCENT. c. THE LAST 200 LINEAL FEET OF LENGTH OF THE NORMAL WETTED PERIMETER OF ANY TEMPORARY OR PERMANENT DITCH OR SWALE THAT DRAINS WATER FROM ANY PORTION OF THE CONSTRUCTION SITE, OR DIVERTS WATER AROUND THE SITE, WITHIN 200 LINEAL FEET FROM THE PROPERTY EDGE, OR FROM THE POINT OF DISCHARGE INTO ANY SURFACE WATER WILL BE STABILIZED WITHIN 24 HOURS AFTER CONNECTING TO A SURFACE WATER OR PROPERTY EDGE. d. STABILIZATION OF THE REMAINING PORTIONS OF ANY TEMPORARY OR PERMANENT DITCHES OR SWALES WILL BE COMPLETED WITHIN 14 CALENDAR DAYS AFTER CONNECTING TO A SURFACE WATER OR PROPERTY EDGE AND CONSTRUCTION IN THAT PORTION OF THE DITCH HAS TEMPORARILY OR PERMANENTLY CEASED. 3. ENERGY DISSIPATION AT PIPE OUTLETS: ENERGY DISSIPATION AT PIPE OUTLETS WILL BE PROVIDED WITH ONE OR MORE OF THE FOLLOW METHODS: RIP RAP, SPLASH PADS, GABIONS, OR EQUIVALENT MEASURES. (CSW PERMIT ITEM 8.9) 4. EROSION PREVENTION IMPLEMENTATION TIMELINES: (CSW PERMIT ITEMS 5.4, 84 THROUGH 8.6, AND 23.9) a. STABILIZATION OF EXPOSED SOIL AREAS (INCLUDING STOCKPILES) WILL BE INITIATED IMMEDIATELY TO LIMIT SOIL EROSION WHENEVER ANY CONSTRUCTION ACTIVITY HAS PERMANENTLY OR TEMPORARILY CEASED ON ANY PORTION OF THE SITE AND WILL NOT RESUME FOR A PERIOD EXCEEDING 14 CALENDAR DAYS. b. IF THE EXPOSED SOIL AREAS DRAIN TO A DISCHARGE POINT THAT IS WITHIN ONE MILE (AERIAL RADIUS MEASUREMENT) OF A SPECIAL OR IMPAIRED WATER (SEE SECTION 2.0), STABILIZATION OF EXPOSED SOIL AREAS (INCLUDING STOCKPILES) WILL BE INITIATED IMMEDIATELY TO LIMIT SOIL EROSION WHENEVER ANY CONSTRUCTION ACTIVITY HAS PERMANENTLY OR TEMPORARILY CEASED ON ANY PORTION OF THE SITE AND WILL NOT RESUME FOR A PERIOD EXCEEDING 7 CALENDAR DAYS. c. THE FOLLOWING ACTIVITIES CAN BE TAKEN TO INITIATE STABILIZATION: PREPPING THE SOIL FOR VEGETATIVE OR NON -VEGETATIVE STABILIZATION. APPLYING MULCH OR OTHER NON -VEGETATIVE PRODUCT TO THE EXPOSED SOIL AREA, OR SEEDING OR PIANTING THE EXPOSED AREA. S. ADDITIONAL EROSION PREVENTION MEASURES: THE FOLLOWING ADDITIONAL EROSION PREVENTION METHODS WILL BE IMPLEMENTED AT THE SITE DURING CONSTRUCTION: (CSW PERMIT ITEMS 8.2,8 3, AND 8.10) a. SOIL DISTURBANCE WILL BE MINIMIZED WHEREVER POSSIBLE TO AID IN EROSION PREVENTION. b. EXISTING VEGETATION WILL BE PRESERVED WHEREVER POSSIBLE TO LIMIT EXPOSED SOIL MD THUS WILL SERVE AS NATURAL VEGETATIVE BUFFERS. c. EXPOSED SOIL ON STEEP SLOPES (S1HAV) WILL BE STABILIZED USING EROSION CONTROL BLANKETS AND SEEDING. d HORIZONTAL SLOPE GRADING WILL BE UTILIZED TO MINIMIZE EROSION POTENTIAL. e. TERRACING WILL BE USED TO MINIMIZED EROSION POTENTIAL. 4.2 SEDIMENT CONTROL PRACTICES: 1. DOWNGRADIENT PERIMETER CONTROLS: (GSW PERMIT ITEMS 9.2 THROUGH 9.6) a. SEDIMENT CONTROL PRACTICES WILL BE ESTABLISHED ON ALL DOWNGRADIENT PERIMETERS AND LOCATED UPGRADIENT OF ANY BUFFER ZONES. PERIMETER SEDIMENT CONTROLS WILL INCLUDE: SILT FENCE, SEDIMENT CONTROL LOGS / BIOROLLS (FILLED WITH COMPOST. WOOD CHIPS, ROCK, ETC.), VEGETATIVE BUFFERS (RETAIN EXISTING VEGETATION WHERE POSSIBLE), OR EQUIVALENT MEASURES. b. PERIMETER SEDIMENT CONTROL PRACTICES MUST BE INSTALLED BEFORE ANY UPGRADIENT LAND -DISTURBING ACTIVITIES BEGIN AND REMAIN IN PLACE UNTIL PERMANENT COVER HAS BEEN ESTABLISHED. c. IF SEDIMENT CONTROL PRACTICES HAVE BEEN ADJUSTED OR REMOVED TO ACCOMMODATE SHORT-TERM ACTIVITIES (SUCH AS CLEARING. GRUBBING, OR PASSAGE OF VEHICLES), THE CONTROLS MUST BE RE -INSTALLED IMMEDIATELY AFTER THE SHORT-TERM ACTIVITY HAS BEEN COMPLETED. SEDIMENT CONTROL PRACTICES MUST BE RE -INSTALLED BEFORE THE NEXT PRECIPITATION EVENT. EVEN IF THE SHORT-TERM ACTIVITY IS NOT COMPLETE. d. IF THE DOWNGRADIE W SEDIMENT CONTROLS ARE OVERLOADED (BASED ON FREQUENT FAILURE OR EXCESSIVE MAINTENANCE REQUIREMENT), INSTALL ADDITIONAL UPGRADIENT SEDIMENT CONTROL PRACTICES OR REDUNDANT BMPS TO ELIMINATE THE OVERLOADING AND AMEND THE SWPPP TO IDENTIFY THESE ADDITIONAL PRACTICES. 2. SOIL STOCKPILE PERIMETER CONTROLS: TEMPORARY SOIL STOCKPILES WILL BE SURROUNDED BY: DOUBLE ROWS OF SILT FENCE, SEDIMENT CONTROL LOGS OR EQUIVALENT MEASURES, AND SHALL NOT BE PLACED IN ANY NATURAL BUFFERS OR SURFACE WATERS.(CSW PERMIT ITEMS 9.9 AND 9.10) 3. STORM DRAIN INLET PROTECTION: (CSW PERMIT ITEMS 9.7 AND 9.8) a. INLET PROTECTION BAPS WILL BE INSTALLED AROUND ALL STORM DRAIN INLETS DQWNGRADIENT OF CONSTRUCTION ACTIVITIES. b. STORM DRAIN INLETS WILL BE PROTECTED UNTIL ALL SOURCES WITH POTENTIAL FOR DISCHARGING TO THE INLET HAVE BEEN STABILIZED. c. INLET PROTECTION BMPS WILL BE: SEDIMENT CONTROL LOG, FILTER SACKS, OR EQUIVALENT MEASURES, 4. VEHICLE TRACKING BMPS: (CSW PERMIT ITEMS 9.11 AND 912) a. VEHICLE TRACKING BMPS WILL BE INSTALLED TO MINIMIZE THE TRACKING OUT OF SEDIMENT FROM THE CONSTRUCTION AREA AND WILL INCLUDE: ROCK PADS AND MUD MATS OR ML EQUIVALENT SYSTEM. b. IF SUCH VEHICLE TRACKING BMPS ARE NOT ADEQUATE TO PREVENT SEDIMENT FROM BEING TRACKED ONTO THE PAVED ROAD, STREET SWEEPING WILL ALSO BE EMPLOYED. SEDIMENT WILL BE REMOVED BY SWEEPING WITHIN 24 HOURS. 5. PROTECTION OF INFILTRATION AREAS: IF NECESSARY, ADDITIONAL SEDIMENT CONTROLS (E.G.. DIVERSION BERMS) WILL BE INSTALLED TO KEEP RUNOFF AWAY FROM PLANNED INFILTRATION AREAS WHEN EXCAVATED PRIOR TO ESTABLISHING PERMANENT COVER WITHIN THE CONTRIBUTING DRAINAGE AREA (GSW PERMIT ITEMS 16.4 AND 16.5) 6, MINIMIZATION OF SOIL COMPACTION AND PRESERVATION OF TOPSOIL: SOIL COMPACTION WILL BE MINIMIZED AND TOPSOIL WILL BE PRESERVED WHERE POSSIBLE. (CSW PERMIT ITEMS 5,24,9.14. AND 9.15) 7. PRIORITIZATION OF ONSITE INFILTRATION AND SEDIMENT REMOVAL: (CSW PERMIT ITEM 9.16) a. PRIOR TO OFFSITE DISCHARGE, INFILTRATION AND SEDIMENT REMOVAL WILL BE IMPLEMENTED ONSITE WHERE POSSIBLE. b. DISCHARGES FROM BMPS WILL BE DIRECTED TO VEGETATED AREAS OF THE SITE (INCLUDING ANY NATURAL BUFFERS) IN ORDER TO INCREASE SEDIMENT REMOVAL AND MAXIMIZE STORMWATER INFILTRATION. IF EROSION IS NOTED TO OCCUR AS THE RESULT OF SUCH A DISCHARGE, VELOCITY DISSIPATION BMPS WILL BE CONSIDERED AND INSTALLED AS NECESSARY TO PREVENT EROSION. 8. BUFFER ZONE OR REDUNDANT SEDIMENT CONTROLS TO PROTECT SURFACE WATERS: (CSW PERMIT ITEM 9.17) a. A 50 -FOOT NATURAL BUFFER WILL BE PRESERVED IN CONSTRUCTION AREAS DISCHARGING TO A NONSPECIALMON-IMPAIRED SURFACE WATER OR WETLAND. IF A NON-SPECIALMON-IMPAIRED SURFACE WATER OR WETLAND IS LOCATED WITHIN W FEET OF THE PROJECTS EARTH DISTURBANCES AND STORMWATER FLOWS TO THE SURFACE WATER, OR WHEN A BUFFER IS INFEASIBLE, REDUNDANT SEDIMENT CONTROLS WILL BE PROVIDED. b. A 10 -FOOT NATURAL BUFFER WILL BE PRESERVED IN CONSTRUCTION AREAS DISCHARGING TO A SPECIAL OR IMPAIRED SURFACE WATER. IF A SPECIAL OR IMPAIRED SURFACE WATER IS LOCATED WITHIN 100 FEET OF THE PROJECTS EARTH DISTURBANCES AND STORMWATER FLOWS TO THE SURFACE WATER, OR WHEN A BUFFER IS INFEASIBLE. REDUNDANT SEDIMENT CONTROLS WILL BE PROVIDED. c. REDUNDANT PERIMETER CONTROLS WILL BE INSTALLED AT LEAST 5 FEET APART UNLESS LIMITED BY LACK OF AVAILABLE SPACE. 9. USE OF SEDIMENTATION TREATMENT CHEMICALS (E.G.. POLYMERS, FLOCCULANTS, ETC) IS NOT ANTICIPATED AS PART OF THE PROJECT. (CSW PERMIT ITEMS 5.22 AND 9.18) 10. THE PROJECT WILL NOT INCLUDE 10 OR MORE ACRES OF DISTURBED SOIL GRAINING TO A COMMON LOCATION OR 5 OR MORE ACRES DRAINING TO A COMMONLOCATION WITHIN 1 MILE OR A SPECIAL OR IMPAIRED WATER THEREFORE TEMPORARY SEDIMENT BASINS ARE NOT REQUIRED. (CSW PERMIT ITEMS 5.6, 9. 13, AND 23.10 AND SECTION 14) 4.3 DEWATERING AND BASIN DRAINING: NO DEWATERING OR BASIN GRAINING WILL OCCUR AS PART OF THIS PROJECT. (CSW PERMIT SECTION 10 AND ITEM 10.5) o,,.,w As sHowN fiNw eNDINEERIN6m.1v13rm1e 4am M4RKElPINNTE ORAE OT HCRRA sUw zaa 4A BMP DESIGN FACTORS: THE FOLLOWING BMP DESIGN FACTORS HAVE BEEN CONSIDERED IN DESIGNING THE TEMPORARY EROSION PREVENTION AND SEDIMENT CONTROL BMPS: 1. EXPECTED AMOUNT, FREQUENCY, INTENSITY, AND DURATION OF PRECIPITATION. Z NATURE OF STORMWATER RUNOFF AND RUN-ON AT THE SITE, INCLUDING FACTORS SUCH AS EXPECTED FLOW FROM IMPERVIOUS SURFACES, SLOPES, AND SITE DRAINAGE FEATURES. 3. STORMWATER VOLUME,VELOCITY. AND PEAK FLOW RATES TO MINIMIZE DISCHARGE OF POLLUTANTS IN STORMWATER AND TO MINIMIZE CHANNEL AND STREAMBANK EROSION AND SCOUR IN THE IMMEDIATE VICINITY OF DISCHARGE POINTS. 4. RANGE OF SOIL PARTICLE SIZES EXPECTED TO BE PRESENT. (SEE PAGE 20F 2) MINNEAPaLIS.MNRAMi I-- I MH I MINNEAPOLIS, MN 90% DESIGN NOT FOR CONSTRUCTION LANDSLIDE REPAIRS CHANHASSEN,MN STORM WATER POLLUTION PREVENTION PLAN (SWPPP) 5.0 PERMANENT STORMWATER MANAGEMENT SYSTEM, A PERMANENT STORMWATER MANAGEMENT SYSTEM IS REQUIRED IF THE PROJECT RESULTS IN ONE ACRE OR MORE OF NEW IMPERVIOUS SURFACES OR RESULTS IN A NET INCREASE OF ONE OR MORE ACRES OF CUMMULATIVE NEW IMPERVIOUS SURFACES IN TOTAL OR IF THE PROJECT IS PART OF A LARGER PLAN OF DEVELOPMENT. (CSW PERMIT ITEM 15.3) 5_1 A PERMANENT STORMWATER TREATMENT SYSTEM IS NOT REQUIRED. (CSW PERMIT ITEMS 5.15,15.415.9, AND 23.14) 52 THIS IS NOT A LINEAR PROJECT WITH LACK OF RIGHT OR WAY. (CSW PERMIT ITEM 159) 5.3 THIS PROJECT ODES NOT DISCHARGE TO A TROUT STREAM (OR A TRIBUTARY TO A TROUT STREAM). (CSW PERMIT ITEM 23.12) 6.0 INSPECTION AND MAINTENANCE ACTIVITIES: 6.1 PERSONS WITH REQUIRED TRAINING: TRAINED INDIVIDUALS INCLUDE THOSE PARTIES RESPONSIBLE FOR INSTALLING, SUPERVISING, REPAIRING, INSPECTING, AND MAINTAINING EROSION PREVENTION AND SEDIMENT CONTROL BMPS AT THE SITE. TRAINED INDIVIDUALS ME ALSO RESPONSIBLE FOR IMPLEMENTATION OF THE SWPPP AND COMPLIANCE WITH THE GENERAL PERMIT UNTIL THE CONSTRUCTK)N ACTIVITIES ME COMPLETE, PERMANENT COVER HAS BEEN ESTABLISHED, AND A NOTICE OF TERMINATION (NOT) HAS BEEN SUBMITTED. (CSW PERMIT ITEMS 520. 5.21, AND I I B AND SECTION 21) THESE INDIVIDUALS WILL BE TRAINED IN ACCORDANCE WITH THE REQUIREMENTS OF THE GENERAL PERMIT, INCLUDING THE REQUIREMENT THAT THE CONTENT AND EXTENT OF TRAINING WILL BE COMMENSURATE WITH THE INDIVIDUALS JOB DUKES AND RESPONSIBILITIES. BELOW IS A LIST OF PEOPLE RESPONSIBLE FOR THIS PROJECT WHO ARE KNOWLEDGEABLE AND EXPERIENCED IN THE APPLICATION OF EROSION PREVENTION AND SEDIMENT CONTROL BMPS. TRAINED INDIVIDUAL RESPONSIBILITY TRAINING ENTITY' TRAINING DATE ERIC FITZGERALD PREPARATION OF THE SWPPP UNIVERSITY OF MINNESOTA SEPTEMBER 2017 TBD OVERSIGHT OF SWPPP IMPLEMENTA- TBD TBD TION, REVISION, AND AMMENDMENT TBD PERFORMANCE OF SWPPP INSPECTIONS TBD TBD TBD PERFORMANCE OR SUPERVISION OF TBD TBD INSTALLATION, MAINTENANCE, AND REPAIR OF BMPS 'TRAINING DOCUMENTATION AVAILABLE UPON REQUEST 6.2 FREQUENCY OF INSPECTIONS: ATRAINED PERSON WILL ROUTINELY INSPECT THE ENTIRE CONSTRUCTION SITE. (CSW PERMIT ITEMS 11.2,11 A0, AND 23.13) • AT LEAST ONCE EVERY 7 DAYS DURING ACTIVE CONSTRUCTION • WITHIN 24 HOURS AFTER A RAINFALL EVENT GREATER THAN 0.5 INCHES IN 24 HOURS INSPECTION FREQUENCY MAY BE ADJUSTED UNDER THE FOLLOWING CIRCUMSTANCES: • WHERE PARTS OF THE CONSTRUCTION AREAS HAVE PERMANENT COVER, BUT WORK REMAINS ON OTHER PARTS OF THE SITE, INSPECTIONS OF THE AREAS WITH PERMANENT COVER MAY BE REDUCED TO ONCE PER MONTH. • WHERE CONSTRUCTION AREAS HAVE PERMANENT COVER AND NO CONSTRUCTION ACTIVITY IS OCCURRING ON THE SITE, INSPECTIONS CAN BE REDUCED TO ONCE PER MONTH AND, AFTER 12 MONTHS, MAY BE SUSPENDED COMPLETELY UNTIL CONSTRUCTION ACTIVITY RESUMES. • WHERE CONSTRUCTION ACTIVITY HAS BEEN SUSPENDED DUE TO FROZEN GROUND CONDITIONS. THE INSPECTIONS MAY BE SUSPENDED. THE REQUIRED INSPECTIONS AND MAINTENANCE SCHEDULE MUST BEGIN WITHIN 24 HOURS AFTER RUNOFF OCCURS AT THE SITE OR UPON RESUMING CONSTRUCTION, WHICHEVER COMES FIRST. 8.3 INSPECTION REQUIREMENTS: EACH CONSTRUCTION STORMWATER SITE INSPECTION WILL INCLUDE INSPECTION OF THE FOLLOWING AREAS: (CSW PERMIT ITEMS 11.3 THROUGH 112) • ALL EROSION PREVENTION AND SEDIMENT CONTROL BMPS AND POLLUTION PREVENTION MANAGEMENT MEASURES • SURFACE WATERS FOR EVIDENCE OF EROSION AND SEDIMENT DEPOSITION • CONSTRUCTION SITE VEHICLE EXIT LOCATIONS FOR EVIDENCE OF OFFSITE SEDIMENT TRACKING • STREETS AND OTHER AREAS ADJACENT TO THE PROJECT FOR EVIDENCE OF OFF SITE ACCUMULATIONS OF SEDIMENT 6.4 MAINTENANCE REQUIREMENTS: MAINTENANCE OF THE FOLLOWING AREAS AND BMPS WILL BE PERFORMED AS FOLLOWS: (CSW PERMIT ITEMS 11.3 THROUGH 11.8) • NONFUNCTIONAL BMPS WILL BE REPAIRED, REPLACED, OR SUPPLEMENTED WITH FUNCTIONAL BMPS BY THE END OF THE NEXT BUSINESS DAY AFTER DISCOVERY OR AS SOON AS FIELD CONDITIONS ALLOW ACCESS. • PERIMETER CONTROL DEVICES WILL BE REPAIRED, REPLACED, OR SUPPLEMENTED WHEN THEY BECOME NONFUNCTIONAL OR THE SEDIMENT REACHES W OF THE HEIGHT OF THE DEVICE. • TEMPORARY AND PERMANENT SEDIMENTATION BASINS WILL BE DRAINED AND THE SEDIMENT REMOVED WHEN THE DEPTH OF SEDIMENT COLLECTED IN THE BASIN REACHES 112 THE STORAGE VOLUME. • DELTAS AND SEDIMENT DEPOSITED IN SURFACE WATERS WILL BE REMOVED, AND THE AREAS WHERE SEDIMENT REMOVAL RESULTS IN EXPOSED SOIL WILL BE RIE -STABILIZED. THE REMOVAL AND STABILIZATION WILL BE COMPLETED WITHIN 7 CALENDAR F F DAYS DISCOVERY UNLESS PRECLUDED BY LEGAL REGULATORY,R O PHYSICAL ACCESS WILL BE CONSTRAINTS, NTS. IF PRECLUDED DUET ACCESS CCESS CONSTRAINTS, REASONABLE EFFORTS TO OBTAIN ACCESS WILL BE USED. REMOVAL AND STABILIZATION WILL TAKE PLACE WITHIN T CALENDAR DAYS OF OBTAINING ACCESS. • TRACKED SEDIMENT ON PAVED SURFACES WILL BE REMOVED WITHIN 1 CALENDAR DAY OF DISCOVERY. • AREAS UNDERGOING STABILIZATION WILL BE RESTABILIZED AS NECESSARY TO ACHIEVE REQUIRED COVER. 6.5 RECORDKEEPING REQUIREMENTS: (CSW PERMIT ITEMS 11.11 AND 24.5 AND SECTIONS 6 AND 20) 1. ALL INSPECTIONS AND MAINTENANCE ACTIVITIES WILL BE RECORDED IN WRITING WITHIN 24 HOURS OF BEING CONDUCTED AND THESE RECORDS WILL BE RETAINED WITH THE SWPPP. RECORDS OF EACH INSPECTION AND MAINTENANCE ACTIVITY WILL INCLUDE THE DATE AND TIME; NAME OF INSPECTOR(S); FINDINGS OF INSPECTIONS; CORRECTIVE ACTIONS (INCLUDING DATES, TIMES, AND PARTY COMPLETING MAINTENANCE ACTIVITIES); AND DATE OF ALL RAINFALL EVENTS GREATER THAN 0.5 INCHES IN 24 HOURS AND THE AMOUNT OF RAINFALL FOR EACH EVENT. a. IF ANY DISCHARGE IS OBSERVED DURING THE INSPECTION, THE LOCATION AND APPEARANCE OF THE DISCHARGE (I.E., COLOR, ODOR, SETTLED OR SUSPENDED SOLIDS, OIL SHEEN, AND OTHER OBVIOUS INDICATORS OF POLLUTANTS) WILL BE DOCUMENTED AND A PHOTOGRAPH WILL BE TAKEN. 2, THE SWPPP WILL BE AMENDED TO INCLUDE ADDITIONAL OR MODIFIED BMPS TO CORRECT PROBLEMS OR ADDRESS SITUATIONS WHENEVER THERE IS A CHANGE IN DESIGN, CONSTRUCTION, OPERATION, MAINTENANCE, WEATHER, OR SEASONAL CONDITIONS THAT HAS A SIGNIFICANT EFFECT ON THE DISCHARGE OF POLLUTANTS TO SURFACE WATERS OR GROUNDWATER. a. THE SWPPP WILL BE AMENDED WHEN INSPECTIONS OR INVESTIGATIONS BY THE SITE OWNER, OPERATOR, OR CONTRACTORS OR BY USEPAMPCA OFFICIALS INDICATE THAT THE SWPPP IS NOT EFFECTIVE IN ELIMINATING OR MINIMIZING THE DISCHARGE OF POLLUTANTS TO SURFACE WATERS OR GROUNDWATER THE DISCHARGES ME CAUSING WATER QUALITY STANDARD EXCEEDANCES; OR THE SWPPP IS NOT CONSISTENT WITH A USEPA APPROVED TMDL. b. ANY AMENDMENTS TO THE SWPPP PROPOSED AS A RESULT OF THE INSPECTION WILL BE DOCUMENTED AS REQUIRED WITHIN 7 CALENDAR DAYS. c. AMENDMENTS WILL BE COMPLETED BY AN APPROPRIATELY TRAINED INDIVIDUAL CHANGES INVOLVING THE USE OF A LESS STRINGENT BMP WILL INCLUDE A JUSTIFICATION DESCRIBING HOW THE REPLACEMENT BMP IS EFFECTIVE FOR THE SITE CHARACTERISTICS. 3. RECORDS RETENTION: THE SWPPP, INCLUDING ALL CHANGES TO IT, AND INSPECTION AND MAINTENANCE RECORDS WILL BE KEPT AT THE SITE DURING CONSTRUCTION BY THE PERMITTEE WHO HAS OPERATIONAL CONTROL OF THE SITE. THE SWPPP CAN BE KEPT IN EITHER A FIELD OFFICE OR IN AN ON SITE VEHICLE DURING NORMAL WORKING HOURS. 4, RECORD AVAILABILITY: THE PERMITTEES WILL MAKE THE SWPPP, INCLUDING INSPECTION REPORTS, MAINTENANCE RECORDS. AND TRAINING RECORDS, AVAILABLE TO FEDERAL, STATE, AND LOCAL OFFICIALS WITHIN THREE DAYS UPON REQUEST FOR THE DURATION OF THE PERMIT COVERAGE AND FOR THREE YEARS FOLLOWING THE NOTICE OF TERMINATION, 7.0 POLLUTION PREVENTION MEASURES: 1. ANY CONSTRUCTION PRODUCTS AND LANDSCAPE MATERIALS THAT HAVE THE POTENTIAL TO LEACH POLLUTANTS WILL BE STORED UNDER COVER (E.G., PLASTIC SHEETING OR TEMPORARY ROOFS) TO PREVENT DISCHARGE OF POLLUTANTS THROUGH MINIMIZATION OF CONTACT WITH STORM PATER. STORAGE OF SUCH MATERIALS WITHIN THE PROJECT AREA WILL BE MINIMIZED TO THE EXTENT POSSIBLE. (CSW PERMIT ITEM 122) 2. PESTICIDES,FERTILIZERS, AND TREATMENT CHEMICALS WILL BE STORED UNDER COVER (E.G., PLASTIC SHEETING, TEMPORARY ROOFS, WITHIN A BUILDING, OR IN WEATHER-PROOF CONTAINERS) TO PREVENT DISCHARGE OF POLLUTANTS THROUGH MINIMIZATION OF CONTACT WITH STORMWATER. STORAGE OF SUCH MATERIALS WITHIN THE PROJECT AREA WILL BE MINIMIZED TO THE EXTENT POSSIBLE. (CSW PERMIT ITEM 12.3) 3. HAZARDOUS MATERIALS AND TOXIC WASTE (E.G., OIL, DIESEL FUEL, GASOLINE, HYDRAULIC FLUIDS, PAINT SOLVENTS, PETROLEUM-BASED PRODUCTS, WOOD PRESERVATIVES, ADDITIVES, CURING COMPOUNDS, AND ACIDS) WILL BE STORED AND DISPOSED OF IN COMPLIANCE WITH MINNESOTA RULES CHAPTER 704$ INCLUDING SECONDARY CONTAINMENT (AS APPLICABLE). HAZARDOUS MATERIALS WILL BE PROPERLY STORED IN SEALED CONTAINERS TO PREVENT SPILLS, LEAKS, OR OTHER DISCHARGES AND PREVENT PRECIPITATION FROM FALLING ONTO THE CONTAINERS OR STORED HAZARDOUS MATERIALS. (CSW PERMIT ITEMS 2.3 AND 12.4) 4. SOLID WASTE WILL BE COLLECTED, STORED, AND DISPOSED OF PROPERLY IN COMPLIANCE WITH MINNESOTA RULES CHAPTER 7035. THIS INCLUDES STORAGE WITHIN COVERED TRASH CONTAINERS AND DAILY REMOVAL OF LITTER AND DEBRIS. STORAGE OF SOLID WASTE WITHIN THE PROJECT AREA WILL BE MINIMIZED TO THE EXTENT POSSIBLE. (CSW PERMIT ITEM 12 5) 5. PORTABLE TOILETS WILL BE LOCATED AWAY FROM SURFACE WATERS AND POSITIONED AND SECURED TO THE GROUND SO THEY WILL NOT BE TIPPED OR KNOCKED OVER. SANITARY WASTE WILL BE DISPOSED OF IN ACCORDANCE WITH MINNESOTA RULES, CHAPTER 7041. PORTABLE TOILETS WILL BE PERIODICALLY EMPTIED AND THE WASTE HAULED OFFSITE BY A LICENSED HAULER. (CSW PERMIT ITEM 12.6) 6, VEHICLE FUELING WILL ONLY OCCUR IN DESIGNATED AREAS. SPILL KITS SIZED APPROPRIATELY FOR THE AMOUNT OF REFUELING TAKING PLACE WILL BE LOCATED. SPILL KITS WILL BE CLEARLY LABELED AND CONTAIN MATERIALS TO ASSIST IN SPILL CLEANUP INCLUDING ABSORBENT PADS, BOOMS FOR CONTAINING SPILLS, AND HEAVY-DUTY PROTECTIVE GLOVES. SPILLS WILL BE REPORTED TO THE MINNESOTA DUTY OFFICER AS REQUIRED BY MINNESOTA STATUTES, SECTION 115.061. (CSW PERMIT ITEMS 2.3 AND 12.7) a. ANY FUEL TANKS BROUGHT ONSITE WILL HAVE PROPERLY SIZED CONTAINMENT MD WILL NOT BE TOPPED OFF TO AVOID SPILLS FROM OVERFILLING. FUEL TANKS WILL MEET INDUSTRY STANDARDS (DESIGNED TO HOLD FUEL TYPE, PROPERLY MAINTAINED, NOT ILLEGALLY MODIFIED, NOT MISSING LEAK INDICATOR FLOATS FOR DOUBLE WALLED TANKS, SIGHT GAUGES NOT USED, ETC.) OR BE REMOVED FROM THE WORK AREA b. GUIDELINES FOR SPILL PREVENTION AND RESPONSE INCLUDE: - TAKE REASONABLE STEPS TO PREVENT THE DISCHARGE OF SPILLED OR LEAKED CHEMICALS, INCLUDING FUEL, FROM ANY AREA WHERE CHEMICALS OR FUEL WILL BE LOADED OR UNLOADED, INCLUDING THE USE OF DRIP PANS OR ABSORBENTS UNLESS INFEASIBLE; - PERFORM REGULAR PREVENTATIVE MAINTENANCE ON TANKS AND FUEL LINES; - INSPECT PUMPS, CYLINDERS, HOSES, VALVES, AND OTHER MECHANICAL EQUIPMENT ONSITE FOR DAMAGE OR DETERIORATION; - DO NOT WASH OR RINSE FUELING AREAS WITH WATER - MAINTAIN ADEQUATE SUPPLIES TO CLEAN UP DISCHARGED MATERIALS AND PROVIDE AN APPROPRIATE DISPOSAL METHOD FOR RECOVERED SPILLED MATERIALS; - REPORT AND CLEAN UP SPILLS IMMEDIATELY AS REQUIRED BY MINNESOTA STATUTES, SECTION 115061, USING DRV CLEAN UP MEASURES WHERE POSSIBLE; AND - MAINTAIN COPIES OF SAFETY DATA SHEETS SDSS FOR HAZARDOUS MATERIALS ONSITE IN LOCATIONS READILY AVAILABLE EMERGENCY RESPONDERS. 7. IF VEHICLE AND EQUIPMENT WASHINGING IS IS NECESSARY, SSARY, A VEHICLE WASH STATION WILL BE LOCATED N A DESIGNATED AREA. RUNOFF FROM THE WASHING AREA WILL BE CONTAINED IN A SEDIMENT BASIN E WASTE FROM THE WASHING ACTIVITY WILL BE PROPERLY DISPOSED OF. ANY SOAPS, DETERGENTS, OR SOLVENTS WILL BELNOTPROPERLYUSED AND STOD. DETERGENTS AND OTHER CLEANERS NOT PERMITTED FOR DISCHARGE WILL NOT BEERE USED. (CSW PERMIT ITEMS 2.3 AND R OTHER 6. OF THE JECT TORAG LL ND DISPO A I OF ONCRETE CONCRETE ANOTHER WASHOHOUT UT WA TIES. IF NECESSARY,TWSTES DESCRIPTION OF THE STORAGE AND DISPOSAL OF CONCRETE AND OTHER WASHOUT WASTES SO THAT WASTES DO NOT CONTACT THE GROUND WILL BE ADDED . (GSW PERMIT ITEMS 2.3 AND 12.9) 8.0 PERMANENTCOVERMDPERMIT-.MRMINATIONCONOITIONS: 1. THE AREAS DISTURBED DURING CONSTRUCTION WILL BE STABILIZED WITH PERMANENT COVER UPON COMPLETION OF WORK. PERMANENT COVER MAY BE VEGETATIVE OR NON -VEGETATIVE, AS APPROPRIATE. ESTABLISHMENT OF PERMANENT COVER MAY INCLUDE THE FOLLOWING ACTIVITIES: SEEDING, MULCHING. AND EROSION CONTROL BLANKETS. (CSW PERMIT ITEM 5.17) 2. FOR A CONSTRUCTIONSITE TO ACHIEVE 'PERMANENT GOVER', THE FOLLOWING REQUIREMENTS MUST BE COMPLETED PRIOR TO TERMINATION OF PERMIT COVERAGE: (CSW PERMIT SECTIONS 4 AND 13) a. ALL SOIL DISTURBING CONSTRUCTION ACTIVITIES HAVE BEEN COMPLETED AND PERMANENT COVER HAS BEEN INSTALLED OVER ALL AREAS. VEGETATIVE COVER CONSISTS OF A UNIFORM PERENNIAL VEGETATION WITH A DENSITY OF 70% OF ITS EXPECTED FINAL GROWTH. VEGETATION IS NOT REQUIRED WHERE THE FUNCTION OF A SPECIFIC AREA, DICTATES NO VEGETATION (SUCH AS IMPERVIOUS SURFACES OR THE BASE OF A SMO FILTER). b. ALL SEDIMENT HAS BEEN REMOVED FROM CONVEYANCE SYSTEMS, INCLUDING CULVERTS. c. ALL TEMPORARY SYNTHETIC EROSION PREVENTION AND SEDIMENT CONTROL BMPS HAVE BEEN REMOVED. BMPS DESIGNED TO DECOMPOSE ONSITE MAY BE LEFT IN PLACE. WITHIN W DAYS AFTER THE TERMINATON CONDITIONS ARE COMPLETE. A NOTICE OF TERMINATION (NOT) FORM WILL BE SUBMITTED TO THE MPCA. 1I a i " Et Km GL m 0. YC Ka m LAF I Mn KC Fm Mm KF FI •� YE W m Km " Kn Na zrtz Ula L CF FC bt m W W _yT KM .01 L Ka Ka w Kne NIC ✓ KN KT IU W RL lbM LAI FC K` Kf KO 1IIW L29 Iw{ Kn KW L}1E 131f1 L7nLaA u l AE u um uu W w3 uu w EP {wA t� Looe jy LAI at LYti��y%\iw Lam u 1 p' //pLN�•�La Lm um E Y� _1 m w 1 LA° LEa,L LM ` KC •C Ka . I m1 LYA2 K":'� KC ([ LaF um u n. -f <_ LIM uv KCl K)ti XCa K. uE .Kw w� uIiA rr u w M V/rtL/N LIL 4 �sry.Le9rcOm T6gN1>C41C•MM qI� a EPa.�wW Om••FN••WT O FgMel - Aea� Wwr E�weT Wawm..v+M _ANlwwwEwwblE�s 0 10.04 20,M PMC MMWRH SUNWFACE WATATE0.5 MD NXL TYPES CA.aaoo $GLEN FEET Stmnwaw NN440n P/Erentim Pon C C. 'ay, MMwuM In iw GOPHER STATE ONE CALL: CALL BEFORE YOU OIG. tE00-252-1188 W. DESIGN T6gN1>C41C•MM qI� a EPa.�wW FmpolEa AS SHOWN LANDSLIDE REPAIRS CA.aaoo MANKETwINre oarvE w,.,, HCRRA CFiANHASSEN,MN tENGINEEWNG EPF MINNEA SMN ss•u ua MINNEAPOLIS, MN STORM WATER POLLUTION PREVENTION PLANNOBy A .Wr LINK P.PATE REVISION DESCRIPTION FF-Wl°".l (SWPPP) C p T ANTE RELEA6EG z -An Aa1 - 0h - _ _ - --`\`- %�/�% //�/' f SOUIHME4 cuLVERT OURET - Z AND SME C9 REPNR 1 I E SHEETC I3 _- •�/I/�� - \\PZ$ NS PZ 1 �! PROPERTY LINE RVP) rNEN TNAII SE - G0 LET _ `- CONSTRIICTION LIMITS 1 Po LAN: TRAIL MODIFIClATIONS Q w ar SCPLE IN FEET ---- - 1 � �'� —� — I �NORIII £31iEI�ARNiFn ��•� NEW FENCE 5E� 1 -� f-7: 14410 R F li�� —rs�� •` -T 12W0T FF T � - "STING NORTH PIPE J ` - 1. ST 0 1 $ 1 1 NEW STORM SEWER. _-- SEE SHEET GI3 CONSERVATION EASEMENT ONTO 3^0 0h - _ _ - --`\`- %�/�% //�/' f SOUIHME4 cuLVERT OURET - Z AND SME C9 REPNR 1 I E SHEETC I3 _- •�/I/�� - \\PZ$ NS PZ 1 �! PROPERTY LINE RVP) rNEN TNAII SE - G0 LET _ `- CONSTRIICTION LIMITS 1 Po LAN: TRAIL MODIFIClATIONS Q w ar SCPLE IN FEET ---- - 1 � �'� —� — I �NORIII £31iEI�ARNiFn ��•� NEW FENCE 5E� 1 -� f-7: 14410 R F li�� —rs�� •` -T 12W0T FF T � - "STING NORTH PIPE J ` - 1. ST 0 1 $ 1 1 NEW STORM SEWER. _-- SEE SHEET GI3 CONSERVATION EASEMENT ONTO tar VC $ry m tarV6 a�u __--_ --- UU <J A� a 025: ydo, FWL911EDTRIJLOMOE $m <W Fw 1ro0 2ro0 3-W 4M 5W REVISION DESCRIPTION 11Mi��.MM4� taut 11E MAreff� RELEggEO U TOIFOR 1pATEREIE/9® 6K0 TAW 8M 9q0 10+00 11M0 12b 13W0 in PROFILE: TRAIL MODIFICATIONS 0 50 100 0 5 t0 HOR23CALEN FffT VERT. SCNENFFET - = 'S$1 019 LANDSLIDE REPAIRS 4" ENOINEE 1147 CO. 1L112118 BARR4.MARKE oIN EORrvE o n EPE HCRRA CHANHASSEN, MN D Sun42oo — MNNEAPOLIS.MN ss43s ^^� MINNEAPOLIS.. MN TRAIL MODIFICATIONS Z F�+e rwwa++s. m,eaosa-sn �� RARR PLAN AND PROFILE 14.00 15 00 tY= 90% DESIGN 23101014.04 CLIENT PROJECT W. FG OFFSET 2+00 -w — — -d 1n a Te m w m w FO OFFSET 2+50 e Bm � f Bm Bm I Bw Bm \\ BID eao 44t -- �i RR, INEERING CO 4m4REP01NTE 0RNE B .m HCRRA EPF 1830 r11P2 ew Bm MwNewvais.MN ssaas Rd�SmI A 1 B C 0 0 1 1 2�Ye°w"°' eew^m Bm 0m OATEREIFAS® ' 830 820 Ll 810 810 LiSBOE TrNP.) e% 000 Bpp Tn- 8+0 Bxo -w — — -d 1n a Te m w m w FO OFFSET 2+50 „_ore. Bm � f Bm Bm I - Bm Bm \\ BID eao 44t -- �i RR, INEERING CO 4m4REP01NTE 0RNE B .m HCRRA EPF 1830 r11P2 ew CROSS SECTIONS MwNewvais.MN ssaas Rd�SmI A 1 B C 0 0 1 1 2�Ye°w"°' eew^m BARR 0m OATEREIFAS® FG OFFSET 4+00 I FG OFFSET I+50 TBB3 GRamO Trm.) /n FG OFFSET 3+00 Bm s%__ _Ai Bw – Bao eao �' Bm B10' –y i ero - - _. _ .810 eto --B�oo 800. B 10 m m -in 50B 250 FG OFFSET 3+50 tI xoTg r s55 j ON TRAIL MCIX0IB.INOLUDING 2%CROSS I SLOPE ON TRAIL SURFACE. FG OFFSET 5+W „_ore. oENmG ASmw �"1PRO1CiNe- 44t -- �i RR, INEERING CO 4m4REP01NTE 0RNE B .m HCRRA EPF 1830 r11P2 rral®..n CROSS SECTIONS MwNewvais.MN ssaas Rd�SmI A 1 B C 0 0 1 1 2�Ye°w"°' eew^m BARR 0m OATEREIFAS® ' 830 820 Ll LiSBOE TrNP.) e% Bf0 8+0 Bxo Ix Ix Boo eaB \ B10 2w 8101 Amo i w0 810 Qa Q an -m -18 8 18 Boo m m m n an In 1T. FG OFFSET 3+00 Bm s%__ _Ai Bw – Bao eao �' Bm B10' –y i ero - - _. _ .810 eto --B�oo 800. B 10 m m -in 50B 250 FG OFFSET 3+50 tI xoTg r s55 j ON TRAIL MCIX0IB.INOLUDING 2%CROSS I SLOPE ON TRAIL SURFACE. FG OFFSET 5+W „_ore. oENmG ASmw �"1PRO1CiNe- R. -- �i RR, INEERING CO 4m4REP01NTE 0RNE B .m HCRRA EPF [l0 r11P2 rral®..n CROSS SECTIONS MwNewvais.MN ssaas MINNEAPOLIS, MN Rd�SmI A 1 B C 0 0 1 1 2�Ye°w"°' eew^m BARR ani rOFOR OATEREIFAS® ' 830 e% Bxo Ix Ix 'Bzo \ B10 8101 Amo i w0 810 Boo 000 I 380 1m Tn- >w o �o so -m -1B B 1B m n m w n m n n 1odB0 MI „_ore. oENmG ASmw �"1PRO1CiNe- R. -- �i RR, INEERING CO 4m4REP01NTE 0RNE B .m HCRRA EPF [l0 r11P2 rral®..n CROSS SECTIONS MwNewvais.MN ssaas MINNEAPOLIS, MN Rd�SmI A 1 B C 0 0 1 1 2�Ye°w"°' eew^m BARR ani rOFOR OATEREIFAS® ' 830 Bxo Ix Ix 'Bzo \ 8101 Amo i w0 810 000 380 1m Tn- MI Ao -m n0 0 10 m m m n n m n n tmm FG OFFSET SWO eao – ero — +� FG OFFSET 5+55 20 -136-1w 150 FG OFFSET 7+00 w®. «. T16av+L✓mFarrwTaNw T rws.�Ao®+wn..�LeBea.oMTmAo.aNmw®OP.Ts „_ore. oENmG ASmw �"1PRO1CiNe- R. -- �i RR, INEERING CO 4m4REP01NTE 0RNE B .m HCRRA EPF �"°° r11P2 rral®..n CROSS SECTIONS MwNewvais.MN ssaas MINNEAPOLIS, MN Rd�SmI A 1 B C 0 0 1 1 2�Ye°w"°' eew^m BARR ani rOFOR OATEREIFAS® ' BTTP2 \ 8101 810 Tn- 2m ~ w' IBB 'S0w Q ao -m -lo o ro no w m w w m w m wo 110 1m 1m 1m 1wQ` w®. «. T16av+L✓mFarrwTaNw T rws.�Ao®+wn..�LeBea.oMTmAo.aNmw®OP.Ts „_ore. oENmG ASmw �"1PRO1CiNe- R. -- �i RR, INEERING CO 4m4REP01NTE 0RNE B .m HCRRA EPF �"°° r11P2 rral®..n CROSS SECTIONS MwNewvais.MN ssaas MINNEAPOLIS, MN Rd�SmI A 1 B C 0 0 1 1 2�Ye°w"°' eew^m BARR ani rOFOR OATEREIFAS® ' BTTP2 90% DESIGN NOTFORCONSTRUCTION LANDSLIDE REPAIRS �"1PRO1CiNe- 23101014.04 CHANHASSEN, MN cuENr PROTECT w. TRAIL MODIFICATIONS m,Gr, No CROSS SECTIONS Gpg p FG OFFSET ]+50 FG OFFSET 8+00 m SP BIG Bm wo m0 tl.V Ba K a!4 \ NOT FOR CONSTRUCTION Bm 1H+T>ro R.xa�riiRN. ue I rma P�wBFi�V�1RW.ao ix[ B "*itENG SWRENGINEEAING CO. Brlr 830 SII LANDSLIDE REPAIRS CHANHASSEN. MN mp BBRR PROJECT NO. 23101014.04 / 121YA18 / azo 810' x30 —MBYFAPOUS. MN ssB'� rm.r� a>mun rr�.. ria v�em�.l�al MINNEAPOLIS, MN a% alENr rlw[crNo. t% \ h0 m0 ax A B C D 0 1 2 Rran'a1m Osy/N flora DWG. NII C REv. NO, D / Bm tso INR LIEBrg. WTE SFIF%ED R.1sOGV-En ._Bop -No 3qp -m a 10 m m a 0, Tm Bm � Tm 810, T% JO +tl -A -t0 0 low mm m m A m m tm 110 121 FG OFFSET 8+00 7m50 i0 -30 -m -t0 0 10 20 30 Op W W ]0 m m tOp FG OFFSET B 50 m SP BIG Bm wo m0 Ba K a!4 \ NOT FOR CONSTRUCTION Bm 1H+T>ro R.xa�riiRN. ue I rma P�wBFi�V�1RW.ao ix[ B "*itENG SWRENGINEEAING CO. Brlr 830 SII LANDSLIDE REPAIRS CHANHASSEN. MN BBRR PROJECT NO. 23101014.04 121YA18 / 820 ero. x30 —MBYFAPOUS. MN ssB'� rm.r� a>mun rr�.. ria v�em�.l�al MINNEAPOLIS, MN a% alENr rlw[crNo. t% \ em Bao ax A B C D 0 1 2 Rran'a1m Osy/N flora DWG. NII C REv. NO, D / BW � INR LIEBrg. WTE SFIF%ED R.1sOGV-En ._Bop -No 820 -m a 10 m m a 0, 7m50 i0 -30 -m -t0 0 10 20 30 Op W W ]0 m m tOp FG OFFSET B 50 FG OFFSET 0+00 m SP BIG Bm wo m0 Ba K a!4 \ NOT FOR CONSTRUCTION Bm 1H+T>ro R.xa�riiRN. ue I rma P�wBFi�V�1RW.ao ix[ Hero wive "*itENG SWRENGINEEAING CO. Brlr 830 SII LANDSLIDE REPAIRS CHANHASSEN. MN BBRR PROJECT NO. 23101014.04 121YA18 / .rw�NrrE m01 x30 —MBYFAPOUS. MN ssB'� rm.r� a>mun rr�.. ria v�em�.l�al MINNEAPOLIS, MN a% alENr rlw[crNo. t% \ ni ax A B C D 0 1 2 Rran'a1m Osy/N flora DWG. NII C REv. NO, D / BW Bm INR LIEBrg. WTE SFIF%ED R.1sOGV-En —4k, -No 820 -m a 10 m m a 0, Bm 810, B10 � `\ apo / mo mol \ Tm,, em Co -a aB -m -10 0 10 m m a im m o -m 40 0 a m m a m m ro m m 10 FG OFFSET 0+00 FG OFFSET B.W BWmo ew � �____—_ EX"NG GROUND jrvP) -'r az ax em �/ Lm0 FINISHED GRROE (TP.) �emm� - — — - eml po dD JO JD -10 -10 0 td m a p so FG OFFSET 10100 m SP BIG Bm wo m0 Ba K a!4 \ NOT FOR CONSTRUCTION Bm 1H+T>ro R.xa�riiRN. ue I rma P�wBFi�V�1RW.ao ix[ Hero wive "*itENG SWRENGINEEAING CO. Brlr 830 HCRRA LANDSLIDE REPAIRS CHANHASSEN. MN BBRR PROJECT NO. 23101014.04 121YA18 / .rw�NrrE m01 —MBYFAPOUS. MN ssB'� rm.r� a>mun rr�.. ria v�em�.l�al MINNEAPOLIS, MN \ 830 alENr rlw[crNo. NrtPz ni ax A B C D 0 1 2 Rran'a1m Osy/N flora DWG. NII C REv. NO, D Bt0 BW Bm INR LIEBrg. WTE SFIF%ED R.1sOGV-En —4k, -No m ,m -m a 10 m m a 0, BIG `\ em / mol em Co -a aB -m -10 0 10 m m a W m o m m\ 10jw FG OFFSET B.W BWmo ew � �____—_ EX"NG GROUND jrvP) -'r az ax em �/ Lm0 FINISHED GRROE (TP.) �emm� - — — - eml po dD JO JD -10 -10 0 td m a p so FG OFFSET 10100 B50 Bao e3p 8311 FG OFFSET 10 50 FG OFFSET 11x00 21 m m m m SP BIG Bm wo m0 Ba K a!4 \ NOT FOR CONSTRUCTION Bm 1H+T>ro R.xa�riiRN. ue I rma P�wBFi�V�1RW.ao ix[ Hero wive "*itENG SWRENGINEEAING CO. Brlr 830 HCRRA LANDSLIDE REPAIRS CHANHASSEN. MN BBRR PROJECT NO. 23101014.04 121YA18 / .rw�NrrE m01 —MBYFAPOUS. MN ssB'� rm.r� a>mun rr�.. ria v�em�.l�al MINNEAPOLIS, MN \ 830 alENr rlw[crNo. NrtPz TRAIL MODIFICATIONS CROSS SECTIONS B10 A B C D 0 1 2 Rran'a1m Osy/N flora DWG. NII C REv. NO, D Bt0 / INR LIEBrg. WTE SFIF%ED R.1sOGV-En —4k, -No m ,m -m a 10 m m a 0, B50 Bao e3p 8311 FG OFFSET 10 50 FG OFFSET 11x00 21 m m m m SP BIG Bm wo FG OFFSET 11 50 80 - 820 BLOW//1, .10 QO -10 O 10 FG OFFSET 12-M 8,50 _ Y eau 830 �// em _a _ BIG - W BEE GW `t0 FCRFURTIERDETNL3 ON TRUL S SECTIONS. INCLUDING 2% MOM sLOPE ON 1-SURFFCE. t�/b/V% J DESIGN NOT FOR CONSTRUCTION 1H+T>ro R.xa�riiRN. ue I rma P�wBFi�V�1RW.ao ix[ Hero wive "*itENG SWRENGINEEAING CO. Brlr 1551ONT HCRRA LANDSLIDE REPAIRS CHANHASSEN. MN BBRR PROJECT NO. 23101014.04 121YA18 .rw�NrrE —MBYFAPOUS. MN ssB'� rm.r� a>mun rr�.. ria v�em�.l�al MINNEAPOLIS, MN alENr rlw[crNo. NrtPz TRAIL MODIFICATIONS CROSS SECTIONS 9r+u. A B C D 0 1 2 Rran'a1m Osy/N flora DWG. NII C REv. NO, D NO By /aP LUTE REVISION DESCRIPTION INR LIEBrg. WTE SFIF%ED R.1sOGV-En L -OS Y 11 5" TOPSOIL AND SEED TYR) PREPARE TOP IY OF SUBGRME IN ACCORDANCE WRIT MMOT STANDARD 2112 NOTES'. TEST SUBGRAOE PRIOR TO AGGREGATE SIDE 1S ------------ T �ICK \\ CI -ASS SPECIAL AGGREGATE SURFACING \ cuss SP:CIAL \ (SEE rAalE 1 FOR cRADAnoN) \ 6" THICK MnOOT CLASS 5 AGGREGATE WE, 1IM1%CRUSHEO \ BASE INSTALLATNIN IN CONFORMANCE MTH TYFE 5 GEOTEMRf FABRIC MnDOT STANDARD SPECIFICATION 2111 IAT ENGINEERS DISCRETKKI) DSECTION: TRAIL MODIFICATION (TYPICAL) - STA. 5+00 TO 7+75 NOTTO S NF NOTES: TEST ROM SUBONOE FRIOR TO AGGREGATE BASE INSTAIUTION IN CONFORMANCE WITH MnDOT STANDARD SPECIFICATION 2111. CUSS SPECML (SEE TABLE 1 FOR GRADATB3N) S THICK MIiD0T CLASS 5 AGGREGATE BASE. 10 Y CRUSHED TYPE 5 GEOTE%TILE FABRIC IAT ENGINEERS DISCRETION) �21 SECTION: TRAIL MODIFICATION (TYPICAL) - STA 1+75 TO 5+00 AND STA. 7+75 TO 12+00 NOT ro. 3V MINUS GRADATION FOR AGGREGATE SURFACING (CLASS SPECNL) SIEVE SIZE FFRCENTPASSING yC 1W as To -1m ND 250 xxm toa0 NOTES: 1. wMINUSAGGREATESURFACINGGIWILBE 100% CRUSHED UMESTONE. 2. Y8" MINUS AGGREGATE SURFACING MUST COME FROM ODUNER MINING & MATERINfi. INC, OF BURNSVRLE. M. IN ORDER TO MATCH COLOR OF EXISTING TRAIL. 90% DESIGN NOT FORCONSTRUCTION 'N �waT LANDSLIDE REPAIR _ _ _ _ _ _ _ BARR ENGINEERING CO. lvl3 19 2.3101014.04 IM FR u 6 _ _ _ _ A�� A990 MARNETPOINTE DRIVE HCRRA CHANHASSEN,MN WENT PROJECT NP. gr.RM D s„I m BMISIi E� ^^� MINNEAVOus.MN ss+2s Oi1e° MTF2 MINNEAPOLIS, MN TRAIL MODIFICATIONS RELEASES A 8 C D D 1 2 .- I'�""' o umsv-nn lagi^^ oV/G ND BY v. NATE REVISION DESCRIPTION T6FOR `AF""""'R''®' Anew TYPICAL SECTIONS C-10 D DAIERElEA4ED ---__=REAlM31®TML • � s r —* 6�O]T AM LEGEND RIPRAP TURF REINFORCEMENT MAT FLEXIBLE CONCRETE GEOGRID -_ -__ -- -_- TURF REINFORCEMENT IMT _- _--_ —L-- -_-- _ % -_ - - - - ----- ----- RBAOJE EJ(IBiING DAIAAGEU RENPHNI-� ZjT -- NIU 6LIP LINE IN EXISTING OIKVERT \_ I FIAREO END SF6TION BEE SHEET C-13 - _ SEE SMEEl C 13 \ J^I I\ _ _ c /_ —J�- j PAQPOBEU dURUGE G"11NNEL WITH FIi.AI&E GONLRETE GEOGRID, BEE SKEET L49 ___ - SCUCULV TOUILETMOUIF":ATMINS. 1 / / SEEBNEET613 �11 PLAN: SOUTH AREA SLOPE REPAIR 4 o m a 90%DESIGN NOT FOR CONSTRUCTION rewrwunEmuae�ur M1raacl new /S SHGMI 99M PROTECT M. a��•roTM•*I•M•gA��+® —_ —_ —_ —_ —_ —_ — BARB ENGINEERING CA. 1L1Y11119 LANDSLIDE REPAIRS 23101014.04 �Nsr•W)f801TEiasR1iE DADn•399 NAIMEfT'pINTEURNE M1� EPF HCRRA CHANHASSEN,MN WENT Rao.TEDT Nn. DMRIR MINNEAPOLIS. MN sass "1TM� MINNEAPOLIS, MN SOUTH AREA SLOPE REPAIR A B C D D 1 2 raP�t u" an roe^ BARR OW 'w RE'/. N^_ W. By N MTE REVISION DESCRIPTION TOIFOR PATE REIFASEO +mvnlo�rr F�'',�,.'°y301 MTP2 PLAN C-11 D t R� fLE%45TNG TRUL liiiii ilii i ii� lii� i� iiil�!i/i• ew 835won iiiiiiiii7■iii iiiliiiiiiillli�iiii ilii iiiiiiiii Bb 8 5 BbMMMMMMM iiiiiliiiiiiiii iiiiiiiiiiiiiiiiii iii &Y 835 805 aza N ma 9,5 a,5 810 010 865 G05 800 800 785 m5 55 N 6 785 Iso leo 5 5 E%ISTING DAMAGED XEADWALL T)0 n0 7fl5 ]65 m 760 765 755 791 750 1 SECTION: SOUTH AREA SLOPE REPAIR o m w SLMf IN FEET [FXIaTM3TRNL an ' eta sae ' e3s els e39 e a us em em 113 915 am 910 emMMM ess m MM em m es Tao es w as 7mmmmmMM zeD 7m 5 m ro as ms m mo 55 55 7w mo Ja JO 30 -10 0 10 A m b w w m w w 100 t10 121 130 1W 150 leo %21 SECTION: SOUTH AREA SLOPE REPAIR 0 A 0a SGYEIN FEET 90% DESIGN NOTFOR CONSTRUCTION I� iluiMRin umiw�clw ssa^m1»nTMTl.u•nu�� ae® ,,, — — — — — — — _ _ _ 42�� -Xeyvaes aSRR ENGwEER1Nc m. E x Dfl aoo MuixETPaN7E ORrvE �Rli sir zoo 606aaa-m1 AS 31M'M HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN� MN 9ARR PROJECT W. 23101014.04 zlvmis cuENT PRaEcr No. o SOUTH AREA SLOPE REPAIR SECTIONS DESCRIPTION I�FREVISION LFaT0.caR ^ 9wiE RpFweEp 1 �� G72 D urPz R� iNiiiii'i liiiii ilii i ii� lii� i� iiil�!i/i• 'iiiliiiiiiiil�iliiiii iiiiiiiii7■iii iiiliiiiiiillli�iiii ilii iiiiiiiii iiiiiiiiiii iiiliiiliiiii iiiiiliiiiiiiii iiiiiiiiiiiiiiiiii iii N ll liiiii liiiii ilii i ii� lii� i� iiiiiiiii iiiiiii iiiii iiiiii 'iiiliiiiiiiil�iliiiii illliiiiiiiiil��l'iiii iiiliiiiiiillli�iiii liiliiiiiiiiiilii�iii iiiiiiiiiiiliiiii`�L��. ��aN�aN�NaN�N��NaNaN�I� MINNESOTA BLUFFS LRT REGIONAL TRAIL — — ,— _ ------ -- - N —9cD� – ���_ _–♦ - –_-- _ _ ___ _ –T _ INSTALLSALVAGEDLPTOE ACLASSN - _y RIPRAP AT SLOPE TOE (20'MIN OEPTH) �_ � - _ _ - -' ` SEE/j\ \ - 11 – i _ _ \ _ –SEE 1 _ _- _ .---'-I-- '♦. 1 L = -_-- - ON SSALlIP119SNEADARCH PIPE EiID BEi _ --- ♦♦ `�� PPOPEATYLIE _Srt _` _ _ STAArRFlW ♦♦ - _\ - - 1 -F-- /) ENDRRRA➢ 1 // SnryGCHANNEL TMLWEGl \\ EN165112.13 Nit9%3 1 - EXISTING STREAM EXTENTS L' \ -_ _ _ \\ ..-.. _ I BOUNDER GROSS VANE 1 INSTALL BN.VA(`£O Mn00TCW5GNRIPRgP STARSRWRAP BE 1 / •. !� l—dam_ � �—_� �—A� �i _V ero -------------------- - - _ ----------- MAIL <—]3, ,1 � BLM LRlE IX4TNG ClRVERT __- __ _-, —WRH9Sx6TCMP. INCLUDES. _IAN. LENGTH INSIDE EXISTING _ CULVERTNID l MIN. LENGTH -\ - SU15ICE EXISTING CULVERT. -SEE 1 - AT SLOPE TOE (24- MIN. DEPTH) E.10 1 - sEE 1 NOTES. 1. START ANO END GOORDINATE3 FOR SALVAGED RIPRAP AT SLOPE TOEDEUNEATEETENTSALONGIENGTHOFCHANNEL VERIFYALL LOCATIONS IN THE FEW WRH ENGINEER PRIOR TO INSTALLATION 2. REMOVE DEBRIS IN CHANNEL AS NECESSARY FOR WORK DEBRIS REMOVAL INCIDENTAL TO SALVAGED RIPRAP INSTALLATION. 3. MINOR GRADING MAY BE NECESSARY ON SLOPE ABOVE PLACED SALVAGED RIPRAP SLOPE SHALL THE IN WITH TOP OF RIPRAP. INCIDENTAL TO RI PLACEMENT. BY INSTALL RIPRM STLLING WIN (BOTTOM EL. Tb &5) SE;!!ZS 77 { I BOUNDER CRASS VANE SEEe1 -�I I- --I 1 PLAN: SOUTH AREA CULVERT OUTLET AND STREAM13ANK REPAIR 4 - 0 A 'b SCALE IN FEET PROPOSED DRAINAGE CHANNEL Wrt FLEXIM E CONCRETE GEOGRID, SEE SHEET G-19 I� I- I- I- I- I- I- I- I- I- I - N LIMITS 90% DESIGN 9RCONSTRUC7101 CBARRP EOT No. 23101014.04 CLIENT PROJECT No. DWG. Na RI C-13 AeynrW sNaA�A[Dm•e"Mmut9lwvb:l ID>enw•"'uTMT''WUAr'®® sABrt�i_ ®1>RA_sv>� ..•E — — — — — — — ^k cra 04RR ENGINEERINO Co pp <300 MwRKETPOINrE DRIVE DARR Sun -2. MINNEAPOLIS, MH55,35 �.a„ � °�` /S SNOWN P"' +vtYlO,s HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN, MN EPF `"v1e° ucH SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR PLAN A B C O 0 1 2'r•�a x.mm BARR DATE REVISION DESCRIPTIONRF$ED ��� v,A,m aKH 90% DESIGN 9RCONSTRUC7101 CBARRP EOT No. 23101014.04 CLIENT PROJECT No. DWG. Na RI C-13 6 \ METING GROUND RHE -ED GFPDE REMOVE E%I$nNG CONCRETE HEAONALL FILL MNUWS WITH CLSM NIGH DENSITY GROUTPERMDOT2519.3AZ IN6TALL--ASTM 1155C, GR36, qi p38 THREADED RCD(G V.). 6' MINIMUM EPDXY GROUT EMBED (6) EA. RON, ECUMLV SPACED b/.ry ORIGIN CONCRETE AROUND CIRCUMFERENCE. OUT ROD R-USHWRH NUT 1c. �{ CULVERT NRNISHAW IERTA OMTIRATORTOV RIFYSNING EXISTING CULVERT. R SIZE - - - AN NOTIFY ENGINEER AND FIT WTHE FIELD AND NOTIFY ENGINEER OF ANY DISCREPANCIES FIRM TO ORDERING. FURNISH AND INSTALL 95'a6]'GS PIPEAPRON 1'p Z{ Zd E%ISTMG GRIXRED MNULUS(ASSUMED) Sm. 2 MIL EXISMGB'SPANCMFA BT APPROXy EXIBTNG GROIft VERIFIGTpN PgtT IXI5ONG SY1D PAp( EXISTING A' SLOTTED PJC E%ISnNG GROUT ORIGINAL CONCRETE EXISTMDRRRA➢ UNOERORNN MLECTpN PORT CULVERT TYPE A GEOTEXRE FABRIC zs-OFCMRSEFILH %ISGROII! TING==E. AGGREGiTE. MNOr 31a9z H E.N VOID E%ISTING GEOTEXTILE (FEB.mtfi) E%ISTING TIMBER PILES PULE SLLVAGEO. LU55III. OR CLASS N RIPRAP BENEATH FLARED END SECTION AS NEEDED TO FACILNATE COARSE APPROOL 3S FILTER AGGREGLTE PLACEMENT. THIS RIFRM MATERNL ANO PUCEMEM IB INCIDENTAL TO FLARED END SECTKKi. i11 SECTION: CMPA CULVERT SLIP LINE ]5s e1 FINISHED GRADE 01 750 ]60 I B]' WRI WIDTH -30') 6P(STREAM WIDTH -20) 36'R41O RIPRAP EXISTING GROUND I ]M - Ttl EXlWRX3DRDIRO 12 BJ GRANULM BEDDING �J0 .ip -m -10 0 10 m EL )62M \\ 2Q SECTION: STREAM CHANNEL (30' BOTTOM WIDTH) BOULDER LROSS VANE 0 10 m FINISHEDGRADE _ 750 760 FLARED END SECTION \_ m -R,5I 1Y 1Y 2 EXTENSION EL. 74395 EL 743M. 6:1 745 J i __ _ - 35' R6]0 RIPRhP �_`_ . _ ]46 ]m ` 13'83 GRANUUR REDOING r 1414 FH81®DIVDE - -- i 30' RZTO RIPRAP 140 _ T4 FXI3TING GROUM ]w B3GRANUR BEDDING) _ _ _ __ _ t2U - -EL. ]<p 05 T4 / 31Y RDAP 0 RIPR �-\ BOULDER CROSS VANE - tl \\X 7 / `/ 1203 GRAHAM BEDDING �JO 0� C IgOC C 2,37C .TO -20 -10 p tp XI 3p %41 PROFILE: CULVERT OUTLET AND STREAM CHANNEL �1 SECTION: STREAM CHANNEL (20' BOTTOM WIDTH) o m 4 C 1D m 0 10 m ......... 90% DESIGN HdUZIXITAL SLALENfEET VERTIGLSLAIE NFEET SCALE NFEETi�Psu M NGT FGcRu mnss�IA9attwNTwIITT®OlTuTlieIINM �IlmAIOIueMRw -- NeN DAT. AB sIawTT LANDSLIDE REPAIRS°"------RMR n1N. E30IE:1Tc_ 4o. YoIM/Wra�wdtR6�In1Eotn HPI®4 — —YAV 7 - ENGINEERING CO m MINNEAPOLIS, MN ss4u F�1I�i��t IWIMOw PF ew HCRRA MINNEAPOLIS, MN CHANHASSEN,MN 0.04 2FO3Ro1 rN ERN/PPr SOUTH AREA CULVERT OUTLET REPAIR PROFILE AND SECTIONS A B c o 0 1 Z C-14 D No. BY DATE REVISION DESCMPNON .APP t®E. T6sOR GATE RELEASED R -YZ�T uw E nNCG ND ElEVA7NIN 3 BOTRIM EL. Ip BS EIfV. E1 .__'.. _.. 3P RZ10 RIPRAP SECTION VIEW D J50.30 J50.30 1T 03GRANULFR BEOOING r EIDBTNG GRgMD ---�- 1 EL ]OBS ---------- ELlY3.65 3 3 �1 eonoM EL Sao a5 3V R310 RlF IY B3 GR UUR BEDDING SECTION VIEW C 3B BWD)EA ElEVA7NIN POINTS EIfV. E1 EIEV. El FLEV. E3 US Vb4E J50.30 J50.30 ]$i.30 DsvuEE ]am ]aBn 7471 RELEn A I B IC O 0 TOIEOR MTEREMARED _ -- yy 91RR ENGINEERING CO. OWMMKE]PDINTE DRNE Sine 3N - MINNFMWS. MN SSt35 9rActx.nn Inl�an�� a�lssao-32aol PLAN VIEW 2 DETAIL. STILLING BASIN No3]o scnLF LANDSLIDE REPAIRS HCRRA CHANHASSEN, MN MINNEAPOLIS, MN SOUTH AREA CULVERT OUTLET REPAIR SECTIONS AND DETAILS 90% DESIGN NOT FOR CONSTRUCTION EMS W SLOPE i / l TOPSOCANDSEED 3 exm P 5iXEM1 BED �',T. ELL WITH IXGV�TED STREW B'E(D�EN/T%Qi]4LLJ% T ISL/// --�� IXGVdTED STNFAV BED IMTEHNLIOOMPM1j "N THICKS V�EDRIPN (MIIWTCUpB pal -- � - p•THCK KNDOTORNNDIM FlLTEN EXETINO mE OF BPW( i DETAIL: RIPRAP TOE PROTECTION DET m scuE 90% DESIGN LANDSLIDE REPAIRS — — — — — — TM*^P,E" svw ENcwmpNc co. .04 ,.; _ y dYp MARKETPoINTE DRNE HCRRA CNANHA nIENrZ2310101 sr,rtarrrsor� — � Sure 30E EIK NINNEn LIS. MN 5AM / MINNEAPOLIS, MN STREAMBANK REPAIR v A I B I C I D D 1 2 °o°'�'"�OP�*'• H�.�z-- P.+Kw &IRR NO. BT K _ MTE REVISION DESCRIPTION Tpspi GTE REI.EpBfDm.v�n�` roPa.. Npy DETAIL C-16 D 8 ------------ � 11111 \I \ \J .•,{ /� ___�---•_-_ _r \IN�-\ \ `^_ / ``���� ExISnNO WERANDf 1 PFRTYLWE I \\I\ `� � � ° ., • �, � \ � �_. - � - caamucnan-LlARB. _ - _ _ \\YP I � °°T�'TS � _ ' - -, �' _ I PROPOSE➢ STORM SEWER ��' _. _ SEE I e19 ----------------- eta _ '�Qy� 818 •. REVISION DESCRIPTION RE c•TOIFOR g� w o c u M WTE REtEAREO ' _____i,T EIfISIMpFENQ \� - _ T _ ' -r - , ° L - - '- -Y- _ _ --- -_ _ _ - --__ - _ 80 _ - a - _F���INSTALL IEW CIWNINN FENLE '-- -A 9___________ ts._an MaEEOTAeDFf3lRTREOIOWLTt01� c1 ------------ RLL"lsnwlroPWI1RG -- -__-_ _______ -- -AND ABANDDN IN PucE. - _ __ — --- - ---------- _-___-__- _ _-_- -/ 1 - PROTECT E%ISR1G IEApNALL � � � 'r _ . _ L CONSERVAnONEASEMENT BOUNDARY —F AREATOEL.8109 (COMMON EMBANIQ./IEINTI E%LSnNG I. E. SIBS (9ERNY W FlEID PRpR TO DOMIStRF/a.I GRMMD) 1 PLAN: NORTH AREA SLOPE REPAIR B m b 2 Sf.4EIN FEET SARR ENGINEERING CO. 4300 MARKETPOINTE ➢RIVE Sub 200 W WIFIiPoLAti. M155 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN NORTH AREA SLOPE REPAIR PLAN 90% DESIGN NOT FOR CONSTRUCTION �- CRUSHED CUSS III RiPRAP _ _ -- - > ��-.. _ --------- ao— _ - __-____ --- - - �- --� _ — — _ ' - -, �' _ I PROPOSE➢ STORM SEWER ��' _. _ SEE I e19 ----------------- eta _ '�Qy� 818 •. REVISION DESCRIPTION RE c•TOIFOR g� w o c u M WTE REtEAREO ' _____i,T EIfISIMpFENQ \� - _ T _ ' -r - , ° L - - '- -Y- _ _ --- -_ _ _ - --__ - _ 80 _ - a - _F���INSTALL IEW CIWNINN FENLE '-- -A 9___________ ts._an MaEEOTAeDFf3lRTREOIOWLTt01� c1 ------------ RLL"lsnwlroPWI1RG -- -__-_ _______ -- -AND ABANDDN IN PucE. - _ __ — --- - ---------- _-___-__- _ _-_- -/ 1 - PROTECT E%ISR1G IEApNALL � � � 'r _ . _ L CONSERVAnONEASEMENT BOUNDARY —F AREATOEL.8109 (COMMON EMBANIQ./IEINTI E%LSnNG I. E. SIBS (9ERNY W FlEID PRpR TO DOMIStRF/a.I GRMMD) 1 PLAN: NORTH AREA SLOPE REPAIR B m b 2 Sf.4EIN FEET SARR ENGINEERING CO. 4300 MARKETPOINTE ➢RIVE Sub 200 W WIFIiPoLAti. M155 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN NORTH AREA SLOPE REPAIR PLAN 90% DESIGN NOT FOR CONSTRUCTION IRS BIB ms 825 m0 815 BID m No Tm TOO )m Tm m EXISTING PROPERTY — _- —. ___-`�EKIsnNGGawND PROTECTM HEADWA PLUG W TH MANUFACTURED PLUG OR CAP SPECIFICN Y DESIGNED AND MANUFACTURED TO BE USED WITMTE� OF PIPE (IW DIP) BEING ABANDONED OR SULKHESOYPENO WITH CEMENT GROUT PRIOR TO ABANDONING PIPE WRH . KMABLE FILL "l � cAP EwsnND 1Y OIP CRUSHED VIRGIN CLASS III RIPW FILL AREA (COMMON _. _ ABANDON FJ(611NG 1SDPN _ __ G ACE WRN RAWABIE RL GROUT 1 PROFILE. NORTH AREA SLOPE REPAIR 0 10 m suLE N FEET m No B35 BOB,BOB L'0 NS NO BOS )m TIO NIB )80 m ON EIOSRlGORgIIO maae•TeuNOTwTI•MI=1 Flof>oLaevEauminEluva6>NE BIATEMMNE9FA lad L4%. BARR ENGINEERING CO. �D 03M MARKETPOINTE DRNE BARR swe 200 — MINNEAPOLIS. MN Sv3s �•°°P�^s°- rmeu-an "� :.1IffiIFViW� 1L132N3 HCRRA MINNEAPOLIS. MN LANDSLIDE REPAIRS CHANHASSEN.MN CFMERTTOCIEWER ,J Uw POSr(m ALTERNATE U1F NOTES. IFR am END PD3rNIRL Posr AKR NORTH AREA SLOPE REPAIR PROFILE, SECTION, AND DETAIL TOP MLOW POSr ANLTIDBAGE T Imre BONOEovlNn COATED -�IAI:N.Guvwzeoe A e C D o T 2 TOa'OR LUTE RELEASED FW81ED l.RAOE GIB D �� .. Aaoo..e AIM GAGE —�V 2 TEHIIUL P05154EW.CORNER Of %ILL P03).TOD. V '�� .I00 C1NN lli(FABRIC� aUf:l(%PE. b 3. LNEPOSTSTx2-IM-SS40. FINAL GRADE m BOTTYMI RAL ♦. TDP RAILSNALLBE ILA'S530. 5. ILLFITTNG TES. LCU'RCM N1DCp.PmENf PITRS S WILL BE V NYL COATED 91OGK'. ]W�� CRUSHED WRGIN CIASS IN PoMNP § n N B. IWLBE2'MESH WITN NM:fMLD) V SFLVAUKK PAMD SELVADE TDP ANDBDTTpA. I�e�I 1P' ) FABPoC BIWISE TED BELOMTCP RNLEVE11V 12•_ �d0 -ISI 0 s I FFNCESI GEGROUNDED. -10 CONCRETE FODTING(TYP.) B. FENCE.LLIGIMEM SHALL BE DFFSEr a•iftpA EDGE OF 2 SECTION: NORTH AREA SLOPE REPAIR (STA 0+43) TRAE. DETAII' WIRE FENCE DESIGN VINYL COATED - 0 10 2D _ SC/ILE 10. REVIEWFENST A NTSWRN EN MME ENGIN -TER PRINGMENT TALLATION ENGNEER NAY ALTER FENCE SLALE N FEET KIN(S'1ENNE%)ENR. 90% DESIGN NOTFORCONSTRUCflON maae•TeuNOTwTI•MI=1 Flof>oLaevEauminEluva6>NE BIATEMMNE9FA _ _ _ _ _ _ _ LgBlgclgx — — BARR ENGINEERING CO. �D 03M MARKETPOINTE DRNE BARR swe 200 — MINNEAPOLIS. MN Sv3s �•°°P�^s°- rmeu-an "� :.1IffiIFViW� 1L132N3 HCRRA MINNEAPOLIS. MN LANDSLIDE REPAIRS CHANHASSEN.MN 231 �� U14.04 EVE wEN)PRwEcr NP. AKR NORTH AREA SLOPE REPAIR PROFILE, SECTION, AND DETAIL A e C D o T 2 TOa'OR LUTE RELEASED �-^ SARK GIB D No. BY DATE REVISION DESCRIPTION .. Aaoo..e AIM ------------------ TRAIL MODIFICATIONS- jjfr.L __ ___-_______________ SEESHEET C-07= EXISTING FIBER OPTIC LINE Tel 3M03 ---------- —� — STORM SEWER AND DRAINAGE CHANNEL ami - — — — — —GIONALTRNL" — _.— —•—•— uINNESOTA BLUFFS LRT RE -- — _ --- --------------------------- _ _RwuP3.yNG�w sEE - _ --- -------- mz � t 4 LS sr$ Taos I -- - _ / POTENTIAL ACCESS ROUTE 2<' --PIPE-- 2I'XOXDNAL DRILLED L pIRECTpNAL pRIL1Ep 11 BGUIH $LOPE REPAIR )' Btp' 0/ 1rp 0 uHs P2.1 J ' --iCOI♦983VATM)N EASEMENT PARCEL LINE ' ' RIXM CHEDK ffP.) SE G J'J 1 PLAN: STORM SEWER AND DRAINAGE CHANNEL 0 30 BO .' BEATRICE I. Z cprsrftucnor2 uE%TS MERSON SCALEwFEEr IRREV. TRUST PUAAFwmmoa =_ i t \L PROPOSED DRAINAGE CHANNEL SEE , G2, NOTES: 1. INSTALL N' HOPE AND NEW CHANNEL PRIOR TO PLUGGING EXISTING NORTH IB' UNDER TRAJL EMBANKMENT. 2. ENSURE VEC£TAMOK R AT LEAST 74% ESTABLISHED IN NEW CHANNEL PRIOR TO ALLO W ING F'OW 3RM . IRL SEED, BIANKET, AND MULCH ONCE PROJECT DISTURBANCE IS COMPLETE AND IN ACCORDANCE WITH RESTORATION DESIGNSPECIFICATIONS. 3M03 NWS 5005 50OS )MDS MOOS BROSS M155 STORM SEWER AND DRAINAGE CHANNEL ami I�aom 90% DESIGN Ed ��� NOTFORCONSTRUCIION area PPEAPRON a®o _ _ _ _ _ _ _ „•„a„m PARR ENGINEERING CO. D A LILA <Too MUBa:TPDINrE DRIVE BARR 511e z^o I MINNEAPOLIS. MN 5505 �.vn LL1��"'®' PUAAFwmmoa =_ i t \L PROPOSED DRAINAGE CHANNEL SEE , G2, NOTES: 1. INSTALL N' HOPE AND NEW CHANNEL PRIOR TO PLUGGING EXISTING NORTH IB' UNDER TRAJL EMBANKMENT. 2. ENSURE VEC£TAMOK R AT LEAST 74% ESTABLISHED IN NEW CHANNEL PRIOR TO ALLO W ING F'OW 3RM . IRL SEED, BIANKET, AND MULCH ONCE PROJECT DISTURBANCE IS COMPLETE AND IN ACCORDANCE WITH RESTORATION DESIGNSPECIFICATIONS. 0�3 1.005 NWS 3M03 NWS 5005 50OS )MDS MOOS BROSS M155 STORM SEWER AND DRAINAGE CHANNEL DPROFILE: o 3o Go o Is w 90% DESIGN Ed ��� NOTFORCONSTRUCIION area PPEAPRON IN8®YCBIIp TI�� a®rwr A- �' ow.N a/antlW MOTN.TI.WAM1Av,®® P%IrMeo%b PNPNITIEuwS.F aRARRrMNrmrA _ _ _ _ _ _ _ „•„a„m PARR ENGINEERING CO. D A LILA <Too MUBa:TPDINrE DRIVE BARR 511e z^o I MINNEAPOLIS. MN 5505 �.vn LL1��"'®' As3 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN. MN BARB PROTECT NR. 23101014.04 `-�f.X�--3T-9 EXISTINGGROUND, o,..� E� WENT PROJECT No, DWG. R•. REv.w EL-slov Ala 0.4•a STORM SEWER AND DRAINAGE CHANNEL PLAN AND PROFILE KARP MTE REVISION DESCRIPTION - O5t% eARR C-19 D AKH I. - - - �I FINIBHED GRADE .� Br f:Aa PPEAPRW �� 90atF-21'HpPE®15ISG IE 350.So) FLLARFA - -RIPNAP (E6TALL� rIRIECIIOHK 1 STILLING 34a1N fMNllKilET10D3) N • ROCK CHECK ITVP.) �� SPACED APPRO%. %I EVERYSP ST$_ 0�3 1.005 NWS 3M03 NWS 5005 50OS )MDS MOOS BROSS M155 STORM SEWER AND DRAINAGE CHANNEL DPROFILE: o 3o Go o Is w 90% DESIGN IgnlzwrlilALE 0I FEET tIE1RICN.3GYExFEET NOTFORCONSTRUCIION IN8®YCBIIp TI�� a®rwr A- �' ow.N a/antlW MOTN.TI.WAM1Av,®® P%IrMeo%b PNPNITIEuwS.F aRARRrMNrmrA _ _ _ _ _ _ _ „•„a„m PARR ENGINEERING CO. D A LILA <Too MUBa:TPDINrE DRIVE BARR 511e z^o I MINNEAPOLIS. MN 5505 �.vn LL1��"'®' As3 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN. MN BARB PROTECT NR. 23101014.04 a° 12/13RD18 o,..� E� WENT PROJECT No, DWG. R•. REv.w Ala 0.4•a STORM SEWER AND DRAINAGE CHANNEL PLAN AND PROFILE KARP MTE REVISION DESCRIPTION A 8 C D D 1 2Kn TgFpi DATE RELEASED eARR C-19 D AKH TARTER QUAMTRI6 nwus ATwFnmsTc LIQ WNiAP ,TER GRANULAR FUER MATERIAL A�SECTION: RIPRAP OUTFALL NOT 7RIO NOTES PIPE SITES URGER THAN THOSE SHOr`M REWIRE A SPECIAL DESIGN. REOUIRENEMS FOR RIPRAP SIZE ANG THCKNESS ANO It1ER RIAH.'ET SMALL BE DESIGNATED M THE IUNS- Q FOR RR:S GREATER IIWI OR EQUAL T030•, UBE 15' ® OIAFNRION E IS GIVEN pI STNYNIp PLATE331 W AN0 3111E l° ftN'RAP WWI GRANULAR FILTER IAATERML (1 SECTION: RIPRAP OUTFALL NorroscuE \DETAIL: ROCK CHECK xoT TDsaIE N %A1 SECTION: ROCK CHECK norm9 F NOTES: 1 CUT FLEIIRLE CONCRETE GEOGRID AT EO.CN ROCK CHECK AS NECFSBARr TO IMPROVE GEOGRID FLEXIBILITY MO FORM TRENCH FOR ROCK CHECK 2 MMIDE MNIL61M OF 3 OVERL OF GEOC4tM AT BREAK BELON ROCK CHECK VATH L REAAI GECGIUD LAYER PLACED ON TOP OF COATiSTREW GEOGRID, 3. VERIFY INSTALAT ANO REWIRED STAKING KITH ELEVATI FLM—/ RE%IBLECONCRETEOEOGRID J –�. ,, (FIFYPMAT ORAPPROJEO EQUAL( PROVIDE MN�FT OVER V FIENIBLE LONCREIE (cOGRO ATBRFW(BELORGW ROCKCOCK CNE::K (F3ElUMAT oft APPROVED EDtW1) �1 SECTION: ROCK CHECK No rosc7 90% DESIGN At'DVRFRAFR®AKrN AviEu'1AmI—In%Dir�i CUSSII clA III CtA55 Rl RS LANDSLIDE REPAIRS dW= E' d90= 9' ,D AD s.rowry aooeu-vn Fs'63I°A�' 6- DEPFH CHANHASSEN.MNE 9' RRiH 1Z' OEPTN dA. OF 12'OEPgV GMNUTAR ]A'DFRTH GAANUUP 24 -IN H GMNUTAR ROUND L RV RAR FUER RIl.w RTFR RIPRAP gtTER qPE TIN) IFT.1 (CU. YD.1 (C0. YD.) (N.YD.) (CU.YD.1 (4:O.YD.1 (a. M.) LIQ WNiAP ,TER GRANULAR FUER MATERIAL A�SECTION: RIPRAP OUTFALL NOT 7RIO NOTES PIPE SITES URGER THAN THOSE SHOr`M REWIRE A SPECIAL DESIGN. REOUIRENEMS FOR RIPRAP SIZE ANG THCKNESS ANO It1ER RIAH.'ET SMALL BE DESIGNATED M THE IUNS- Q FOR RR:S GREATER IIWI OR EQUAL T030•, UBE 15' ® OIAFNRION E IS GIVEN pI STNYNIp PLATE331 W AN0 3111E l° ftN'RAP WWI GRANULAR FILTER IAATERML (1 SECTION: RIPRAP OUTFALL NorroscuE \DETAIL: ROCK CHECK xoT TDsaIE N %A1 SECTION: ROCK CHECK norm9 F NOTES: 1 CUT FLEIIRLE CONCRETE GEOGRID AT EO.CN ROCK CHECK AS NECFSBARr TO IMPROVE GEOGRID FLEXIBILITY MO FORM TRENCH FOR ROCK CHECK 2 MMIDE MNIL61M OF 3 OVERL OF GEOC4tM AT BREAK BELON ROCK CHECK VATH L REAAI GECGIUD LAYER PLACED ON TOP OF COATiSTREW GEOGRID, 3. VERIFY INSTALAT ANO REWIRED STAKING KITH ELEVATI FLM—/ RE%IBLECONCRETEOEOGRID J –�. ,, (FIFYPMAT ORAPPROJEO EQUAL( PROVIDE MN�FT OVER V FIENIBLE LONCREIE (cOGRO ATBRFW(BELORGW ROCKCOCK CNE::K (F3ElUMAT oft APPROVED EDtW1) �1 SECTION: ROCK CHECK No rosc7 90% DESIGN At'DVRFRAFR®AKrN AviEu'1AmI—In%Dir�i RS LANDSLIDE REPAIRS °1"e"a�a,wNEE"K'xTFu'.�ntE®iOwswi11l N°mlBA1o1r1AaEv1l"aN'a6F®0`t'E ,D AD s.rowry aooeu-vn Fs'63I°A�' HCRRA MINNEAPOLIS, MN CHANHASSEN.MNE .04 4. 1W EPF WENT2"R91-,0`E1C0T" uw STORM SEWER AND DRAINAGE CHANNEL SECTIONS AND DETAILS pFyEgSED A B C D 0 1 2"'�"_�� �%^^ BARB C-20 D No ev IK DATE REVISION DESCRIPTION Aa,... ToIFOR DATE RE3sESEn R..am-m. „JKH d MIN. TOPSOL WITH SEED AND CATEGORY 3 EROSION CONTROL BLANEET. ENTENDEROSNIN CONTROL DLMMET 10 MIN. FROM EDGE OF FLEX83LE CONCRETE GEOGRIO. SEEDE7AL2FOi —. FLEXIBLE CONCRETE GEOGRID F 6 MEN. TOPSOIL AND SEED BELOW FLEXIBLE CONCRETE GEOGRID 10 SOPE� NOTES t ALL FLEXIBLE CONCRETE GEOGRID TO BE FLEXAMAT OR APPRO`/EO EOI 2. FLEXIBLE CONCRETE GEOGRID IS TO BE LAID IN A SHINGLED MANNER SO THE UPSTREAM ROW IS LAID OVER THE TOP OF THE DOWNSTREAM ROW AND INSTALLED IN ACCORDANCE WITH MPNUFACTURERS GUIDEUMES. 3. FOR GENERAL INSTALLATION INFORMATION SEE DUAL 2. 4. PLACE TOPSOIL PRIOR TO INSTALLATION OF FLEXIBLE CONCRETE GEOGRID AND GRADE TO BE SMOOTH PER MANUFACTURER GUIDELINES. 9 SECTION: DRAINAGE CHANNEL XOi To. WHEN THE AREA 9 DISE THE FLEXAMAT ARMOR 19 019iUP8EU. COVER THE SURFACE WITH STRAW IF ME EOOE OF THE FLEINNLT NV MULCH. EROSN3NLONTRO�. a B1mO TO smatt mums.RBCBY T OR ROD TO PREVENT R. L_ ME OUTBOE E R OF BIOCY. GRADE THE CHANNEL 90 THE µpryO THE OUTSIDE EDGE OUTSIDE EDGES ME HIGHER MAN ME CENTER OF THE CHANNEL AND THE FLOW IS C AHED WDNIN ME MAT. ----------- RML WR1M LQMGER THAN BY OVERLAP (3 BLOCKS( 18' LENGTH. 25' DEEP, OVERLA�_1111LLOVERLAPPED MAT WITH TOP SOIL. `-1B', #3 REBAR OR APPROVED ZIP TIE. COMSTRUOIOM MOTES: L AN ENGINEER OR MANUFACTURES REPRESENTATIVE SMALL BE ONSITE FOR THE START OF THE INSTALLATION, 1. GRADE THE SIFTS SO THAT WATER WILL NOT FLOW ABOVE,BELOW. OR AROUND THE OUTSIDE OF THE AREA PROTECTED WITH FLEXAMAT. ALL SUBGRAOE SURFACES PREPARED FOR PLACEMENT OF MATS SHALL Of SMOOTH AND FREE OF ALL ROCKS, STICKS. ROOTS, OTHER PROTRUSIONS, OR DEBRIS OF ANY RINO. 3. APPLY SITE SPECIFIC SEED, INCLUDING NATIVE GRASSES DIRECTLY TO ME PREPARED SOIL PRIOR TO FLEXAMAT INSTALIATION. a. FLEXAM AT ROLLS ARE AVAILABLE IN WIDTHS OF{,5.5',B',10',12',E18'. ITISTHE MANUFACTU REBS PECOMM ENOATION TO UTILIZE THE WIDEST MATS POSSIBLE TO REDUCE AN ABU N DANCE OF SEAM S OR OVERLAPS. a. TO ACHIEVE W JOE It W IDTHS. INSTALL MATS ADJACENT TO ONE ANOTHER. INSTALL ADDITIONAL UNDERLAYM ENT UNDER ALL AOJOINI NG MATS. A MINIMUM OF 11' OF UNDE RLAYMNET SHALL ENE NO UNDER EACH SIDE OF THE MAT AND DIRECTLY AGAINST THE SU BGRADE. B. INSTALL 18' °3 REBAR U -ANCHORS OR STAINLESS STEEL ZIP TIES IN 3' INCREMENTS THE LENGTH OF THE LONGITUDINAL SEAM. 5. AT THE BEGINNING OF THE FLEXAMAT,TJUNSRgN THE INRML LEADING EDGE PROPERLY WITH EROSION MATTING OR SOD. IF EXPOSED TO CONCENTRATED FLOWS EMBED 18- VERTICALLY INTO THE SUB GRADE TO SERVE AS AN ANCHOR TRENCH. THE TRENCH SHALL BE FILLED AND COMPARED WITH SUITABLE FILL OR OTHER IAS SPECIFIED BY EORI, C FOR ADDITIONAL SER IONS OF MAT, OVERLAP ME DOWNSTREAM SECTION D' WITH UPSTREAM SECTION OF MAT, PRIOR TO INSTALLING OVERLAP, FLIP UPSTREAM MAT BACK 24'. EXCAVATE 215. OF SOIL TB- FROM END OF UPSTREAM MAT. DOWNSTREAM SECTION IS LAST IN THE SHALLOW TRENCH. LIGHTLY SPREAD TOPSOIL, SEED AND FERTILIZER OVER INRML EDGE. FLIP ENO OF UPSTREAM MAT OVER THE SOIL COVERED INITIAL LEADING EDGE OF DOWNSTREAM MAT. T. INSTALL 18' U -ANCHORS IN 3' INCREMENTS ACROSS THE OVERLAP. INSTALL ANCHORS DIRECTLY BEHIND BLOCM3.'U' ANCHORS CONSIST OF 83 RSM 'U' ANCHOR WITH 18' LEGS. B. AT THE END OF THE ARMORED[HANII EMBED THE MAT IS- INA TERMINATION TRENCH. RILL AND COMPACT TERMINATION TRENCH WITH SOIL(DETERMINED BY EOM). FLEXAMAT INFORMATION Manufacturer: Mex Enter"'°°."`. FLEXAMAT ,1e; %imat Product Hamer FleXamat son Road AOtlreaR_ Cinci3153 nnati, ON 45209 Telephone: 513-722-6669 STANDARD CHANNEL DETAIL Email: Info®Fleaamat.com NTS INSIDIOUS WWW.FleaamaLcom ---- - 2 DETAIL: FLEXIBLE CONCRETE GEOGRID INSTALLATION FLEXAMAT OR APPROVED EQUAL xol 10 SONE 90% DESIGN t:t"*A55NON'" LANDSLIDE REPAIRS - - — — — — — —BARK ENGIHEERWGcO. 12nsa01B 23101014.04 OsIO LEAKKEIPoNTE ENLNE - _ _ _ _ _ = D A DDzaB HCRRA CHANHASSEN,MN EPF aIENT PRT1Ecr w. WIL— — — — — — — �M—iiR MMEwroLIs,R«sws AIH MINNEAPOLIS, MN A a C D o t 2 "-�-"� N. vmMz.RZN o.y.R eARR STORM SEWER AND DRAINAGE CHANNEL No. BY m" P. DATE REVISION DESCRIPTION r 0 DATE gEIFASf30 k �rM� ��aj1p1 ANH SECTIONS AND DETAILS 821 D //////i /////�f��' ' _ — �\ \ \ 4 \11\:\I\\`\1 /{II 111\x.\\\\\ \\\\\..,Illll lull 1111 1 111111 \�� !t\•., I ;\ �\�Z� � ��J i _�� � `_ � /'/ / t - / /�//� !/ i. /lC /� �% �✓�—�\�� �� `\ ��'— �I - \.,. "III,/; �!1 \\` \�\'\\lid\\k \`\ IIS\ /: l I,/III,/l, t "\ \ \l \ _ — —�—� ��✓'— _y --f `= — �'//�/i/ / / I _ 1 i /1.l�ll, llll l/// //JCS\/ O�aii {//i 11V/ii//l//Ifl1//:// ✓ �� — �_—i' _—__— -----------— o_hi - - -/ � 1s/-�.r _ Y =1�II� I I I III 1/' �, - \- - _ a S_ yi ` ////ii ::�i:.S•��/,.'ii //:// il'l. I 1/ `L-,___� ��t -'�_-_ �_---I _ — '-`�__ -- �—����%'— Illi I - ;oma ��ir-�.;,� � -_� �__ �'j%!c "///�i1111/9/�I�L��/!y�tl1`1 i�/; �-\•�-, _ _ _ '�'�>-� I /( - - /-- - 11 4. _,,- __-, -_' - -- :�%�.�' //i _ir'r /�/i// 1/„ - �/;.//' •���� --s- - - �5.`�'f = -, o �3% � \i �tl \\\\ '�\ l I '... � -' % / L "� %' \\ - /�/ i /''n'• �:/' i Or - `_ :� / o - _ _1.. I ;u__� - `v '-,., Ili I I ,jl �� - / / L �£�\- .._�'�'�°1 jirr�= �c, _\lJ /!,/-y-- �'ar ='moi C� - -I L777- MINNESOTABLUFF LRT REGIONAL /— _ F nlln = _-_`-� 1 A ppp f- 1 yr _ SYMBOL AND PATTERN L CIEND l� _ / p_ i i�/ l I l llN (I 559 - F%16TING IU CONIWR .� Ipl 11'', 1, -99 -- -- FXI5TNG2CONTOUR IT - CONSTRUCTION LIMITS WOODLAND EDGE SOUTH SEE -MIX / �, - • v v I n l/l l / / / / / / vA 111' ® IMn-OTxznl 1111!411. l/Jr/, / 1.%///ii'./'"i/��. 11-J. STORMWATEI18pIT18EEDYIX (Hopp! 3S'tlt) 1Q PLAN: SEEDING 0 W 120 4 ''''�'''''' WETPRNRIESEEO MIX IMET P 30.M21 SCALE M FEET RIPRAP RESTORATION NOTES-. 1. ALL GROUND DISNRBANCE GENERATED FROM GRADING NlT,TDES SW BE OECOMPACTFD TO A MINIMUM DEPTH OF Ir, STABILIIfD AND PROFOSED TRAIL RESTORED WITH A MINIMUM OF 61NCHES OF TOPSOIL SEED WT1 COVER CROP, ANO EROSION CONTROL BWIQTOR S1RAW MIBLIi THE TOPSOIL USED FOR REGTOINTION MY BE STCCMILED FROM GRADING AREAS. 2 SEED ANY MSTURSED AREAS OUTSIDE THE CONSTRUCTION LIMITS WTI THE SPECIFIED SEED MIX. 3. ANY EXOTIC INVASNE PLANTS AND WEEDS WITHIN THE SEEDING MEAS SHAL BE SPRAYED WTI HERBICIDE 1A MY$ PRIOR TO SEEDING. SIGNAGE INDICTING THE USE OF HERBM:IDES MUST BE POTTED ON SITE. A. ALL HERBICIDE APPLICATION SHALL BE APPLIED BY A LICENSED APRICATOR WITHIN THE STATE OF MINNESOTA 5. SEED IN ACCORDANCE WTI THE SPECIFICATIONS. SEEDING IS TO TAKE PLACE IMMEDIATELY FIXLp W FINAL GRADING AND SOIL PLACEMEM TO WIEVENT EROSION AND COMPACTION B REFER TO SPEGFICATIONS FOR ADDITIONAL INFORMATION. IN THE CASE OF ANY DISCREPANCIES BETWEEN THIS DETAIL, PLANS. OR /1/�y SPECIFICATIONS, THE SPECIFICATIONS SHALL GOVERN. Jy/B DESIGN NOTFORCONS7ROc770N rearfalsvtlRiT1®wx,sEoawTOAu pyv dNa. AS SHOWN LANDSLIDE REPAIRS BARRPROJECT No. INMHFI.NL.,IEOAMNBIY�6.6. fFBN�INOT1uTIulAouvl®® -- gpgR ENGINEERMGCO. 1N13'[019 23101014.04 j T ATA 9]W MAR IPOIME DRNE EPF HCRRA CHANHASSEN, MN GAIEM PROJECT Na. StibiW MINNEAFOLIB Im ss6,A AKH MINNEAPOLIS, MN SEEDING PLAN RELEASED I A B C O D 1 2 G^r°s'l" In, an �r BAPoi OMC. W. REV. No. 10 BY DATE REVISION DESCRIPTwN TOFOR DAIERE3FASHI �F� FaA�„�"0i DAP^^ I Ala R-01 D !i \ y\Il'11,,ltp Cd 1111;\IIII'111 J/ 11/11;1 • \ -.' Lam``_ – ,\1 J4�j`J /'11•(1)111 (,I\!1,` veli,\ _ --mD - - \ I' _ �/ � _ - _-_-_ - _' _ — __ �G ' /r•. _ _ /Q (/ %i''//ir.7/i'/iii) /l/' 1t1/\ I '� �_ /._?.��� .�: J.–___-���_`_ 1�--�11*/ \111\•'\ '"�•/'rlllll/ i�,ll� it Lh ////, `\\ 111�_„_�/ ^_ \ \ �--_����� �` � , �r �\. ?.• II/ W• 34, ]', n -'u \ : - MINNESOTA6LUFF LRT 0.EGIONALT I 041 _ _ ._---�a�Y II -------- _ I �v\ y �� / l J l l 1�1A V��♦ CONSTRUCTION LIMITS \\\ 1 j / / -!–'� •` _ i _ 1 , \1 CLEARING OMITS BV ICHK.IAPP.I DATE I REVISION DESCRIPTION / 1 � l \ t \1 PLAN: EROSION CONTROL BLANKET MULCH PLAN 0 80 10 4 V SCAIE M FEET 921 BBRIi EIG�FERNG Go 1300 tl0R0=1PDr1TE OTdJE armo MIIHEAPOLIS, MN $$i]5 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN EROSION CONTROL BLANKET AND MULCH PLAN 90% DESIGN 23101014.04 IDUSTMG IB CONfp/R EXISTING 2 CONTOUR -------- CONSTRUCTION LIMITS — — CLE NGUMITS RIPMP FLEXIBLE CONCRETE GEOGRID (FL T OR APPROVED EOIML) LONIROL INANI(ET MR T (MMDT UT. JN) DDISK ANCHORED MULCH LANDSLIDE REPAIRS CHANHASSEN,MN EROSION CONTROL BLANKET AND MULCH PLAN 90% DESIGN 23101014.04 — y �?'_ `%�.✓-�-- \ �\ �\v q \ �11 \ � 1/J/t/ r f - \ ��.\�\\\�� `�.jj 11� `IPI \ r L 1��41 f/I11 1.\\, I . \ 1\`.. ``` __ _ 1� _/�axl _�_ 11 \ 1 r/ \\ r \41•U 4 " - , - -- -- - r ---~D` - ��I�I I � `'4�i"� _-_ _- /r -r//�/ -/ /hfli',1' I4•UIII/� � �1 \\ 4r'�=�`~. �__-", " 1111 Itlll ! % �1/��;` -���/ '� �r/ii/l !ll// lI�• f rk rL�.. n� At am _ r REALIGNED GRAVE_TRAI_— CONSTRUC1om LII 1 CLEARING LIMITS SYMBOL AND PATTERN LEGEND B00anTp Rloalle O+byP wpn'nrw DUSTING 10 CONTOUR SPI mIRl 100.0 EXISTING Y CONTOUR '------- CONSTRUG"ONUMRS — CLEARNG LIMITS 1001 RIPRAP TBD FLEXIBLE CONCRETE GEOGRID TNM anNrimnP (FLFXMAT OR APPROVED EQUAL) IS O.O -EERAN--AREA BY ICHKIAPP.I DATE NOTES' 1. pLLTREEB CAEp1ER TWVl6•pNAEIER pT SREpST HEIGHT gEMOVEp DURING CONOTRUCTKKI SINLL BE REPLACED pT p 1'.1 RATIO. 2 ESTIMATED TREE REPLACEMEM QUANTNIESARE PROVIDED IN THE TREE PLANTING SCHEDULE FOR BIDDING PURPOSES. 3. ACTUAL TREE REPLACEMENTCUANTOYWULVARYFROMTHEPLANTING SCHEDULE BASED ON NUMBER AND SPECIES OF TREES REANIVED WRING CONSTRUCTION. 0. BOTHCO CTORANDENGMEERSHALLKEEPALOGOFALLTREESGREATER THAN V DWAETERAT BREAST HEIGHT REMOVED DURING CONSTRUCTKAI TO DETERMINE TREES TO BE PLANTED. 5. APPRST I LE ARES FO F PROPOSED MEE$ I THE FI ON THE PLVI VIEW. FIELD STAID LOCATIONS OF PROPOSED TREES IN THE FIELD FOR REVIEW IND APPROVAL BY ENGINEER PRIOR TO RANTING. aATevlea®prt N.n®Nae RE =ate® w o a. M T TQ'FOR OATERELE/3® ---7 _ I TRAIL �uewPE"� lm� 11 ` I I I II i i iilllll _II Common Name v nwooc B00anTp Rloalle O+byP wpn'nrw %u .10 Com SPI mIRl 100.0 %^ of A% QMaIttkY - TM3 Doxny SemceEerr/ AmebncAierortwea B10Com. 1001 3% TBD Amerion UnHen TNM anNrimnP nOCRA, IS O.O e% TBD NoMMun Nn Oak Do—Nyvolvb MCRAL 1501 3% TOO Sugar MaI A0.-MIRON wn nOCam, ISO.G 50% TBD III Oak Oue]oa rvhm 01000AL 150. 3116 TOO Hadb" CIAB, RdOmm6 a10 Cmc Mac 1011 TOO NPnAenl SlMn RI Rrta mminna nOCRt. 1SQC 2% TOO swamp III Calk QuNoseiwbr nor uac 331 TOO OMROrmY RIaaMma, m0 ad. 10 OUG !% MD CRURR O Papa ahMWa am Cant 150E 1011 TIO BACKFILL SOIL OR UNSMARLY SHALL SE REPLACED AT CONTRACTOR'S EXPENSE. TRYI la0 DTABLE: ESTIMATED TREE PLANTING SCHEDULE P,N.vONm BARR ENGINEERING CO. 1300 MARI(ETONTP DANE SIM mB MINNEAPOLIS, MN S5N15 Il I - IIII I VIII � 111111, DETAIL: TREE PLANTING 'IV NLTTTOSCAE HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN TREE PLANTING PLAN 90% DESIGN NOT FORCONSTRUCTION A TitEE PIANi1NG NOTES 1. REMOVE DEAD OR OAMAGEO BRANCHES. RETAIN THE NATURAL FORM OF PLANT. GO HOT CUT THE LEADER 2. IF ROOT F -ARE IS NOT EXPOSED WrtHIN THE CONTAINER MGAVATE SURFACE SOIL TO BASE OF ROOT FLARE. 3. DIG PLANT HOLES B' MIN. LARGER THAN ROOT PER SCHEDULE MASS.ALL SIDES. /-TREE 0. SCARIFYBOTTOM AND SIDES OF HOLE PRIOR ROOT FLARE, TO BE AT GRACE TO PLANTING AND NOT COVERED WFOI MULCH 5. SET TREE ON LIGHTLY FIRMED BACKFILL SOIL OR SOUL SO ROOT FLARES EVEN WH FINISH GRADE PRUNE AND REMOVE B BACKFILL WITH P=NG SOIL AND FIRM SOIL ADVANTAGEOUS AND FIBROUS NTA ARCUMDR)OT MASSTOMAINTAIN PLUMB AND ROOTftOOTFWEE ENSU RE NO AIRGAPB ARWHO ROOT MASS ], CONSTRUCTTINATERINGBASIN. THOROUGHLY Y SHREDDED WATER WRHIN 3 HOURS OF INSTALLATION. HARGWOOD MULCH B. RACE SHREDDED HARDWQ^O MULCH(MI (INCIDENTALTOTREE SPEC SAW 2 TYPE 6 -WEED SEED FREE INSTALLATION( SHREDDED HARDWOOD) TO A RADIUS OF 2<' AND TO A DEPTH OF 3 -AROUND TREE (SOIL PREPARED AS PER PLAN). FINISH 9. NO MULCH TO BE IN CONTACT WITH BASE OF GRADE PLANT. 10. CONTRACTOR IS RESPONSIBLE FON MAINTAINING TREES IN A PLUMB POSITION THROUGHOUT THE GUARANTEE PERIOD. 11. CONTRACTOR TO WATER AS NECESSARY THROUGHOUT GUARANTEE PERIOD TO MAINTAIN IN A HEALTHY CONDITION. ATTIE E%6TING SUSGRAVE END OF THE GUARANTEE PERIM ALL TREES THAT ARE DEAD OR DETERMINED UNHEALTHY BACKFILL SOIL OR UNSMARLY SHALL SE REPLACED AT CONTRACTOR'S EXPENSE. LANDSLIDE REPAIRS CHANHASSEN,MN TREE PLANTING PLAN 90% DESIGN NOT FORCONSTRUCTION A WATE�_rTURF REINFORCEMENT IMT / ITRA1) CHECK SLOT NOTES: 1, SECURE AT 121N.INTERVALS, BACKFILL AND COMPACT SOIL, 2, CHEM SLOTSTO BE PLACEEVERYOTALONG FLOWLINE. INTERMITTENT CHECK SLOT F I PLA NOTEB: 2 OVERANCXgMEEN R0RDING TO THE ABOVE PATTERN, 2. OVERLAPBETWEEN LLS IS ISBIN.MINIMUM . 3. SPLICEALWAYS INSTALL ROLLS IS 181N.MINIMUM 4. ALWAYB INBTALL DOUBLE ROW OF PINS SPACE012'APART ATALL ROLL SPLICES. 5. INSTALL PINS DOWN THE CENTER OF EACH IMT STAGGERING THE WiBIOE PINS. 8. ANCHORS OR 12 R, AT MINIMUMDWRE X. STEEL LONGER ERIlf[L1l11N. REWIREDW0ISHERS OR LO U SOIL -S WIRE MU T LONGERANCXORS MAY BE GROUINDO FOR LOOSE SOILS. RESIST PULLOUT ANCHORS MUST PRONDE SUFFICIENT GROUND PENETRATION TO RESIBT PULLOUT. TRM ANCHOR PATTERN TPM INSTALIATuN NOTES. 1. PLACE A MINIMUM OF 4 IN. OF TOPSOIL ON SLOPE. 2. PLACE APPROXIMATELY 3 OF THE SPECIFIED SEED AND RAISE SEED INTO SOIL RtKK1 TO PLACEMENT OF TAM, 3. INSTALL AND ANCHOR TRM AS SHOWN AND AS SPECIFIED. A PLACE ADDITIONAL TOPSOIL (PULVERMED.DRY. LOOSE) OVER TRIM ROUGHLY I IN. THICK OR UNTIL THE TRIM IS RNELY VISIBLE. 5. APPLY RE"NING 5Y6 OF SEEDING ON TOP OF SOIL PILLED TRM NID LIGHTLY R/JSE INTO SOIL USING THE FIAT SIDE OF A AM'E. 6. HYOROMULCX IMV BE SUBSTITUTED FOR THE APPPWCM IN STEP S. 3O'WN. TURF REINFgTLEMENT TMT WATER `fiRMl ANCHOR TRENCH NOTES: 1, SECUREAT121N.INTERVALS.BACK%LLMDCOMPACT SOIL 2. FOR SLOPES, CONSTRUCT TOP ANCHOR TRENCH 2 FT. BEYOND CREST OF SLOPE. 1 DETAIL: TURF REINFORCEMENT MAT - 1K IT TO SGLLE TOP ANCHOR TRENCH NOTE 1. SECURE AT 121N. INTERVALS, BACKFILL AND COMPACT SOIL EDGE TERMINATION ANCHOR TRENCH 90%DESIGN NOT FORCONSTRL . ,................... ............_a�............ NAeN�,.,FOF„�T,IAIFAH.PM.�T LANDSLIDE �s'ATrul4er+ a Tu,�K ® am... — — — — cp4s,„txTg3 — — — — — — — BVTR ENGINEERING CO. BAR SUII,m Dom:—lili XM""°Ir«EAPOMR. Ii.1aY 1(n� Fc�Nm.ID11 amw2Hzn o,„ 1Z13^dt19 HCRRA MINNEAPOLIS, MNRESTORATION CHANHASSEN, MN 23101014.04 cuENT PRDUEcr No. - ARX DETAILS AaxNE AELF.ASFD R-04 D No. 81 XK. AVP DATE REVISION DESCRIRRON TaaoR PATE Age�C aTa REIF.ABED AKX Chanhassen Landslide Repair Project Interim Use Permit Application Prepared on behalf of Hennepin County Regional Railroad Authority Prepared for City of Chanhassen December 2019 Chanhassen Landslide Repair - Interim Use Permit Application List of Figures Figure 1 Site Location Figure 2 LiDAR Map Figure 3 National Wetlands Inventory Map Figure 4 Wetland Delineation Map Figure 5 FEMA Floodplain Map Figure 6 Public Water Inventory Map Figure 7 Water Table Depth Figure S Water Table Elevation Figure 9 Well Locations List of Attachments Attachment 1 Proof of Ownership Attachment 2 Landowner List Attachment 3 Construction Design Plans Attachment 4 Draft Specifications for Horizontal Directional Drilling Attachment 5 Joint Application Form for Activities Affecting Water Resources in Minnesota P:\MF5\23 MK\IO\2"*'010:4 Lontlsi�ges!n CTanhossanFk?P.ALOd C'�an:�¢:-mope FWwe Coral Pbrs\KM:Aes\Pert llPnP\C;40 Cho haven\Chanh�W IJP 0.dr-. I Introduction This application is prepared to fulfill the City of Chanhassen Interim Use Permit requirements as outlined in the City Code Chapter 7, Article III, Section 7-35. The application is organized to correspond to each numbered item under Section 7-35 (b). Project Description The scope of the project includes landslide repairs on a portion of the Minnesota Bluffs LRT Regional Trail in Chanhassen, MN owned by the Hennepin County Regional Railroad Authority (HCRRA). Two areas will be repaired as part of this project — the north repair area and the south repair area. Project access will be from Highview Drive in Eden Prairie, proceeding southwest along the trail to the site, and also from Flying Cloud Drive through the Moon Valley Aggregate operated property (final access route through Moon Valley Aggregate operated property pending property owner authorization). Landslide repairs in the south repair area will include stabilizing the south slope, repairing the south culvert outlet area and constructing a new storm sewer and drainage ditch to direct water into the repaired area. Plans for redirecting the water were provided to the Lower Minnesota River Watershed District for review and comment on December 12, 2019. The response from the watershed district will be provided to the City upon receipt. Existing trail profile grades will be reduced with the embankment slopes regraded to less steep grades and finished with turf reinforcement mats. The existing damaged concrete headwall will be removed and existing riprap will be salvaged for reuse. The south culvert outlet area will be repaired with riprap, boulder cross vanes, and a stilling basin. Work in the north area will include removal of existing pipe debris, placement of riprap fill on north slope, and abandonment of the existing pipe crossing beneath the trail. Drainage will be rerouted from north pipe area via new buried storm sewer and lined drainage channel, which will discharge to the south culvert outlet area. 2 Interim Use Permit Application Item 1: The name and address of the operator and owner of the land, together with proof of ownership. If the operator and owner are different, both must sign the application. Contact Information Owner. Hennepin County Regional Railroad Authority Mailing Address: 701 4"' Ave. S, Suite 400, Minneapolis MN 55415 Contact Person: Jessica Galatz, Project Manager Phone Number. (612) 348-2691 Email: Jessica galatzCfhennepin us Alternate Contact Person: Kristine Stehly, Project Engineer Phone Number: (612) 348-6370 Email: kristine.stehly2hennepin.us Proof of ownership is provide in Attachment 1. Item 2: The correct legal description of the property where the activity is proposed to occur. All that part of a variable width strip of land in Sections 34, 35, 36 and 25, Township 116, Range 23, Carver County, Minnesota, being former railroad right of way. Subject to existing public roads and highways, and easements of record, if any. Item 3: A certified abstract listing the names of all landowners owning property within 500 feet of the boundary of the property described above. The City of Chanhassen provided the applicant with a list of landowners located within 500 feet of the property boundary on December 2, 2019. Refer to Attachment 2. Item 4: Specifications of the following, using appropriate maps, photographs and surveys: Full project specifications are provided in the construction design plans as Attachment 3. Draft specifications for horizontal directional drilling (HDD) are provided as Attachment 4. Once a final copy of the HDD specifications is available it will be provided to the city. a. Proposed grading plan Refer to the attached construction design plans, sheet G-08 (Attachment 3). b. Proposed stockpile sites Stockpiling will occur in the areas identified as staging areas on plan sheet G-05 (Attachment 3). There is limited space for stockpiling material on the site. The contractor will likely choose to put any excavated material directly in trucks to export from the site and stockpile temporarily stripped topsoil on site. It is likely that material will also need to be imported and stockpiled at the site within the staging areas on plan sheet G-05 (Attachment 3). Imported material will include riprap, granular filter, and topsoil. C. The physical relationship of the proposed designated site to the community and existing development. The project site is located on a portion of the Minnesota Bluffs LRT Regional Trail in the Rice Lake area just north of Flying Cloud Drive. The project will take place on Hennepin County Regional Railroad Authority property. Two repair areas are part of this project — north repair area and south repair area. A gravel pit owned by Moon Valley Aggregate is located southeast of the south repair area. There are no other residential, commercial or industrial developments immediately adjacent to the north and south repair 2 areas. Residential areas are located on either side of the trail in the northeast portion of the project area (Figure 1). The northeast portion of the trail will be used for construction access only. d. Site topography and natural features including location of watercourses and waterbodies. The trail slopes down from the northeast towards the southwest with an approximate elevation of 880 feet at the northeast access point coming down to 830 feet at the south repair area. Topography on either side of the trail is variable but generally downward sloping. Refer to sheet G-08 (Attachment 3) and Figure 2 for elevation contours within the project area. Wetlands are located on either side of the trail along the access with a small percentage located within the construction limits (Figure 3 and 4; sheets G-05 and G- 06, Attachment 3). A small wetland is located northeast of the north repair area outside of the construction limits (Figure 4). A stream channel runs adjacent to the trail from the northeast. The stream channel is outside of the construction limits at the north repair area and flows under the trail via the south culvert in the south repair area (Figure 4). No other waterbodies are located within the project footprint. The site is not within a designated floodplain (Figure 5). A Public Water Inventory basin (unnamed) is located northwest of the access at Highview Drive but is not within project limits and will not be impacted by construction activities (Figure 6). e. The description and quantity of material to be excavated. Excavated material will include soil and riprap. The total estimated quantity of excavated material is: • Excavation — common (non -contaminated material): 19,990 cubic yards • Excavation — special (contaminated soil): 2824 cubic yards The trail lowering portion of the project will require extensive excavation and some of the material on the surface is contaminated. Contaminated soil will be exported offsite to an approved waste disposal facility. No new soil will be needed as the finished grade is much lower than existing grade. f. The depth of water tables throughout the area. Refer to Figures 7 and 8 for water table depths/elevations. Depth to water table is approximately 0 to 25 feet in most of the south repair area, 25 to 75 feet along the trail and, 0 to 25 feet in the north repair area. g. The location and depth of wells and buried garbage, water and fill. There are no public or domestic wells within the project footprint, refer to Figure 8. No buried garbage or fill was identified at the site. Item 5: The purpose of the operation. The purpose of the planned work is to repair landslides along a portion of the Minnesota Bluffs LRT Regional Trail that occurred in 2014. In addition to the landslide repairs, a new storm sewer and drainage channel are proposed to be constructed on the south side of the trail that will drain to the south culvert area. The south culvert will also undergo repairs. The culvert located in the north repair area will be filled and abandoned in place. 3 Item 6: The estimated time required to compete operation. Tree clearing will occur prior to the work required to complete the repairs. In total, construction time is expected to be no greater than ten months. Item 7: Hours and months of operation. Work will occur within regular hours, starting no earlier than 7:00 a.m. and finishing no later than 6:00 p.m. on a daily basis. Work is anticipated to occur between the months of February and December of 2020. Item 8: A tree survey indicating the location and type of all trees over six inches in caliper. In a heavily wooded area only the boundaries of the tree areas must be indicated on the survey. A tree survey was conducted to identify trees over 6 inches in diameter at breast height (dbh). The area within the construction limits is heavily wooded. Collecting individual tree locations was not feasible given that the area is heavily wooded. Instead, a square measuring 2,500 square feet was surveyed in three different locations along the south repair area. On average, about 7 trees at or above 6 inches dbh were identified within the surveyed squares. Tree clearing will take place in areas as necessary within the limits of construction (Attachment 3) and will be avoided to the extent practicable. Trees over 6 inches dbh that are removed during construction will be counted and replanted at a 1:1 ratio within the construction limits during restoration as space allows. Some areas where trees will be removed will not be replanted due to new features being constructed. Refer to sheet R-03 (Attachment 3) for the tree replacement plan. Item 9: An end use landscape plan and interim screening plan for the operation period. The restoration plan is provided in Attachment 3, sheets R-01 through R-04. An interim screening plan is not applicable to this project. Item 10: The plan of operation, including processing, nature of the processing and equipment, location of the plant source of water, disposal of water and reuse of water. Not applicable. Item 11: Travel routes to and from the site and the number and type of trucks that will be used. Access to the north repair area will be from Highview Drive along the trail. An access road will be constructed from Highview Drive for truck and equipment access. An application for a right-of-way permit will be submitted to the City of Eden Prairie once the contractor has been selected and construction dates are finalized. The City of Eden Prairie permit is required to obtained authorization for constructing a temporary access route in the City of Eden Prairie right-of-way. The timeline for submitting the application in late winter/spring of 2020 and the application requirements have been discussed with the City of Eden Prairie. Access to the south repair area will be from Flying Cloud Drive via Moon Valley Aggregate property (pending owner approval). Equipment used will include a backhoe or similar excavator, small bulldozers, light bobcat(s), and trucks to transport personnel, equipment and material. 4 Beyond the direct access routes into the project area, it is anticipated that most construction related traffic would use County Highway 1 and County Highway 61. Item 12: Plans for drainage, erosion and sediment control and dust control. No drainage will occur as part of this project. Erosion and sediment control best management practices (BMPs) are outlined in the storm water pollution prevention plan (SWPPP) included in Attachment 3, sheets C -OS and C-06. Item 13: A restoration plan providing for the orderly and continuing restoration of all disturbed land to a condition equal to or better than that which existed prior to the earth work. Such plan shall illustrate, using photographs, maps and surveys where appropriate, the following: a. The contour of the land prior to excavation and proposed contours after completion of excavation and after completion of restoration. Refer to Figure 2 for current topographic contours and refer to Attachment 3, sheet G-08 for topographic contours after project completion (regraded area along trail modifications). b. Those areas of the site to be used for storage of topsoil and overburden. The site does not currently contain much topsoil. It is anticipated that the contractor will strip what topsoil they can and stockpile it in the staging areas, but most of the topsoil used in site restoration will likely need to be imported. c. A schedule setting forth the timetable for excavation of land lying within the extraction facility. Refer to items 6 and 7 for a schedule of the proposed activities. d. The grade of all slopes after restoration, based upon proposed land uses, and description of the type and quantity of plantings where revegetation is to be conducted. Refer to Attachment 3, sheets G-08 for area that will be regraded and sheets R-01 through R-03 for the restoration plans. The construction area will be re -seeded using MnDOT approved seed mixes. Types of seed mixes are outlined on the restoration plan (sheet R-01, Attachment 3) with a total area to be seeded of up to 7.41 acres. e. The criteria and standards to be used to achieve final restoration as well as intermittent stabilization. Intermittent stabilization will be achieved with the use of erosion and sediment control BMPs. Final restoration will be achieved per the restoration plan (sheet R-01 through R-03, Attachment 3). For further information refer to the SWPPP on sheets C-05 and C-06 (Attachment 3). Item 14: A statement identifying the applicant's program to insure compliance with the permit conditions, method of response to complaints and resolving conflicts that may arise as a result of complaints. HCRRA will obtain coverage under the Minnesota Pollution Control Agency s General Permit for Construction Stormwater. As such, required inspections under that coverage will be completed and will serve as means to oversee compliance with the permit conditions. Conflicts that are brought to the City's attention can be directed to Jessica Galatz (612) 348-2691. Item 15: Unless exempt under Minnesota Rules, an environmental assessment worksheet, if required by the city. Not applicable. Item 16: A wetland alteration permit, if required by the City Code, which shall be processed concurrently with the excavation permit application. Ajoint application form for activities affecting water resources in Minnesota was submitted to the U.S. Army Corps of Engineers and serves to fulfill the city's wetland alteration requirement. It is provided as Attachment 5 for reference. The application materials are supported by field delineations completed in 2015 and 2019. Delineation work was confirmed by the City of Chanhassen's technical evaluation panel, as noted in the attached application materials. Figures ~ f F CAL Pioneer Tr �.. Yyy f 4 c ".144 G' s p,t i 1., 'j 9 noKoa r tih a- .1 0 TWP 1I.� RNG 2s1. SEC 23 Minnesota Bluff Rivers �j Municipal Boundary ^� LRT Regional Trail Public Land OConstruction Limits Survey Section County Boundary O 0 700 Feet Imagery Source; NearMap, April 2079 - � - ,,, - ' - 1 t' •`' ; tie. j fr _i PEMCd1 .0 r. 1- i PE/M�A;. ' .r- t ' � -r 1 PUBG �. � ,,Y �• PEMCdA a ea° el- ..PEM\C, - 1rie,� w !PFO1Cd ...%. 1. r► �'�r r. 44 PUBFd .F-•. E+/'. _ Ir f.:'JLPUBGX J'.. •+�,•f • 1 0 ��� �. ✓ d 1 r _PEMCd i SAS Na �f Z �s. ..,a, c P";10,1 iq 1 PUBG. • . ,i I.f �+��� . � 1 tit i��f. } #l^ J '�t ExP�o.e'j C_ i•'+- Pioneer T� 4A� }r ` yp t y iaas� fjy! 1 +t,1. i ns PEMC L .'t�x7� f•5��iLA'- _: • 1 Voge FarymTr r .. o K V, r •1T t. 1 h r }` •er�1oa- r�;.PEMC ,i e 4 ! N ROD e0K) ,« f'+. f �s 1 417E 9r I V - 1 • rF .V ��., y ,.(i = f 4 • �. •, •i- "�' i ♦: 1`�y tea,' ccs Settlers t 1, I e A t. • t �� , •{r 'r'1f}- . 1 �/. r' r- (:'t� T��•rf�i PFO1C E �•:i••.,.i L' �Yv✓Si►i'JyP' r�PEMF Y _ 0 700 y(.,� •;.. a� L1UBH \ _ O Feet ®Construction Limits Freshwater Forested/Shrub Wetland g - Bluffs LRT Public Land Survey Section C'� Freshwater Pond - .. - 'k- , .. County Boundary Lake ota BARR L---' Wetlands (National Wetlands Inventory) t Imagery Source; NearMaP• APri12019 FIGURE 3 (� Freshwater Emergent Wetland — 14 a J x +R. y�3°t z y ,, yaw •a 4 WETLAND DELINEATION MAP Minnesota River Bluffs LRT - r r Regional Trail Slope Stabilization Chanhassen, Minnesota FIGURE 4 i P N OConstruction Limits O —1110, Approximate Stream Channel N C3 Delineated Wetlands 0 100 Feet Imagery Source; NearMap, April 2019 s -• { I � y¢� r Y 4 ' • �k - � . % -1y s 3 z., ♦ L w �y T > 7 E y ]R IVT k i? i > t i r Construction Limits Minnesota River O �♦ Approximate Stream Channel - Bluffs 3 p 100 �♦ Culvert PipeMinnesota M"RRFeet Delineated Wetlands Imagery $0afre; NearMap, Aprll 2G19 HO I OConstruction Limits Approximate Stream Channel �► Culvert Pipe 1-0 O o loo Feet Imagery SOWC2; NearMap, Aprd 2019 TWP 116W RNG 23N SEC 23 LJ Construction Limits Q Public Land Survey Section County Boundary M - Public Water Inventory Watercourses Public Water Inventory Basins O 0 1,000 Feet Imagery Source, NearMop, April 2019 " Cake Riley 1 ' <, Uno-med Ir ' 't e• �� TJ p�L � t• r _ Unnamec •y :.named �c '� 10 16 f i I oft TWP 116W RNG 23N SEC 23 LJ Construction Limits Q Public Land Survey Section County Boundary M - Public Water Inventory Watercourses Public Water Inventory Basins O 0 1,000 Feet Imagery Source, NearMop, April 2019 v _ _ N a C5 "I f 0 o u n't �f MIR W, I, Note: Qp 700 O Water table elevation data is from the County Atlas Series, Feet O' $ Carver County, Atlas C-21, Part B, Plate 6, Minnesota DNR Construction Limits >10 to 25 imagery Source: NearMap, April 2079WATER TABLE DEPTH Q Public Land Survey Section >25 to 50 Minnesota River Bluffs LRT B-= County Boundary >50 to 75 Chanhassen, Minnesota Depth to Water Table (ft) Surface Elevation (Carver Co., 2011) = 0 to 10 -\.i 10 -foot Contour Attachments Attachment 1 Proof of Ownership - Hopkins to Chaska Deed 1`V(, ) ,j J 54384 l 0 `f `�' GEED N0. 8fi 511 Authorization No. 7246 l\ THE GRANTOR, CHICAGO AND NORTH WESTERN TRANSPORTATION COMPANY, a Delaware corporation, whose principal office 1s located at 0 0 0 165 N. Canal Street, Chicago, Illinois, for the consideration of o G O TEN AND NO/100 (510.40] DOLLARS, conveys and quitclaims to HENNEPIN 1 t. COUNTY REGIONAL RAILROAD AUTHORITY, a Minnesota political subdivision N m a Mand local government unit of the State of Minnesota, 2400•A Government Center, Minneapolis, Minnesota 55487, GRANTEE, all interest in the ri rr ,,,following described real est .te situated in the Counties of Hennepin r. N Viand Carver, and the State of Minnesota, to wit: i t � HENNEPIN COUNTY, MINNESOTA C o 0 Nr� Strips of land of varying widths being part of Grantor's railroad right of way from Hopkins to Chaska located in the \ li n1 n o County of Hennepin, State of Minnesota, Including all of i� Grantor's rights of way and other real property associated therewith, not previously conveyed and not excluded and excepted herein, all as located over, across and anon the following described lands, to wit: Beginning at the South 'g line of Excelsior Avenue in the Southwest Quarter of Section 0 19, Township 117 North, Range 21 West of the Fifth Principal 0 i` Meridian; thence extending Southwesterly and continuing o ';I across the following described sections: �) e1 TOWNSHIP 117 NORTH, RANGE 21 WEST OF THE FIFTH PRINCIPAL MERIDIAN G Ile c7 Section 19 - Southwest Quarter pr 141 n TOWNSHIP 117 NORTH, RANGE 22 WEST OF THE FIFTH PRINCIPAL MERIDIAN N1r -a 30) P o O Section 24 - South Half of the Southeast Quarter n 0 p Section 25 - Northwest Quarter of the Northeast Quarter; (34) I , i North Half of the Northwest Quarter y, N Section 26 - East Half of the Northeast Quarter; Government \ Lot 4; Government Lot 3; Government Lot 2; Government Lot 1 ru Section 27 - Southeast Quarter of the Southeast Quarter IN Section 34 - Northeast Quarter; West Half of the Southeast f� �......y, Quarter; East Half of the Southwest Quarter TOWNSHIP 116 NORTH, RANGE 22 HEST OF THE FIFTH PRINCIPAL MERIDIAN ti. L1 V' h I- d tv N N M Section 3- Northwest Quarter \Section 4 - Southeast Quarter of the Northeast Quarter part I Cff f Titl N / S d• M — M 0 0 G 0000 0 000 N N N v 000�- of which is described n ertl tate o e No. 49402; East Half of the Southeast Quarter Sect i or. 9 - Northeast Quarter; Nest Half of the Southeast Quarter; Southwest Quarter Section 16 - Northwest Quarter Section 17 - East Half of the Northeast Quarter; Southeast Quarter; Southeast Quarter cf the Southwest Quarter Section 20 - Northwest Quarter Section 19 - Southeast Quarter of the Northeast Quarter; North Half of the Southeast Quarter; Government Lot 3 Section 30 - Government Lot 1; Government Lot 2; Northwest Quarter of the Southwest Quarter. CARVER. COUNTY, MINNESOTA Strips of land of varying width being part of Grantor's railroad right of way from Hopkins to Chaska located in the County of Carver, State of Minnesota, including all of Page 1 of 4 Pages DEED NO. 85511 Authorization neo• 7246 Grantor's rights of way and other real property associated ' therewith, not prevlo�a ly conveyed and not excluded and excepted herein, a'1 as 1,,ated over, across and upon the following described lands, to wit: TOWNSHIP 116 NORTH, RANGE 23 NEST OF THE FIFTH PRINCIPAL MERIDIAN Section 25 -Government Lot 3: Southeast Quarter Section 36 - Northwest Quarter of the Northeast Quarter; Northeast Quarterof the thwest Quarter; Government Lot 3; Government Nor Section 35 - ofu theHalf Northw sf t t Quarter; South a Quarter Northeast Northwest Quarter of the Southwest Quarter Section 34 - Northeast Quarter of the Southeast Quarter; Northwest Quarter of the Southeast Quarter thence continuing Southwesterly across the Southwest Quarter of the Southeast Quarter of said Section 34, Township 115 North, Range 23 West of the Fifth Principal Meridian to Granter's Milepost 32, -- at i on 1157*40, being a 11 ne drawn at right angles to Grantor's original main track center ve at its a point thereon distant 1,245 feet Southwesterly f ro intersection with the North line of the Southwest Quarter of the Southeast Quarter of said Section 34. .- .----- -- All according to the Government Survey thereof. Together with and Including all of Grantor's right, title and Interest In "as is" condition as of the date of this deed, in and to all bridges and culverts (but not trackage, signal and communication facilities) situated upon said real estate. Subject to: (1) Roads and highways, if any. (2) Covenants, easements, conditions, and restrictions of record. (3) Rights of any government agency, public or quasi -public utilities to occupy said premises for the use and main- tPnanr.P of existing conduits, sewers, dra Ins, water mains, gas lines, electri, power lir^s, and other utilities, whether or not of record. By the acceptance of this conveyance, the Grantee, for itself and/or its heirs, successors, transferees and assigns, hereby agrees Page 2 of 4 Pages I DEED NO. 86511 Authorization No. 1246 to, at its sole cost and expense to take all steps necessary to comply with any and all governmental requirements relating to the conveyance of said real estate, including land subdivision or use requirements and payments for any a..d all transfer taxes or other taxes and fees incl- dc::t at to the recordation of the deed, except for documentary stamps. In the event Grantee fails .o comply with any such requirement and Grantor is obligated so to comply, then Grantee shall be liable for all costs, fees, expenses, interests and Judgments against Grantor, and the same shall constitute a lien against said real estate until full pay- ment by Grantpe. further, this conveyance 1s made upon the express condltIon that the Grrnt or, its successors and ass Igns, shall ha:c the right to enter upon the above described real estate, for a pert od of ninety ( 90 ) days (weather permitting) from the date of this conveyance or until June 30, 1991, whichever is later, within which to remove all railroad tracks and appurtenances thereto, or any signal and communication facilities from said real estate and adjoining real estate. After said removal, Grantor will make the necessary repair of street, road and highway crossing surfaces. The Seller certifies that the Seller does not know of any well, on the described real property._____ /moo AND PRIOR TAXES PAID / PT�Ta Dim TLX DUs EME014 KPT. of Psortnrr TN; a H/Uc aeWos 0, V. BLED RF, NOT REQ, 13TRAN6iER ENTERM ((vJJ FEB 27 1941 FEB ?-1 1991 P9pP sr rx T = IW DTO r1;' otm I11NY' "1NTY MINN. -�oK Un, 02/23!991 6311M f=3:.n 6r.'i..3': /—/�+�1' CEPUIY OOOGGGt��� DATED this 20th day of December , 1990 Signed, Sealed and Delivered 1n CHICAGO AND NORTH WESTERN Presee/nceyof: T/ TRANSPORTATION COMPANY COMPANY Kit MAAU`.TAYLUR,-&..., en t -7,4A Attest ANNE E. REATIN Ss, ' ; SV atz: Page 3 of 4 Pages STATE OF ILLINOIS) SS COUNTY OF C 0 0 K i i, RICHARD S. KENNERLEY, a Notary Public duly commissioned and qualified fn and for the County and State of oresa.d, DO HEREBY CERTIFY i that RICHARD D. TAYLOR an^ ANNE E. KEATING , to me personally known and i known to me to be, respectively, Vice President. and Assistant Secretary of CHICAGO AND NORTH WESTERN TRANSPORTATION COMPANY, a Delaware l corporation, and the identical persons whose names are subscrib,d to the foregoing instrument, appeared before me this day in person, and being first duly sworn by me, severally acknowledged to me that they are, respectively, Vice President and Assistant Secretary of said corporation; that as such officers they signed, sealed and delivered said instrument in behalf of said corporation by authority and order of it; Board of Directors, as the free and voluntary act and deed of said corporation, and as their own free and voluntary act; that the seal affixed to said instrument is the seal of said corporation; and that said corporation executed said instrument for the uses and purposes therein set forth. IN WITNESS WHEREOF, I have hereunto set my hand and affixed my official seal as such Notary Public, at Chicago, Illinois, this 20th day of December 1990. / /4 oma•t mat S.KO WIT Not y Pub n and for the "TA ruflu ITAn or nlnm of ook, In the Stat of I1 nois r^(D1�131°�[>>. 'bT• 1917 RICHARD S. K 1NERLEY My Commission Expires: November 8, 1992 .. ...,,: u• acr/d sriould+ •F�anu,fi 7ftlf S���e N. (.r>IS Te; Seu//r c�csf S�Arce{ Ler(/ /j0 ✓CMN(N� CAM �/� If 5.T4B7-D0/6 ( / H,,l 44 763) This instrument was North pare 'Canalb Street, Chy Chicago icago, Illinois nd North r606D6�sporta- tion Company, L-131-17 Page 4 of 4 Pages �c1 5754OU8.1 128FE89115;39 05754384 CON $5.00 128FEB9115z39 C5754384 DOC $10.00 trxr rl ;:;:,Ntr iumn ta++.ry cc.�+ne, ru,xscnr, c[atrtr:F�.r: ;voce r,r ;arttGGN 91 FEB 29 PH 3: 4400 q _� ir'trM:'.Nt x 5rJ%Ji�ttU`t Gf �✓�+. li..w. C{. XI.fA.aCIN Olde.4F /r Yja TAX NAME MATTHEW. JOHN D & BARBARA 1 FORCE CHRISTOPHER & MICHELE A J DANIEL JOST PAUL W & SUSAN M ALLEN JUDY E MANEY TRUST EL1 KANE :R HOLLAND NEUBAL EW T KEEN N & ELIZABETH PETA DPHER & ERIN WETN & SHERYL A CARLS01 %NSETH W ABERCROMBIE RUSSELL A LEIGHTON 1R MARY E BRIOL MICHAEL PARADIS REV' BEVERLY 1 ZIMMER WILLIAM N DECOULOS ELIZABETH M VOGEL REV TRUST KEVIN E & JANET S WINTER BRYAN & ANGELA MALONEY UV' NANCY MADSEN REV TRUST BEATRICE I ZWIERS IRREV TRUST MOON VALLEY AGGREGATES INC N L JONGERI US RICHARD DEE & KAREN COUGHLIN DEE Chanhassen Landslide Repair— Interim Use Permit Application LANDOWNER LIST- provided by City of Chanhassen 12-2-19 10 PIONEER TRL 1008TH AVE S UNIT 1 1000 HESSE FARM RD 10005 TRAILS END RD 1001 HESSE FARM RD 10012 TRAILS END RD 10017 TRAILS END RD 1002 HESSE FARM RD 10024 TRAILS END RD L0036 TRAILS END RD L0048 TRAILS END RD L0053 TRAILS END RD 10065 TRAILS END RD 10072 TRAILS END RD 10077 TRAILS END RD 10084 TRAILS END RD 10096 TRAILS END RD 10096 TRAILS END RD 10112 TRAILS END RD 1025 HESSE FARM RD 10377 HEIDI LN 10460 BLUFF CIR 105 PIONEER TR 1075 HESSE FARA HESSE FARM RD 1 DEUCE RD 1 DEUCE RD BLUFF CREEK DR BLUFF CREEK DR HESSE FARM CIR MN 553189520 iSEN, MN 553174594 MN 553189527 SSEN, MN 553174594 MN 553189520 ;SEN, MN 553174594 iSEN, MN 55317 MN 55317 MN 55317 SSEN, MN 553174594 SSEN, MN 553174594 SSEN, MN 553174594 SSEN, MN 553174594 SSEN, MN 553174593 MN 553189527 MN 553189516 MN 553189534 MN 55318 MN 553189534 MN 553189534 4ASSEN, MN 553178659 :A, MN 553189526 MN 55020-9591 MN 55020 A, MN 55318 A. MN 553189515 1000 HESSE FARM RD 10005 TRAILS END RD 1001 HESSE FARM RD 10012 TRAILS END RD 10017 TRAILS END RD 1002 HESSE FARM RD 10024 TRAILS END RD 10036 TRAILS END RD 10048 TRAILS END RD 10053 TRAILS END RD 10060 TRAILS END RD 10065 TRAILS END RD 10072 TRAILS END RD 10077 TRAILS END RD 10084 TRAILS END RD 10096 TRAILS END RD 9841 TRAILS END RD 10112 TRAILS END RD 1025 HESSE FARM RD 10377 HEIDI LN 10441 BLUFF CIR 10460 BLUFF CIR 10S PIONEER TRL 1075 HESSE FARM RD 108 PIONEER TRL 1101 HESSE FARM RD 220 FLYING CLOUD DR 100 FLYING CLOUD DR 1161 BLUFF CREEK DR 1190 BLUFF CREEK DR 1201 NESSE FARM CIR ». 11 .,. un IHA�RH, Mry SSsls 1225 HESSE FARM CIR 253250050 JEFFREY M GOOD 1231 BLUFF CREEK DR CHASKA, MN 553189515 1231 BLUFF CREEK DR 253250040 THOMAS GNANAPRAGASAM 1251 BLUFF CREEK DR CHASKA, MN 55318 1251 BLUFF CREEK DR Chanhassen Landslide Repair — Interim Use Permit Application LANDOWNER LIST - provided by City of Chanhassen 12-2-19 253300160 MAUREEN ANN GRAllINI TRUST 1251 HESSE FARM CIR CHASKA, MN 55318 1251 HESSE FARM CIR 253250030 NICHOLAS WARITZ 1271 BLUFF CREEK DR CHASKA, MN 553189515 1271 BLUFF CREEK DR 257980010 P R KELLY PROPERTIES LLC 13991 KENSINGTON AVE NE PRIOR LAKE, MN 55372- 550 FLYING CLOUD DR 1425 BLUFF CREEK DR CHASKA, MN 553189515 1201 BLUFF CREEK DR 250350500 HEIDI R MOE 1510 MIDWAY LN GLENVIEW IL 60026-7792 19018 VOGEL FARM TR 3.01162E+12 JOSH & JULIE TAYLOR 15506 VILLAGE WOODS DR EDEN PRAIRIE, MN 55347-1439 10551 GREAT PLAINS BLVD 250351810 SKIP S COOK 185 PIONEER TRL CHANHASSEN, MN 553178660 185 PIONEER TRL 250250800 WILLIAM CGRIFFITH 250360100 RILEY PURGATORY BLF CRK WS 18681 LAKE DR E CHANHASSEN, MN 55317 MN 55347 18936 EXPLORER TR 3.01162E+12 RYAN & HEATHER ZICK 18936 EXPLORER TR EDEN PRAIRIE EDEN PRAIRIE MN 55347 15945 EXPLORER TR 3.01162E+12 WESTON T & LARUA K ROPER 18945 EXPLORER TR EDEN PRAIRIE MN 55347 18948 EXPLORER TR 3.01162E+12 GREGORY & COLLEEN WEBER 18948 EXPLORER TR EDEN PRAIRIE MN 55347 18957 EXPLORER TR 3.01162E+12 MICHAEL & CARIN VIERTEL 18957 EXPLORER TR EDEN PRAIRIE MN 55347 19042 VOGEL FARM TR 3.01162E+12 RANIA DOUBAL BACHOUR 19042 VOGEL FARM TR EDEN PRAIRIE MN 55347 19066 VOGEL FARM TR 3.01162E+12 JEFFREY V & JENNIFER J JIOVANAZZO 19066 VOGEL FARM TR EDEN PRAIRIE MN 55347 19090 VOGEL FARM TR 3.01162E+12 RICHARD J & SUSAN 1 LANAHAN 19090 VOGEL FARM TR EDEN PRAIRIE MN 55347 19114 VOGEL FARM TR 3.01162E+12 WILLIAM & PATRICIA BARTRAM 19114 VOGEL FARM TR VICTORIA, MN 55386-9639 410 LAKOTA LN 250362500 RUSSELL J BARTO II 1969 WOODSTONE LN CHASKA, MN 55318-9532 230 FLYING CLOUD DR 250362900 DAN & VALERIE TESTER 230 FLYING CLOUD DR CHASKA, MN 553189532 240 FLYING LLOUD DR 250363300 STEVEN JON & ANGELA S SMITH 240 FLYING CLOUD DR CHASKA, MN 55318 250 FLYING CLOUD DR 250363200 MAX LAUREANO 250 FLYING CLOUD DR 300 6TH ST S SW STREET LEVEL MINNEAPOLIS, MN 55487-0999 NUII 259990600 HENNEPIN CO REG RR AUTHORITY CHASKA, MN 553189452 250362020 RUSSELL & YVONNE BARTO 400 LAKOTA LN CHASKA, MN 553189452 400 LAKOTA LN 250362400 RUSSELL J & YVONNE L BARTO TRUST 400 LAKOTA LN CHASKA, MN 553189457 415 LAKOTA LN 250363800 MATHEW JOHNSON 415 LAKOTA LN CHASKA, MN 55318 425 LAKOTA LN 251300050 KEVIN FALCONER 425 LAKOTA LN CHASKA, MN 553189457 445 LAKOTA LN 251300040 WANDA SYNSTELIEN 445 LAKOTA LN CHASKA, MN 553189533 450 FLYING CLOUD DR 250360710 CHARLIE D HAllARD 450 FLYING CLOUD DR CHASKA, MN 55318 460 FLYING CLOUD DR 250363100 ALVIN R LEBENS 460 FLYING CLOUD DR DR CHASKA, MN 553189533 470 FLYING CLOUD DR 250362800 MICHAEL S SPIESS 470 FLYING CLOUD CHASKA, MN 55318 495 LAKOTA LN 251300030 DONAVON GLOUDE 495 LAKOTA LN 500 LAFAYETTE RD ST PAUL, MN 55155-4045 250350111 STATE OF MINNESOTA - DNR 510 PLEASANTVIEW RD CHANHASSEN, MN 55317 5.35. LAKOTA LN 251300020 ECO REAL ESTATE HOLDINGS LLC CHASKA, MN 553189453 540 LAKOTA LN 258490010 MARTIN K & KATHLEEN M SCHUTROP 540 LAKOTA LN CHASKA, MN 55318 565 LAKOTA LN 251300010 HEATHER LYNN SILVA 565 LAKOTA LN CHASKA, MN 553189455 5751 LN 250362210 CHRISTOPHER R KNUTSONAKOTA 575 LAKOTA LN CHASKA, MN 553189456 595 LAKOTA LN 250362200 JOHN C SCHWANKE 595 LAKOTA LN DR CHASKA, MN 553189502 608 FLYING CLOUD DR 250361300 608 FLYING CLOUD LLC 608 FLYING CLOUD CHASKA, MN 553189455 615 LAKOTA LN 250362220 JAMES A & BONNIE B SWANSEN 615 LAKOTA LN 5 SUITE 400 MINNEAPOLIS MN 55415 61 ADDRESS UNASSIGNED 3.01162E+12 HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY 7014TH AVE GOLDEN VALLEY MN 55427 ADDRESS UNASSIGNED 3.01162E+1261 SETTLERS WEST HO ASSOC - COMMUNITY DEV INC 7100 MADISON AVE W Chanhassen Landslide Repair— Interim Use Permit Application LANDOWNER LIST - provided by City of Chanhassen 12-2-19 3.01162E+12 CITY OF EDEN PRAIRIE 8080 MITCHELL RD EDEN PRAIRIE MN 55344 61 ADDRESS UNASSIGNED 250351710 HAGEN LAWN & LANDSCAPE LLC 850 FLYING CLOUD DR CHASKA, MN 553189503 850 FLYING CLOUD DR 3.01162E+12 MARK W & SUZAN R KAMMER 9600 HIGHVIEW DR EDEN PRAIRIE MN 55347 9600 HIGHVIEW DR 257420110 JONATHAN P & JOANN DIMINO 9751 MEADOWLARK LN CHANHASSEN, MN 553178826 9751 MEADOWLARK LN 3.01162E+12 KARL REYNOLDS & CHRISTI HART 9800 TRAILS END RD EDEN PRAIRIE MN 55347 9800 TRAILS END RD 3.01162E+12 THOMAS A & KELLY A HOPPER 9805 TRAILS END RD EDEN PRAIRIE MN 55347 9805 TRAILS END RD 3.01162E+12 KRISTA A HAYEK & PETER N WHITE IV 9812 TRAILS END RD EDEN PRAIRIE MN 55347 9812 TRAILS END RD 3.01162E+12 MICHAEL &AMY RUETZ 9817 TRAILS END RD EDEN PRAIRIE MN 55347 9817 TRAILS END RD 252640160 NATHAN H GRIFFITHS 9821 DEERBROOK DR CHANHASSEN, MN 553178550 9821 DEERBROOK DR 3.01162E+12 JEFFREY 1 HOLM &JENNIFER EKEREN-HOLM 9824 TRAILS END RD EDEN PRAIRIE MN 55347 9824 TRAILS END RD 257560010 MICHAEL A & CHRISTINE M MANNO 9836 TRAILS END RD CHANHASSEN, MN 553174591 9836 TRAILS END RD 252640150 TRUSTAGREEMENT OF RICHARD & CATHERINE M 9841 DEERBROOK CHANHASSEN, MN 553178550 9841 DEERBROOK DR 257560020 DANIELS LAUN 9848 TRAILS END RD CHANHASSEN, MN 553174591 9848 TRAILS END RD 257560300 SCOTT LAUERMAN 9853 TRAILS END RD CHANHASSEN, MN 553174591 9853 TRAILS END RD 257560030 SARAH J BREIT 9860 TRAILS END RD CHANHASSEN, MN 55317 9860 TRAILS END RD 252640140 ANN K LONSTEIN REVOCABLE TRUST 9861 DEERBROOK DR CHANHASSEN, MN 553178550 9861 DEERBROOK DR 257560040 JASON BURLAGE 9872 TRAILS END RD CHANHASSEN, MN 55317 9872 TRAILS END RD 252640130 JOHN M & LINDA REVIER 9881 DEERBROOK DR CHANHASSEN, MN 553178550 9881 DEERBROOK DR 252640120 RYAN & COURTNEY DUNLAY 9901 DEERBROOK DR CHANHASSEN, MN 553178552 9901 DEERBROOK DR 257560310 A JEFFREY KARSCHNIK 9905 TRAILS END RD CHANHASSEN, MN 55317 9905 TRAILS END RD 257560050 JARED JOHN GRUNIG 9912 TRAILS END RD CHANHASSEN, MN 55317 9912 TRAILS END RD 257560320 ELIZABETH A FARRELL 9917 TRAILS END RD CHANHASSEN, MN 55317 9917 TRAILS END RD 252640110 KIRK D HEISSEL 9921 DEERBROOK DR CHANHASSEN, MN 55317 9921 DEERBROOK DR 257560060 JASON EMMETT 9924 TRAILS END RD CHANHASSEN, MN 55317 9924 TRAILS END RD 257560330 LENNART J JOHNSON 9929 TRAILS END RD CHANHASSEN, MN 553174592 9929 TRAILS END RD 257560070 WILLIAM 1 ROUSE 9936 TRAILS END RD CHANHASSEN, MN 553174592 9936 TRAILS END RD 252640100 ROSS L HABBEN 9941 DEERBROOK DR CHANHASSEN, MN 55317 9941 DEERBROOK DR 257560340 JON FRANSWAY 9941 TRAILS END RD CHANHASSEN, MN 553174592 9941 TRAILS END RD 257560080 STEVEN C KIMES 9948 TRAILS END RD CHANHASSEN, MN 553174592 9948 TRAILS END RD 257560350 ROBERT G DAUB REV TRUST 9953 TRAILS END RD CHANHASSEN, MN 553174592 9953 TRAILS END RD 257560090 KIANGDONG LIN 9960 TRAILS END RD CHANHASSEN, MN 553174592 9960 TRAILS END RD 252640090 JENNIFER M PALMQUIST 9961 DEERBROOK DR CHANHASSEN, MN 553178552 9961 DEERBROOK DR 257560360 CHRISTOPHER CATTERBERRY 9965 TRAILS END RD CHANHASSEN, MN 553174592 9965 TRAILS END RD 257560100 JAMES DOBCHUK 9972 TRAILS END RD CHANHASSEN, MN 553174592 9972 TRAILS END RD 257560370 STEVEN R PASCHKE 9977 TRAILS END RD CHANHASSEN, MN 553174592 9977 TRAILS END RD 252640070 PAULJ TAUNTON 9980 DEERBROOK DR CHANHASSEN, MN 553178551 9980 DEERBROOK DR 252640080 JIMMY M & MARY E ROANE 9981 DEERBROOK DR CHANHASSEN, MN 55317 9981 DEERBROOK DR 257560110 RANDALL S & MELODEE D BROOKS 9984 TRAILS END RD CHANHASSEN, MN 5531745929984 TRAILS END RD 257560380 MATTHEW J WILLIAMS 9989 TRAILS END RD CHANHASSEN, MN 55317 9989 TRAILS END RD 257560120 RICHARD BARBARI 9996 TRAILS END RD CHANHASSEN, MN 553174592 19996 TRAILS END RD Chanhassen Landslide Repair— Interim Use Permit Application LANDOWNER LIST - provided by City of Chanhassen 12-2-19 �,. Diu nC%M nDMFNT 11 f I PO BOX 94 SHAKOPEE, MN 55379 110520 GREAT PLAINS BLVD Attachment 3 Construction Design Plans MINNESOTA BLUFFS LRT REGIONAL TRAIL LANDSLIDE RErAIHS HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY (HCRRA) I W*MTA COWff IAAF CONTACTS G�'iS� a�pTAcr ,T 9yYKL �.NA.P�w WAwn LLYyX�nT.w• w FR FTP11 AL..X NCPeE on HCRRA MINNEAPOLIS. MN Nm of SHEM OLI TITLE ENEV, WHIJECT LOdnON/NOBXEETINBEP OM LEOENO, NOTES ABBREYMTlIX . M9 PL10NYENT COMM CATA SCS . STATEMENT OF EMAE 1O Q.TIES Op ...SITE ACCESS STAGIM], AVO L TRAFFIC CONTROL WERILL PLAN AND NOTES O® SITE ACCESS. STA,,N]. ANO FIC CONTROL. PHIS OA SRE ACCES6. ..W ANO 1 TUFFIC COM PM PVNANOOETNLS OA TRML CLOMWE aGNACE EAST OF W¢ RILEY OC! MJECT LAYOUT PUN EJINTIMCB' PVN CCCLCHOdOMOlf ., RBXIBNCCPWICNmPMT O. ANO TEMEROSION V CO MROI%IN PASONCOMOLDET.B MM.,RNMLMEEM.AN IBKP sTOWINATER .Nm.AWlI6NPm OCT TRALGFCATION.ILANANOPROKE CM TMLM TIONS CR8 6E"O CIS TYLMNCPTOBR6Ec. 4m GLItlI TBBNWdSRLNARwPEAAFrSBAILnOOPPa Ci16 SMEACIRYEEEM➢MnM1IIvRR.U PT VABNNED cwBnToBI w NTPLAN F11 BMTHARFACVRT WET REPNR:RIOP NCE6CnOW C.L. MECNIFRiEPEPPER BbANETCETNLB C.I. NREPfMTAR C-17 NCSITH AREA MOPE FkANR -PVN LIB UGG'AmB TMPOFIE,ECTRANOUE STOYe ERANCOSANAGECHANELflANANON BTERRNLMCNRJEL.TIONSANUIUF',I i. IA.II 6TORW6MRANDORAIAELmL "CIKM6AN0O1nL R.M BEEONBP.AX R. R@ TME C AL NUMMFTMIEYULEX MH AN RdR RFATOPAnON EFTAILt GENERAL NOTES'. TA FlICN:WMYCdNKTIOfI SNRIN]NIEBNl000IM WNWY m1S , euRN>!rwMcleE ereTaraeMCNe Ix JAXNARr LPIeAMLHwR mn LLPM TOA'mRIRF(. L. IYWlM, CCOIROM PC ,,MTLAIYTICPALC0PPAIJOXIMIEM1XCd , NIxNLemAJm1 S XwMMTH dNYAMWPPY1YR 6rRlY'. dINIR UAIXf/C6RpNATU. INOp HAX. W eVMIIYf[LT. .. veATNx drvY. locos "DDEWIN NO7"CONST9D'CTION NUSLIUE REPAIRS 3311 mlaw CHANHASEEN, MN ET, PRWECT LOCATION, AND SHEET INDEX GO' D —]R— IMTIp INRx.. __. TM-__ eMRnxplEmgYEaAlEooxmux _ _ � [u9nW v1RCELUNE �R— EFIBnxp H1tl1Y6ENFp —A— EiiBnM RHIR WIC MIN lenMUReM:cuR — [WnNHCdHEMAId WE ME NT 4xn• EYISnXp BigW }MLLIEp ��--- ExIBnNHHnEMMEFTER2 —RT— ExlHnnp REruxD YKOI Cd19rRUC1d L14rtS —HR— mpeNep lxpMcoxrwn �fR— IRMEEp IHRgMEaAiEC fPIR —�— FROttleEp HECRR.. Ft —x — sRoosEDEExcE ---_ cETRAIMMUNT. SIIr EEM,E O e,. nre HaL Ylm.O 0— EXLATND nEZDNETEN SIR. .N.1... *--I Mne SqL eXINC AOMEM.ATIONS C. CATCH Mel. HAPPENS ! C.WiiWVU CmiggLlp LCRARI Na}H XeiEgNla MIN ECERLwTEDMETALPSK EtC CCHCRETE ELEVATICM 4xn• HECTNX� Rnp IpRrN EVEEVERTEND RT EIEVATIpX AN N MI MESETADEIMTMEM6TRMOROMTArXM YKOI ANAL Na1MAL.1. LIVEL MIEQEE.UYCRER arE TS. .N HISAIENCESSEET RATE SYMBOLS Nna e, 1. mmx IMRM L 1 ~^m SECTION VIEW CALL OUT ammx NgmryM fRAI RECTION: ORAPHICB BTANOMDB �] SECTIONVIEWTITLE NE sal ••�s�an 1 DETAIL VIEW CALL OUT vR11[ lixnryM (}IAfyyy��� /} \MTAI.'.ORARXLB BTMpORDS RIe.1i.,lelq)P OENERALWTESF WTES. 1 CdIIRACIM$H4LLWAIFMDEMILKRf Au Ml WMI MMM VNRx ].ME 1XIETHEC; (A RARI-ARNHAEL SCRE EA aaNPoep pJRI1pMCCM19AR?Np* �iIL9.�O SMALLC4LYpIEMIHMVtY• Nnx THEER INIERTDCOCUMEMMEt lTi ICT.EFB..p ..IS. e. COInRACTR STALL INSTALL AxOMYNiMx AU EWaKNCpRTERE. ACMrp CCYYINRMENI W ORApxp Cqi EACH LCICATCM DURIMSCg6rRLCICN EA®ICH cCxIRU.A.1eRWID.IXHICNINEMpJIR.TWN/ .igLlrtpN EREKRnOVOI CENSTRIACTICAU MEAwNRIWE MMIN m01RLG gNLAY , M C6RPW.T[p LMHnle CVwlRµpaiAXEDIXM f1ElO. 6 .YL�IIgµpORYRIIq iOa[/ERECPMeOdILV WrtXM ORIJxxDpY12µ0 eM Rawls uNem aTEnvase DRecleD R EMMMeR. nllea TO R ¢CMIO AU R MMNEO IN TEN EIELEI INSHORE. n1EEE.. r M aRYerz. MENYVII¢pIW R. HlMu R ARaRClep. rReM IRRrRDnexaxeeR SCAAMnaNt Rporeax]x axMLRATecRp ar RDRCOMEICIRN, MMM suetnnAMCS METRIC ICNESTED T15IxON RI.. RTI eNM1 ap INtlLCxTK • CLR111IG}lM allµL rM'E AeuITCHNIMIMM3MTRMLSEERWAWATCARO rzRRHl114LL INVMM SROM TOTHE MAMIMUY.. K<SRF. I_ _ TRAIL MWIFIMTIONB LOl MMTA -AMhIMEW ITE B El MEA CULVERT WILET AM WREAMBAYH REPAIR CONTRW DATA -ALNMIIAENT TVILM. RMT RATIOI RM]IpEI]M4 ttMR W]W t.Wp IEMTH WW qD RATtlM nRAtpl IMDRAIKN [MDIAAEEBq lXO W1Rn Mi Ipltn Mp _ MRR Eli 4pi MRC HPNM RESSIN mus Mc IMs NmN NORTH MEA ELOPE REPAR CONfgW MTA-AWNMENT N rYq[MD. RARRATLN RMIMDI111RD RMrt LMiMI [Mp]J ILN]gl EMM• pRRMI RRAT4N [IORA}gN INDNDRIM] INO WIaO Him. ORAINAOE CHANNEL ANO STORM BEV]FR CONREQ MTA-RLRNMEW'B' MYq. RMERAaYI RrMlgnl[IN nMrw]M [MMIp tlME11 MIAUa pCtt/RgIX rtnAllgl ew nA1AY eNDrllaaHllU Mp WnIXI HAPPENS .MA YL Y MIN wYa ver NHn• IN 4xn• A.am• Rnp IpRrN MY IrNYrI nmA xVNI[ p IMfR LAY M•NE 4M.M Moral I LANDSLIDE REPAIRS —7 xatntpu,w HCRRA CHMMq&SEN, MN MINNEAPWIS. MN RxMeKn Recxlmp RRSANNR A[ c D C x ANENNIR I LEGEND NO=' -c' T-L90NR, MDgLXiNMEW CIXJTROL OATq :w,n..>NMrwMYglq N.r.r.G„l.MMnwlnpeNllnrN� rlmnn.Nwwnnrranwrwnrom mmlmwn +�� rau Imm rownNe MunmrvNrla rorw+wr®aroxrinwrwMrw. Pmlrrnwwwrol� w�+wwn�evwnvn n rrw.ww.wonolweonnwer rnaP • +�rwrn+nwow sv� ro�wrao�e1°"vw�.noNw �nwm !. lurrwrownremrw+rwwrunmrmrw.rxw � MwNMNrMur�iwe nn�r/a dvuemNlNP/Onwfomcrrw mewr TR FICSMS OlY ��� lN1IlQ! Nw YlpYp! pq.1p. a ar.» O oor e nrw ».x uar HCRRA CHINH SSEN, MN MINNEMOLIS.MN BRED CEW, STM NG,, MO TRI IC ONEFN.L PUN MD NOTES / 1 \ PLIN: OVEAti I,CC£BB PLMI O \✓r N cvewrter 80% DESIGN ------------- qm ileZn.�Tca 3 ^Sn $ u _ xcnnA VOL;4:,, a �r ` w....� w T teT w - rv�.oe — a^ dr �Pmwry ut aw c�xucT— mme` \yam r 1 7. f •^.L i :- "�sonenwaw I8N'. SITE RC US STAQING suewear m Q mnroTua rw Nvlxumem,w ---------------------------- AtmwnpwxfY mMEe E.wleceaal naewsairtu aYldcml [cwMndd¢Ndn�w �dNMew �e'ua¢" nun S d /L\IIGTNLOiEMPORNn N£ELN0.9fTOHF � � � p"t e��aVnwuf, un rare avow wuEUErvi m`.ue i TMLE1 w�nevuuee r,fw,uwenfonwx.Eu Fulenmormr O :euerT YMIw ORNMTaI nOR d�md ``�fueRodweo I1e N1MEd1F MMF/glp F faW,wwduro IGMBBKCW) O O O R to.e .ellddew.� -__Eason' ETwI `E1-1—Tw...i.. RAVEL TRAIL RESTORAT ON \I...T ,%;;L�NO ¢BITUMIUS TRAIL RESTORATION G /9 �� 90% DESIGN nnTraecaysTRmucnoN HCRRA LANDSLIDE REPAIRS a+aw+aw CMANHAB6EN, MN rnefp A e C V o t " MINNEPPOLIS, MN SITE ACCESQ STA NG. AND TRAFFIC COMROL nEVbnM RKnIVIUM vee PI MD DETAILS �d taxa j / rzr. W RL E h \i� rr `\, ♦ ♦ �_ _ ___iii/rii / _-_ _ __ '�'�i1 �1\1111 1- i I \♦ `'f �i���='�'ii% _ _ - _____ _ //'i' //lrV __ __ - III\I /�_� _'__ _ � i _ _ � / I __ � `_ `__ _ _ .\�( `� ♦♦' az I / ' a'L /_'Y _ _____ - ,/'Ill // '/l / �♦ 1 _ __ _ � _ —_'ri `-_ _ \\\ - 1l IP /' ,/�♦`♦``1> �� i•�'� ii ri rri/ \, 111 � T � _ __Y /,% � "' "/S_%'�� _ (r r - __ _ _ /r _ rui ir;' b% • _-____ — -- /r, ♦1_ __'-_� • _— _J_'�_ _ _Jimnnw _ _-_ __ '_ _ __ ___-:;�-'• ,.. -- -- - R _ z v a_1__ _ _ •_�� \111 _-�_ , a � - �i� '��-\ x iW x \,�I1\♦I\;ti. _ �q� "x lu¢111 1 1 I r T,. e. 11 /�1 � I' v „ f \ \I Ir—•y ','-M 11 11 I I I _ _ �_ � \ �— -- _– 11111 /lIl �l � ri '' \\i\ 1 1 I�, 11•rr 1r-/. __ __ _ _ _ _%i � / 1111 1 / r _ '\♦ , Il � / ' _ r-\ � ' _ I __ �:\\.1 �,.,I 111111 ♦ _ / / %-�-_ I // / / _ - \I ;4\ ` fir '/I ♦ ' / / I / l %� \\ 1. III 1 ` / , / ' ` / � // YOIMulnp.7lgBB �rnxux_L __ , / % / l/ / I //// / IFYWVxZ', '// r I / /// \ 111 \111 1`, ♦ _ / r ' / l I //j///%/ //// ///%/ OM1'6 r// r / / % /%/ 1//' / '_�\\\\\II\1''111111] _ ' / j � l / / \` 1 _ \ ``� r'{' ,/'/� I1�111111///�,///1l/ .. `I�1\♦♦i /i"' // %'/////II%/'/'\♦\\,1111111111\111\\`♦ - rr////%////♦ \ \ (\L y♦,m 11 I f II // l/ \, / /Ij 1\\\\\ l/i iI `\ \I �� �- ' �' I III '1\I\`'♦\\\I\\♦ \I`\♦ 1 1 _ / /r , OU®Ixx SII/ ri ,� \`\`I\\1 \`;\\\\\\ ` ` \i"' / �// �/ � � / 1 -' s��: '//'i'� 1 I I '\\. `♦5 �.�:```�\\\ t/ -'- i i �/ i%! � iii-`�" ;I�1 `0 \0 \�u� ``\\\\` / Pi l� i i � ' � r�i /l/f li,\`\" ♦ . / / //%;' // t111J 11U1 Jll o\. \ \ � ',,'' / / J \ \ ; �'' ;'r:-,_.._��f _-ice_' I; 11;, ,`r_,\ I/%' _ f;/s/; ;, ,/;;;r \I;\,\\\ \\\\`\\t\\\ \ ♦:= /; ;; ; ' !-`♦ I / / / I _ __- _-_ _ __ ! - 11111111 111 ,11 1 \\♦ ' %%I � � i � � II _ _ � � _ __ �r-_'``'/•-i'/i �',i'//i �'r i'r r'' , _r`I IIII 1, II l.,ll i _ r r / _ /// �.� 1 1 ' >_1 `\ 1`_ _ _ _ '/ �%/, 1111 1,11 1'1111` \,` L'�y ' ///''r%i%'%, � i'// % 11\'\1\I II I ♦Ill] 1%i (. I /` `tip � � ♦�'.. �_ � 'I-�_ _ ter% r _ _ �\ \11111`\\`\\\I `t`\\` r �__// .' i/: % r : 11 t 1 ____ _ may, 'y 1 1 i `. '::.1 I A'BB�MB \♦\\ ' /i /r r / / 1 1 11, 1,11V, BI1MAWti aIMIaPATEO FI�MENr NEED9 i J ' r // rr ' , ♦/ `I 11 11 \\ 1'11 ^l l 1' ; I I \\ ` _ `\\ �_�-�.�F�, ♦♦ ♦\ `\\\\1 � l l % �r i(ir r'r '\ \1 \ 111\1 11;1111'�'11�\I r�'' ,1'" ''/11'11 ♦`♦� Bre / / / I I ' 1/t /',., _ r• Jrl , ! \`����__- ♦♦ \,\;; \`��\ \\11 r'/f �!1 , \ \\I 111111111111,1 j 'J r iS:. - _ - �-:C2_� "t 1 . _- � ::` i ./gi♦e1� � _ -___� \\\ ` ; \ \P 1 11 1 \ 1 1 \, ` 11 1 111 PI \\\ \ um,.e �.•rartxonr �'_ 1 __ �_ - - ♦i `0 - Ili\`=`' �`- __ �\\ \,J..-��\\\`\\`�\\\\�\ul\ \`�`\ ♦ 1 \ /11111 J\1\pl l„` _ _ "i'.=�_ _ '__ _ _ t. 'sg ' _- ,• O: : `. ♦ 111 \ \\n \ \ �' — :b Y` C. i `>, `."\�♦ \ce=3=�`v'i 4,'11:1 _'-_' - `u\ �: ` \\; `M ��' $ rxex W%DSSfGN ADTFDRCDM MLCWN LANDSLIDE REPAIR�7� iI _R HCR RA CHPNNABaEN. MN ;,q BEWw ueulPlNn ., B O 0 MINNEAPoLIa. MN PRg1ECT L YV PL 1 11 -------------------- - ----x---- ---------------- --- mm 1 _ Q�1_ Mx01liMYlIYIi O 1 11 -------------------- - ----x---- ---------------- --- mm &ii '- uxeeu xorte. &ii cni __ � � 9 � Y K�� � I! .p., 1 r y.•. �. ~ w:,,y^� � jl'�� '� ter• - .wi: .. � �_j��y�,,�ir• �r; , :71 _ .. �j+ltlly _ , �y a':. , ' _ "�;.�' .. b pi'n'y � 'f�A Y� � *�,� ' '. ,�S �� y1�f,}"`l�►,+ ^•'1 j_j���$S�K �I. 'gym" }W �n.'.- Ale ,-7.4,pY.y.' ^ Jr'/i, __ �� � ��b` \1\1 �1\I�\1111�I 11```\d♦ ♦ \�\\11111a1`r 111�r "1YII I'1 ♦1'♦\ ♦1 `I` _ �-_ � � _ _ __ �_ � _ -�A� ' }. Ir. �j ,1- _ >if _� _— '_ __ -�•=__111\\\ lii- F �I�"IW nl11 rl\ - ___—__',_-_--�____________ ____�-_-_ '-cl 1 i IJ :'.� y'C='_ w�_ l %N/ r `_ ``i.�xR v /)' '// _`�♦x _ _ ./' :� /' .'f iii' `�� _ ♦l``'=----------- _ _ �?-- ``b--------- -.�----- N-1,_ � /f /Va ♦ 'nl lllr ll'l l'' ,,j$i__— 'ti-.T`` ;.�'�.w'.[� :��_i-s___ ii' i �T•� - ___-_ _ - _ ____ :n ilil `IIA 1d�i'i' - /1,1 I"11�11'r�12� �� ,7, - i�`" no$1,6�: :1. / 1/ - /ii=:` `�` __� � _:.aii-1 .y M•I '.ii'':i :'',"'j:'• r_l l 1111 1 1 IN _rvJ..✓����jjj ��'999�i ri.. �,l^ /M//�'' r.'6yc..r �f - �1(-' 111\r 'J/S I♦: •FJ'�H f.,� - c �:/ g \; /V _ / MmWlrv-------- Lo" y --' =- �' _ `.5•,�; - Iii i"' �-\'r ��\-_�`__'-_-_''---`_,--�✓ I 1 >'.. s_a= ---. _%'.%'' ' _=xiew nwsaurt _ _-� <w 'yy°'� _°_ " -'.,1'Ji r / i ! _ -s-ss. - � � -1' �1 ® ✓NMra�a �R '- 'y.�„v___ _- _ `` / / ' ' / ✓1 ”- �- �_ •`� "�` -_--., _i:-i rlri.r.ilillr %ill ELIIFR1NfRNYRMLjey Q9 Q — c �ci -'. �` rl�l \ l J.' �MnY0. 1 11 1 I . / ' 'il ! _ / 3- � ' 93 / 3111\ \`�I 11 I r I \ I 1 �—•T I <u _ d fb _ - I \ - � i1•Y' IT rr, i% / 11�I1 �II�' -� / ,lll /Ill >T - ' 1� _ I I l• '.., \. 1 11 1 1111111111 \ _ i '%/ ' l l r Ime I r _ aw l l' I 1 1 1 r ♦ \1 \111 11 !lit .I� h -- ��i +I mlwwMei vxeiliw 11 \1111 III♦ •♦ __ ' / / �' aiMefl w yyl1yxpp 111♦`♦ __ I ` I / /' Ill, 11111-, ,' wellwrwMY4wLLNwV. 1 11`II�`l\• ♦ ♦ ` � / i / r%/ oili x 1\ -""1 I1 - rl rlr/1111111' I \11111 \\`\`\ �♦♦`♦ _ j ' // / `I Yom^ -_- \ `max //�•'. 1 `\ I,.' ; 1 ' IIII l/ /fl ' 11 ` 1\=i%�/'' / //l/ I'/l 11 � � 11, 11\I1 \\�\I ♦`♦\•\\` l l ll /I j: mxwW11RM.IIVE \ 1` \ � I♦ / lil 1111 ll'l I// j'' I r'//ii'�rll�llli 1�\�\\`\I1 �\\\\ \i'- / l lJ//I I 1 - \ 1, `.. 1/ ". i 1 r I i r II u0 p\`o.�:" \ I I hi \P de 1111111\\\\\\♦ \ \ \-'' ' / , , �__� uemnlvwnww 11 \` \ / IIJ\c.. ..♦..\\ . I_ `I':'�.' /' n u-LIPgPI u\ 0-I ' 1,-:: r :ii ii i____ unwuRm '// / , _ _ _�_ � ,,,I I,- -__ 'r �� . IYiIaYYNEYe`MrM1.MOWOwAiltlXllaVwWrlw! ANO �wx Nw� '°wa wen wmew i 1 1/i'p/, Ipl''; _ _ _ _.__:-//)lil :/'�rJ a evw�eveomeEnlx..rlue me�iawl`.vw.xww r• ; -;,,, , /, /,II ` '� •�__-- ', I ',�/'; i,�J ;;;• .IIwxRM.NNwMw.Nr.i. Y.M W.wICR'I.nel.wn �I��i .a r"r`r l 1 1 -' _ ._��' y�pxyeeelwxpeMpxwMLRMwlwxel anallaeew Nwrwrarla���ir�rrwwlnll..lwclw.. I ��y'�"v'-/i� i,ii�.%'ii:' 1 1 ♦ ' 111 � -�--` _'i L�s / r�.� /: /r r ylelurwmw/.wwxrwrwwMwawr Meww eleewsereonlle. w.ueMwMmw. Z � ,,' u`,li _ 'i'-i'r - i � /„ EwrNW MMIMO wIwwMwvMWeeplWewIRMNM � dwOMewMeeeMrwR Nwixxd[wNxiM'r nxu 11 H[fi i �, 1,�%ilP �/i�i-��,�II1, `I `I\r .•` 111 '1 /rl Ili-♦` /♦'lli-i �ii''111 �'/�ii',r'" OwMPIYESMraO.eOTtN lNaeeMMM/ixrtmM1enm ��EepM1eV.MawlMlalw'MnmNVulslOmexdex � /, //, /1/.��� ': / \ 1 , r I 5'%' , , / `I "I'\♦i`; Ir 1 1 1 1 . 1 /I, / - /'I_ \OwlrelRwa MOMmIM1eeYY RxLm�\MMlpewe:MMIMMxwwrEwwweon lEeoiEen 1 wYW1NtML1oe MPM1PiRM0wwClxwllGmexxwvlx _ ' 'I 1 r:1 1111 1 II! " _ W"♦"\♦\♦``"��\ 1111 li rZ.11 ewww/InrovwnweenN R1w1�eM1�MeW1 ey�yGy.1w�11��elemEx. x ae 1AIYYIreilFMe.t Wo1KMOIwYnMpwwlY[Iexwol4aM rdlOwMewMI11w1MwlllAwnMGP mPrtmia `�gEmowuvww 11 \ . /,` -- I i -�-�.4♦`\\\\ n\II NI (\1111 ewYIIIYIMeeniMW RM1wC1w1eYY WVIw.w.�m..artm Wx9eiYMeREMaNRMee1EY __ .",1 \CIS_-'Li 1i`. _ 1. •`� •- ' `--' �;._� \ 1`u1111�\I Iw.Rerwewl..nrlwmRxR.va.suleeww.alvl.m aawrwMevwlw.lwnEa.E.wreo'.IwanxneuEa i' ` �♦•''S' __ 'YOMIVWlY �1`I\`1Q �\"``N♦\` xww N\Vwn RMYReIeIYSMwwgYrn Vlail�xlur a MdM�'1w\rP/e�.E���Ecea M�reuW/rts -i' \\\` \ ♦\` WaPM11wIiMMeliewxElnfM101lAMRMD.Fur xmIMY1O[NCPIf6YYeM WYEaeoHeol..M ovw®[wxr.o _ �?r' `�s X541 `•1 1 _ �In��` /minwn .\\\`. `:.�;`\.`:°a:.` Ie1°0'anix'wellpP1�:I�1°w�wrwell�w.mw'°'il.l~'w.:,.,"�.1� v see mlewxewn.w.�x.oalE.E /, _ i"'J_y5.,' \♦`' �, .,J fii\S __"aL!r\ 1`���1\♦.\":.♦`.`:`.:. .uvelvwwoawowwexmna,Iw.rt AIW •_/ .-♦\. f„ \.\\\I \u ♦\1.`\ eomvawwwx.`wwxMRRa Maeawlalewa coPea ¢NRMaEeNeeee®'exu M.x.wo.xll..eve�'e.F°.o.�'".ox'. £'- s%' ��1 \1 '--�_�'1\- -_ \\`\J\\♦`�♦♦`:c:. `���' mollaeuvlmw��Iw .Yx'e'0oeawlw>i�R.w:`"•wawr... �IiN.��e�M.R�e alewwwo+...x„vN '. .3.' ♦` /' \♦ _ ;, \` j'1 ``; \�`:�`. ``"`.:` �II�I1YwRexrr.we�xwMYmewal Mrwmexmmx.xo ' � `I • r _ �� `\ / eYlell<Y16 RIoeexwAVYIMwIaMi RRn�Rx.eo. Waeom _ /) iin 1 ` \\ ♦ ♦ ` MIIOIOPefMal4.IReYew.lwY s11 ;M♦xl�l" 1 %✓``_ \ l;l's _�__ ___"_".( `�;1e,1J ..♦. .\.. ..x .. REMOMSM MPORMY RMO 90%DESIGN .r..e,x.r.. WT %ORc SMLCTM LANDSLIDE REPAIRS z3wmla oY HCRRA CNINIMBBEN. MN .fie w. ' ------ MINNEMOLIS.MN REMOV"MDTEMPORMY ERO $ONWNTROLPI- G03 O i IIMOM CfdCNIPIYw IRR COWN6TRE.W WEW ^� rnee 6ECTNW VIEW rein xeun � e�irt axmxueru wrx�irrgrwPia�iavnuPa�tt�ManwrMmwmxrvneaa Ar a e.r xu w wu�rM.mwe��•q A.mrw[or�inyMnMPa e �qp•.. tyros Pgrsormxr.MArronwwuY®mmeeq.epw aiRra.m.Ya®PnsYq MoannrdxA• wFerWe� e4�NrYgttln.lbrttU]IYbmMllggr4RNSMB4iVfq McT/lYlAcliygMMrgrq MrgrrW'J. qiP m Of.n n.nur eq Pm M rNgc w.Mw� M M eyeC riq M M.q o M Igre m /Calertlrt M..�m�W MxtmK.pnIMeMNMMvn.CMmr.•gM ..M..gmn w qiw RECTION WEW 1� r4iottrtcrmw'� runni�a� rwa��rA�i !ioMww.iroA e M+wo m.Ar4ee"er`�rmm �rav�m esmno.m•exr wxuA M®DFT�/II INLET PROTECT ON . SED MEM LOG &OE WEW ON OLOFE SIOE"EWFL T ll� COWN6TRE.W WEW ^� rnee 6ECTNW VIEW rein xeun � e�irt axmxueru wrx�irrgrwPia�iavnuPa�tt�ManwrMmwmxrvneaa Ar a e.r xu w wu�rM.mwe��•q A.mrw[or�inyMnMPa e �qp•.. tyros Pgrsormxr.MArronwwuY®mmeeq.epw aiRra.m.Ya®PnsYq MoannrdxA• wFerWe� e4�NrYgttln.lbrttU]IYbmMllggr4RNSMB4iVfq McT/lYlAcliygMMrgrq MrgrrW'J. qiP m Of.n n.nur eq Pm M rNgc w.Mw� M M eyeC riq M M.q o M Igre m /Calertlrt M..�m�W MxtmK.pnIMeMNMMvn.CMmr.•gM ..M..gmn w qiw RECTION WEW 1� r4iottrtcrmw'� runni�a� rwa��rA�i !ioMww.iroA e M+wo m.Ar4ee"er`�rmm �rav�m esmno.m•exr wxuA M®DFT�/II INLET PROTECT ON . SED MEM LOG &OE WEW ON OLOFE SIOE"EWFL T mwmm TW"EW a.m.�.e::o.•wo�ww.Mm.i.c��grP.00.w..w.q HCRAA MINNEMMIB, MN. . PIO waN•KIV6...ttYVglYprgerpFM.Rwyrq.ip'i MµurM, R_MIMMs'.LLv 10AlYnm�i.CNA4pxwv®�D�lane.. `Ei.[leaueoi �•Wlnttq.�Nu6wMan�w an.u..M�... M.wq m.rane MqM _gMw.srq. un..wn.e..•n.o Mn.M.o.P.m.rMw..PnM a �waA w�veP� � �wM rAm MrM p�M CHINW1 N. MN MTRIL6 90% s;�uik N9JA/wf mwmm TW"EW a.m.�.e::o.•wo�ww.Mm.i.c��grP.00.w..w.q HCRAA MINNEMMIB, MN. . PIO waN•KIV6...ttYVglYprgerpFM.Rwyrq.ip'i MµurM, R_MIMMs'.LLv 10AlYnm�i.CNA4pxwv®�D�lane.. `Ei.[leaueoi �•Wlnttq.�Nu6wMan�w an.u..M�... M.wq m.rane MqM _gMw.srq. un..wn.e..•n.o Mn.M.o.P.m.rMw..PnM a �waA w�veP� � �wM rAm MrM p�M CHINW1 N. MN MTRIL6 90% T" SOMNINARYOR POLLIROX PROMOTIONAN" RANDMVM PAN AN ME.MEDIX CCMRNNt[ wmI T1E NWX?]OUN..M., OR ANNATER RPMrt [W11rRVL AN"NO ANN 1091 pEINNALMRYrt1. AS RECOMMENDED LNI NIWE]M.L ICHCMP<l AENCr MPON MDER THE NATIONAL EIXLMAM MHUM OE EIJWx.LTW BVenw]rATE WIVAL "'Em" ADEBrsE1 MWRAY THE RIOIELT 6LOV.nD M THE CRr C£cxAMAMIN aMR DONNI MwxEsorA PRdGINIED.TRLOULANANOTJ111Es ON, TAN? PUDE µCMO MD JUST ]drtH OF THE NINNE]OUA PRO AN RE ROOL i PAL ERMECN FLIM DIDOLD REO MO UM1A W1E. ME AMROMWAR UM0.YDE T1E PRWECT XA9A UTITMEC£walpW}AXOAlP10DIlplEAB'.® 1Md PIp1ELT IFYOLK6FRNIOX6MROL, REPAIR MOREMAOIMJ fF UH WLIOF DT LD D NOR].EIMREWWTOU V E RR. Ix9Tµ 4:CN E •TORY BFNLR MD µW NOI[4 MO ]ITE P E6NPATIv1. T N F PPOIELT M PR<V E!O NN A iOUµ REPAN,MITURIANCEMEAEIRROMPES NS INTO1 117 DAN PARI AMEN ARROLMMURISMEREWPEOTOMMIME FVMMER EPL, NHANPM WTPoETEDATOIEVFFCR[Ix NNKXI9Ax IYPAMEDNMTFR. RIFERR1 ixO1CCY ORAMMa PoR I WANTCMR/.iFDM[ EdSNR'AK a ZI" xWnLV 1 n POPES. THE TOTAL AREA OF MFL LNN IYNERNPIB PAN I]AWREIWT"-NP KLEB. F ME TOTAL HEW MMRW115 AN p1WRO111EMM1Elr o KPei APPLO]INARLrLro ILn[s. dRB6CM8iRVLTBRI: ANTICMAndlxDdTE TED /NUGT.LR06TML dtEUMI WON:x REgWMl RMLRdOµRI 1 HAPPINO ROME. TN PM AN B. MOI lIR[: PRdEci WMAO[R AE NRRAIOLIE1TEE�ESIOA ELIAR EWILALMEA] JEMIOA.dI.INUMID... MAN La ALTERNATKER E MKNANNULAR BiIXLV PDREHUMTtiEMNLMMIN, FRI nxEeRUTI EMEPNUB OPERATOR I µCLMURK1W fML P2MeEE wMEYFMATW 6 THE]OSPP1: ON PHONE PDAER. EML AWELB THAIV REs%M&E[ FOR W16RLY MENTA PM MIxiEL PLE OF ME PERMANENT ETdMIPTM MAEMO[MEM E RTENA HE NXEIRN C W Mr A..ALMOND ANHMRV I MAN.1. AI PIN K. E. MOI KiTRLE: PRWECT IMXKIA ..M JIaaPA. (MIL NOMEND I...P PAr[pIIMERB.V] q IFNEXUMEER. 1] IT RR D REC[MMNNRRa WAnRLwTNIN W[METTER11e1HOLPOiuN[dOTMC[IixAT AM u.N. mRMBmRMIJRRRVHR FROMiK PR0ECi 9rtE1CAw MRYrt IRM BIq IMLUDE MLIALA.M. NBOLMMRRVAUXMLT XAM oN.IMMOP nA[,N MATER 1I IDIN MATEPiIN PANATE 'I EMFdEEK GEEK DAM1bno NOM Rp LAM UxE aMam XO NO 111 UVM NAMMCB:AKX,KMD. M•RULD.VIGREW?Ex.1AE.aiREAM.RMR m NMRL KOr IEMRI =jR,. INOf EAvuIAEe RP µ,S= 60 MB. ME THE MFCDL AXD I.M. =M` G9FAAG TO0. Ai:IIRMRAN]SVR.L.BTATENµIIiYMnNTp1MIMTMaINH UM,ADIwMEDWARRa EARCH DE M`AMIlDNNI=ECUTA1n IMNRIDw.TERFQTMlF61L]MM IRLUTAND'IMINTROMMAN HADANTOR ,M I,""PAPNOAIATO EARN 1.BNM8E!]ONNIALIN. CE.. E]SEG]MM.MOFLUDAUUNAMgNVEEATMRROWtMEN. B AKESIR YNT) rxI=, s HECIALMD IWMED MMTER SEARCH IOW W44 uBEDtO LIATE 11111 MD f0'MTGBMTMWENIt[V.EPML RADII M[MIUREMEMI EMTME PR01lCT aIWEOI, HE uAAI REuiFO EFAµ9MVROIWIRMEM Fd TUPMATV AND FILH SOUR ESE IY E ENNAN—' LE PLOMf MEL�NALEGAVoeMTaE ly NNO,111eMPoI G PLAIN REMUEW MR OCNMIN EPATH THE GAMPAL AppDO NAN WAEOIMIRMEOFC CWBLRWTKM REURDIYMIYEMAIUW KTMTG WMIFIEOIX MAPPRLVEO TMµ YMIN1Yd0.r LMORYMI IXCLUE ILYE Wn STMLPAICNKNRFIDaAL MFA]AXO CnMBTRVCid Oc♦ PlM�R, MYEMAt A,,AFECCMYCMAEMMELOCI.1p161NiL[RYT Ax MN WRN]OR MME AGES I4]w IAOIICTKEf Iwt IKLUW OORKIx PueuC WAR0.5 IcsW 23 RIRUID DMP PaEn DOee Xm IXCLME wmAMEPACR.IWw PGNR rtEMx. RM x la, Axoa[rnDX nl ]CMIMONYT, MD ALe dIOLENENB: aTGNLWnR MILT I MAN MF AOT REWIRED MA ERE INNON GNOME. MEWL NUNN, ,,MNU,L MMM MI FOR EMLWM NEM ARD XLGDx.'UIO FG TIF PMIELT NW PERMIT DENNIS E].laMDL B.Iq dMMIEO NMrFR EUPMYWHMELEMM W.Idi9 P MPTNAR LN Ian1a. •!A O�q IxCLVE MVMMBTW E rrunF L B1fLXRLE9'MLE STRNLrEOLOfx MLFM RWX M eFPPW MULCX NNNI oMTRACAL MAM UB OR EOLNµEM MEMVREB TEMPORARYiOLNRLE6LMiNWTemXIFIGxT e1Li,CUr.EMNMICCOMFeXEMR 1[O.CLNX KOMEd 6•IIX.Mnt E9`WWv?6Mr K' LES UNDAy [],aMDEUWMWLF&ANOTHE cn Os M LOIS. A. BIWUR BU MKEB ME EMEMNT p•MEYF.—A,AA EXISTING srORMNATN MLP PI 6VML[ WTIA Tlgletl� LMIl N IWtuiio Al'IOJxo IIT AdIN dLLw MLETP W/MOPMIEMK ,OquNTRUCTAFTIOUS BAN MANESUDAN[R WILL PROUECnD OFFL All ECARROM OTI MUENTNL NOR W]LxAPPAND TO, THE IN LET HAV A MEN M SD. PA FT oprnFCTIVJ MAN POLL RA E dNNEIFF 0.LCO. RLRPEALM.QLWNKEM MRMXEMMG d18W 'ZIN^Dn,MVNTa wRIFR MOM ANP. 1. OF THECCNB .F. LRE m. PIT uru'ml"FAN FEET • O -1 ANDARN E. A. IC -]W PRMIicREYeN Eq(aNx M(VEMICNIYPLFMExi.LUpNTNEIIXE]IM<VJERMTR[M?l?E TXRANX R4 AXO]L,MI REWNDAMPIRINfRR MMPM8WLL8l IMTN1FOPT LtMT]MEi MAxT UHL[ELMR(DBV L OFMPYEDATFUNTR]DKLIRNM EI WNEEfI VaL!(IMIO.nOINNEAMFLvm IK OF AVMUEEMKE LOUANERW OM NNExIVER RXv[deTPVCTG RLIMUV XPB PERM.LX[MLPWnYIA18Rltr UBMF=.MENU1I,. RNTMEMCNEMIGLBIEO.NNL1-1- MKCVVNTe. ETt.11?!NT THE INK • i B �.v.............. CIMEOGAM PoRnqu Lf THE artE MONILHTRIEVM RRA MPIf10 ERCEEAMH ID MF PRNECi VMLLACT DXCLVOE 10FINKALESE WNREOeOILEAMIMryO `fOYMrR NIMQEOONEREKRPNEELIOAW IM CREKM N1MMW. VEGETATION LFAu E PnesEmEo vMGevlA rEEde TO LIEr elwed eDM AM IMn HE FIVE M NTUPAL VEO[TMM Wf WILL AX 0.MED80. W PUMP ]WMe pP•TVIOILL HE ETRIxBIOEMREIIGIOM WMROLMAIIREn O]EEAM N W BOMµ L. GRAMM" MIX E MM L.0 UO HIM¢E E. POIENTLµ. • 1I NO. 1. PALL M VETO TO .... MON. POLEMML MICEW.LS MMGMEN" LMAIMMFALL R MMPMTOF M .. iWgXE IMM mMOIM EMP MSYL NOUN NONE ME P CWeM Pwm EEIm NO THE P�a AND EDARINT MCIWM EMRUMAMWxT. iREOUExLr�WRNIry, PXO WRP:KN E MECIPRA1pN N,LFupE �sTGMMALER PUI'wFFMOEUMLNRLME]RR IMLIMM FKTMaBULHMNP'CRO IMMNxw.+axnf_L DOKW, elven.AND sREA IDE FPwm AM. mNNNALEP AXONA PILL OENIXIMtIE LM.LXxEL XD9�MFAMENMERGIWEAHD9AµREMWUxl ILYEO�ARL VICKI EX ITV Cf A%M� E Rvxia. p I LE s¢G ERPECUID TO M INHERENT HCRRA MINNEAPOLIS, MN STORM MN ,PTNMA..11WT.LOU. ENOw OGDINFN MD NL MOOS ADAPT B MADE]TAMIN M IN LERWIp THEECIR M DTEPING AeDR. WAR. L.T.C OFIMMII U EDA.. PKEP GEc1ACN • LOGTgItl EMEID ARM EN E MUM E D IE. O. NIEEE A .-S 011 ME) fAGIfGIB LOV.1¢N OF MW EBR EP]1.01 N. GDI.GIELIC LCATEN o�EREAS ONE R E CCN]TAI.CiIOx MALL E TOPPED TO MMEm WMIILN IN ERIRdI W THE SHE THAT ORION TO A wxG VMTMOMx WR ANNON INIA IM E]RKUKx] PAR HBH eMOMIM TYER ED M NN MCCMML hTS µL AND PERMANENT EAMIpJ AM IE LKNME R MPoRMr C(4PD1Y> SMP, AS REWIRED IN KRAFT PECTw9 a TNR W wl ld AND 11 TXRnnN 1. nxwAE M REDUAED W POINT FUNAN I I MD n II wwR,cN OF PCUNMML FGLUnJXOINNINNO KTMTEDIEMEO IFlIX PEANUTdgCMFIR PROTON eiAXdRD ETMW PE MCI AND MOMENT COAUANDL PS T]EIxeTKtlD Dd AiIMADE MST MARINIP.E. .. E rrunF L B1fLXRLE9'MLE STRNLrEOLOfx MLFM RWX M eFPPW MULCX NNNI oMTRACAL MAM UB OR EOLNµEM MEMVREB TEMPORARYiOLNRLE6LMiNWTemXIFIGxT e1Li,CUr.EMNMICCOMFeXEMR 1[O.CLNX KOMEd 6•IIX.Mnt E9`WWv?6Mr K' LES UNDAy [],aMDEUWMWLF&ANOTHE cn Os M LOIS. A. BIWUR BU MKEB ME EMEMNT p•MEYF.—A,AA EXISTING srORMNATN MLP PI 6VML[ WTIA Tlgletl� LMIl N IWtuiio Al'IOJxo IIT AdIN dLLw MLETP W/MOPMIEMK ,OquNTRUCTAFTIOUS BAN MANESUDAN[R WILL PROUECnD OFFL All ECARROM OTI MUENTNL NOR W]LxAPPAND TO, THE IN LET HAV A MEN M SD. PA FT oprnFCTIVJ MAN POLL RA E dNNEIFF 0.LCO. RLRPEALM.QLWNKEM MRMXEMMG d18W 'ZIN^Dn,MVNTa wRIFR MOM ANP. 1. OF THECCNB .F. LRE m. PIT uru'ml"FAN FEET • O -1 ANDARN E. A. IC -]W PRMIicREYeN Eq(aNx M(VEMICNIYPLFMExi.LUpNTNEIIXE]IM<VJERMTR[M?l?E TXRANX R4 AXO]L,MI REWNDAMPIRINfRR MMPM8WLL8l IMTN1FOPT LtMT]MEi MAxT UHL[ELMR(DBV L OFMPYEDATFUNTR]DKLIRNM EI WNEEfI VaL!(IMIO.nOINNEAMFLvm IK OF AVMUEEMKE LOUANERW OM NNExIVER RXv[deTPVCTG RLIMUV XPB PERM.LX[MLPWnYIA18Rltr UBMF=.MENU1I,. RNTMEMCNEMIGLBIEO.NNL1-1- MKCVVNTe. ETt.11?!NT THE INK • i B �.v.............. CIMEOGAM PoRnqu Lf THE artE MONILHTRIEVM RRA MPIf10 ERCEEAMH ID MF PRNECi VMLLACT DXCLVOE 10FINKALESE WNREOeOILEAMIMryO `fOYMrR NIMQEOONEREKRPNEELIOAW IM CREKM N1MMW. VEGETATION LFAu E PnesEmEo vMGevlA rEEde TO LIEr elwed eDM AM IMn HE FIVE M NTUPAL VEO[TMM Wf WILL AX 0.MED80. W PUMP ]WMe pP•TVIOILL HE ETRIxBIOEMREIIGIOM WMROLMAIIREn O]EEAM N W BOMµ L. GRAMM" MIX E MM L.0 UO HIM¢E E. POIENTLµ. • 1I NO. 1. PALL M VETO TO .... MON. POLEMML MICEW.LS MMGMEN" LMAIMMFALL R MMPMTOF M .. iWgXE IMM mMOIM EMP MSYL NOUN NONE ME P CWeM Pwm EEIm NO THE P�a AND EDARINT MCIWM EMRUMAMWxT. iREOUExLr�WRNIry, PXO WRP:KN E MECIPRA1pN N,LFupE �sTGMMALER PUI'wFFMOEUMLNRLME]RR IMLIMM FKTMaBULHMNP'CRO IMMNxw.+axnf_L DOKW, elven.AND sREA IDE FPwm AM. mNNNALEP AXONA PILL OENIXIMtIE LM.LXxEL XD9�MFAMENMERGIWEAHD9AµREMWUxl ILYEO�ARL VICKI EX ITV Cf A%M� E Rvxia. p I LE s¢G ERPECUID TO M INHERENT HCRRA MINNEAPOLIS, MN STORM MN XWEYEM.Y TEYIBREWIREDFT RIOIECTRESULTSINO MA[q., MPE RHE FINK X[TINCMM N... ANNIICRNDEAMR, GTFVI MW VPESCf9lx ipiRL OR giry ryECfb PNrt OR1Al1O[R R.W Lf RL4LVMpM.IOW RERMT TEEM Iaal a U A IT RMMEIm piOMNATR TFI TMEM pVSRyIS NOT REWIRED. HUM AERMrt DEW 51B I S 4IES. MD 53ERIBXLrt ALINEM AOIECiYrtX LN:xO' RpEETOR.(e•VIERMrt TEEM 1[m CiCOR NEW NOMROI TORTRODBREMIOL ATRIMTMV IN TROD EREAR, ICBMPeRMD IFA JS I'I . l PEgpv15 WTMREWME AIMFOINDMOMR II.ELV ETMSE'AFAR. REBFONMF FTM R uPERYT INS. RAIRIM WPERIND, AND MVxEATNIHS WOSgry PpEKMd AMO MOMENT TONERFOL INNER AT XO6 HE RITE FENNEDIxgNDMM ANE ARO gRNXSIRIC FOR IMPLEMENTATION O THE eAWP AND ON DARREE NTN THE GENERAL PERMD UNTIL TME CMRIN. ACTTVITEB ME COMPLETE. KW RXM E CwER MM BEEN ESTMLISN[O. AND A NWl O TERMI. ppT Iµ5 RTE FN DRAFTED M .I®PRME, LEE. s A, 5 2, AND I I p AND NO. ill XERE1No IEWLS MLL R IX TER ADFORE I TM THE M.UMEMEMI9OTIE 0EXERM FI REQUIREMENT THAT THE CONTENT AND EXTENT O TM,MINO YPLL RE COMMENSURATE MEN THE NCMDV/A'S JOB DUTIES AND RESLONSINLRIES. FELON 15 A Lai O QE�E AISIIXIRBLE RN THIN NgIECTWpME RNCYAEWEAELE AND ERPEIULN.O M M[ R C NRH OFKxDOM AND AHM,- COTRO RM. FRcN IFFYZISF�R,YbL RRVTnE MIFF, TRAINED ENTITY NEsaAIbFBif SEAv Tw OEMEAT OF RNINR RREETA TBD Tm 1 KM, RFNRCN.µpAMMEXOJEM TIM PMFRMMROFRIWRINSRCTOM TW RD TM PMMRMANDE M BUPEIM1,MDH OF iBp RO INERT.., NATeWNPE. AND REFFROFMARR Ci RSA1NCYDF _i6,M[OTRIM[D PER[OINML ROIDIMELY IMpftt MFFTI PW PFM N_T AT.ONCE FRE., I WMOWIM ROT.WNIRIR:.gN • NTTIIN N FOLLIES AMR A RENEML EVINT GREATER TINE Da INCIIEEMN NWR. KN REWEMCY NAV M ADIUBTEO UNOIN RE F0.1OMIRD WEDDANiFN3Ep'. YMEPEPARTN OF THE CON5TATI MEM WVE OEIIINEENT CLCAIERL BIT WEIR RAVERS ON WHEN FMTB ARESDE IMRFECTNNSOTNEMEMWTn RR RANT OUERWTRp 10EDNOICEP ... Oi VCE-DAR-NAVEFERMMENT FERNERMAELD J3T1RO FLTRNNINE.EURRRp OX TMEESDETELY MIM4NRpEdITD PKERR NCNTMµp. FiTR 13 MCIRNa, WYRpWRNRO C ERLEMf TRTILCOJBRUOIOI MTNDVRESUMEB. WG6TRVM SUSPPENDEXV RENBWD INR WETOFD MEETIWNOCdMUIE THE WYReAWM =fROAT OIMFECECN RM U.ME ClS T NAWai ROH RITHIN RECTI ISWMSAPRR MINCii6CVRBAi iNE PDE OR VMH RESUMIIp UM'BALCip, VMcnEVER CMRRNBL INSPfGi W_3Rh WMWi TMSp tlN'IATIR BRp WCECTICMALL IWAVOINfPFCTgN HALL EROSION MENRI ICNTRNJEN'Mp BEOMETCdrtp0. RJM ANDFIXLIRW MENER. WNMRMET MEMURES URBMi WATEM FA IMIXNCE OF!RWmN ANDBEOYIT WPGRNTW CPN RUCTgXaDC VCNFLI— LRATTM FOR EACE. KCiFMR ROYET TRACMq STgEER RNOEIMI. MEM ADVENT TOTR NMIICf FORE RDEND, OF OFF A,ADDVMJIATPRO EDWIN },A MAMTENMBIR! LEMEIT HTB' NNNTEWNO O THE FOLOMM ARFM AND MED MLL R ERPoRMEDAl rou FENaNMERALITEMSLLM Ilm NNMrnwuaMoe 3viNE END OF THt EEN nR.v AFTilnD a ac°oiRT o'R As' p°NOPBNHii FEiLEOTmR HDimvJa nuwv HIVE Xp LL.1 REPMMD. pRHKED, MapnLEYETEDNNR TNEYeEmNE All vE wlNNEDAAN�i BEDMENT RENDERTNNM THE OLETH Of 6Ew EXixc0.LECED 1. TE WW REIN EER ID THE STORAGE LpVNE. FRITED W SURFFGE mNMLL R EBAW TERSMED, TME MM R ENNE REORIENT FIERADAL 9m ERFGR. M E BE REaTAMWID. THE RENWMM MO STORM 1—MLL SE CONFLETEDGLExpAp SAM O WNDONW'UROSY EM FRE4VO LEWOMIA . NEY,OR ELLYSiCALN 8'I CONSTRAINTS. IF ANMFNMD WE TOKLEM CpaRMMR. REAaONMR EEFpHR TO CRETAN RECE'D RILLRE WED. RERO MD aTMNGTLR MLLTAR EINEMHINlLIENWR D,,, OF TREATKED • AREAS TEDENOPNO STAFFPw1xT FAUNFRELL AN REETAyLUEY MX L. FAILL BEII CALENDAR DAO, DA EMASYTO KM NEEADHERED DOOR soRWNINT CSE I THE MEM OREEPERRIPEDWF.. COMETRUBPCM MILE N pTMILUDDNrtM RERWNIxT COVER LIN ONNI!}CX O YOxx PW EpNEM RNC. WY K VIOETATIV[ OR IY.MY20l.ATM, MpRTWRMTE, bTIYIWYCMO RFRWXEMCO2q Wy IMOWDITI! F0.LPMN9IC.NmIpp. aEENED. MUHDHINDAXD E.CORgCL NAXN[R. Ifd W RRYR IRM p 1I1 DOACRWMUOR TO.aD!ttIMMVI R.NT.. VI FTMf FOLAMD,HM, A AND ON MUCTM CA ALL DMIOINTE.MIM.KNORRMECpC.FLE(CLW IERMLETED AND (MDII MEMS deLED NOCOOTRVCIpXFCATERE .. TONVERES OF A WYC BEENCOMPLETEDI.. RWxeHT TENETNTE TNTERR MEN DENSLITYO)1R O M EXIMOTLDAFIAL RIOVIM VEWE ATgX111 HOT R EWI RLO .1E(ME F MG A OC.RC NO MIOCTATpN IBWN M IMENRVFWe SURFACES W M( RATE TERI O IN ML 6EpYEM IW KCX gLMMOFROMCONIYANC[SYeTIW, MAU3N]CULYERn5 SYHO(.F LIYXMAAlx.cxµOp[pMlxTeoxW0. WPo ME (i(x Re WV[O RATHER dIA RSgNIOTO ECCOIPoCIdHDE WYpI LIRIN RACE. MIA MFGRgWNTMI(ONPfCNLM! foLR[iE, ANOC[ ORNMINATICN MMOCAFFMLL µ•LNTMfD�a: N ABLE�iPLEie MLI R LOGTRAWAv ROY BYPFACF YNRga MDIffiDKNEDMp9ECMEDTOME GRO NET RTpPEOCPXpCXEOOrtR RMrtµv WASTERLLRDREFR[DONS .'lLCRGXOHMTXINEXxf MTA RULR —MERIT Tg1MR lOLfR MLLRRPIDRGLLY EMPIrtO MM THE WMTE MAUI(DC F.SDE SYA LRENSED W VLR.ICSW EEFERT ITEM ORE RYOJNATEIFICARTHE EOFREFUELILMGRTARAGPUCEML$R LTOGOTEDE BmLL NLDBMLLYE4GRL�Y IARIED DCONT.NN WTERNL9 TI MBIBi IN B%LL CLEANUP INCI uglq RpapRBEE PRpa. EOg19 FOP CORNNINO 9PILR. ANO IN eN�AA STENRTEe SEnati Ill.. IGEWFIREFT ERERPTRro THAM M3A MyESOIA OIn CiTFERMREouMEo NEL TARO MRpT ONLEFT�EELLNB ALF inxMMwLUEED ONETAIINNIENI.WIGRNEry 9E MTOREO WFTHOLD OFUFL LOPE. PROPERTY WpiAIXED, NOILLEOLLLY YONFIER Hn M ESIN G LRUL INCIGTOL FLOATS FOR D MG R XJRE INALLTANKS, 591D WWEB NT WED, M) ON R REMOVED ROI ME NGIN HCRRA MINNEAPOLIS, MN M NAH�I.I.µr. L Auo REPAIRS NEN, MN ,MTR MRS• GOITER STAR dE OF CIILYKRCYW DNS ImECllm 00%OESMpN 17, MIN" / i////. % _ _ e 1 I � 5� 3 f - A. 1CMy"5-5 rv4/l li 4 1 ii l v� - � -""'•' �'p vv ''1- ��_ "" , i 1 / / // � 4i, I1 v J:: v4Vv• � � - JJ//f1, r n r 1 I v v�� o` �J✓/ , \\ _ _ rlw®,rano a e Y 5 » a MOOIFICATlON9 IMS' f _ LANDSLIDE REPAIRS xamwua HCRRA CHM1W\B6 MN MINNEAPOLIS. MN TFAIL MCOIFIWTIONB G 0 t °i� m PVN MID PNOFIIE C-01 0 3 xo aavMloN oeacnn•Ilox m Wommoommom ��y n NTA T� AVAA M A41Y� M00 HCRRA MIME S, MN CROUSECTION$ iEa M■■■ME■mmorecoiNMMM. E■o■■EE■om MENMEMMMME B M■� _MEMO ■■ ■■MM■E. mM■MMMMMMM. ME E■O■ ME �■Ms■■ MMWEM■MM MME■■MONEE HCRRA CHANHABSEN. MN MINNEAPOLIS. MN TPAIL MOOIEICATIOl. CROSS SECTIONS m � SECTMIN TRALMCdFNMT ON RVPIC -S �.na�� 4,tw.�.asofaflx.il ESEOTIOl: TRML MODIFICATION ITYPICVl-.TA 1.15 TO. D .5T RA DESIGN HCRRA cNu+NAeseN, MN aaioio,i MINNE P 16, MN Te........����..�...�� TYPIC& SECTIONS GSECTION SOUTH MFA SLOPE REPNR 01 C K)N' SOU HMEA5LOPER PNR HCRRA CHMHRSSEN. MN MINNEMq.15. MN SOUTH MEA SLOPE REPNR SECTIONS 90% DESIGN _ raN,Npyp(MYMINAM4Y®NMIMAP. i a�IIYMMM7CMMlOOI INTN M1 Wttw MmaaMYWINNIYWIIPaCR Owa vNNNNaM1M4,u mom,,.,DAW nwa�N� a6�0 ------- IMFACRTOMaTMQQTRMKftPNR HCRRA MINNEMOLIB, MN 90UTH MER CULVERT OUTLET IND BTRFMIBMK REPRIR PLM 41 0 •tom �in •yy��.� • •��jyYDy��•w _ raN,Npyp(MYMINAM4Y®NMIMAP. i a�IIYMMM7CMMlOOI INTN M1 Wttw MmaaMYWINNIYWIIPaCR Owa vNNNNaM1M4,u mom,,.,DAW nwa�N� a6�0 ------- IMFACRTOMaTMQQTRMKftPNR HCRRA MINNEMOLIB, MN 90UTH MER CULVERT OUTLET IND BTRFMIBMK REPRIR PLM 0 VECTION: CMPACULVERTWPLME C21 BECTIOM RTREAM CNYMIEL W BOTTOM WWH f i1 SECTION: rAMCININE I9YBOROMVAOTH �PROFI.LE' CULVERT!gFT MD STREAMCHM o u a \/ a m a o ro m r u ............. wuelxmT _._.. raxDamuxw•IxrRrt Hxxrx cu[mre[r $41{DESIGN NOTFORCONSTRUCTM LANDSLIDE REPAIRS ------- HCRRA CHMHMl3EN, MN 33f010'1d InT� • • C D 0 3 MINNEAPMIS, MN SOUTH AREA CULVERT OUTLET REPAIR 111V49NRC111TIp1 PROFILE AND BECTION6 �_� EN, MN Mimuwe�eux wsHCRRIS CHMIIU68WE MINNEMOLISMN , NORTH MFA SLOPE REPNR PIAN 22 Q SECTION'. NMTN AREA WW REPA R RTA O 3 L) PROFILE: NOIRX MEA SLOPE REPMR Wm wermurwr _ _ '^^W rlwnuM SiIDt µTWD '^•�^I x�nwrro.va.ravrmr w nriacW ` �� rm.eeralawwn.ren r rorwwNAD . w•a ` w rnmo. re. uX+aMA..o �., war MWagMftlro WCF. rll� Q SECTION'. NMTN AREA WW REPA R RTA O 3 L) PROFILE: NOIRX MEA SLOPE REPMR Wm wermurwr _ _ '^^W rlwnuM SiIDt µTWD '^•�^I x�nwrro.va.ravrmr w nriacW ` �� rm.eeralawwn.ren r rorwwNAD . w•a ` w rnmo. re. uX+aMA..o �., war MWagMftlro WCF. . awlwrwsrwarnw.i,.wwur� k ay.amNelm« r. w•wua.maarvwlewE.. �r. .m.iwn«.I i A r•awuawNMn • IIYX.XOYryrMMatlrar�wpPXMcs r i 0 024 FENCE OE OX wxreaX �� Xgxm' naai•um�M w tANH=L10 X�PAII MCRRA CHMHAB9EN. MN MIMEMOLI6. MN �� SECTION. MO OETML 0% DESIGN 0_Qfoma'.ap WTML c::!�::.9��_lL•�,. - - Vit: v�Y.Ii:�:>� v v LA v HCRRA MINNE MIS, MN MN SECTION MDMTMLS W%DESW HCRRA CNANHA88EN, MN MINNEAPOLIS. IN BTONM SEWER AND DRNNAOEC BECTIONB NA LETNLS .IE.,E.K.ETIF®MO RF.i.OY.,.KWi LiwN,xxEaEmnKL r.i.gNCEK.xr I�.,gKo.xxxLnxwE E4rrtv ' NMOVFv I9 iE. ,•u"W M.R.NNYannuxt..-III..—M.xvv".. rrNW MR.C1V 1•Nn NYxr+Lww•NK wvtY raNxU mxru(luNrq xxx WLL M—xv R.,—M.. '...... rpyE, KWvorx"N• RRM Orw K(x.,� [•rmrWlew.o•-.RR O,.N(«. ro M,K,xa Nvxr uxrs Moxa,vxxN.Nxuxwx•M.Ywa• TpL oJxpErtv[wmiOz inrNNVrtO[Pw .p}KKnvappnrn rOee ugxAMM%W wMMMM,RM Wn•N•MVEUN LM` prrEN.w,a,"4uxO.Y.Nomarul.oNKGPmwa MMuwR+GnxFl10 1N[+4x+•([wNe,xtw+.>s.•.b.x..x. nnrq rrNu,u,u4xs[YwxwtM ru, NNrgxu wraq.vu[x uxxxw NquMuuF +we«uO,x or Ux•Nu ruxrrNu([mxo OnNa. 4 gvMwM,uu,FNNrmiu+ivxaFF K{,gpgpllp MiwVFMx[(F}ELfCdLnfx4[P'xio.vUWRNK a xevoatoro[v[ rxu[va (pIt•uxor{venxurr N,o Nrw EIp,EIgwXiFu,Y,En.Nvf,gMRM ..,N u[["1v.....r. DRM,�,NAGE CNI,NNEL MR- [.c..ainxo er u on�m�+wn� rr _9ECTgN. w V—MM w,Kwx f.."I RRAvroNox, nm Nor(ms4vn•on4x:� �" •wuo[rt.xw[..reouF •. ..N orrx ..EK.o x.e. wxv rxr x.r,{warMNwxq.r...(x..�++om+r+(.n•xa.mxrx[,q.xim ee4 TEIIOII•.iION FLEXAMAT a� P DETAIL cwNw,ox+.:w STANDARD CHANNEL NTS NC. FLUIB E CONCRETE GEOORIO INSTALLPTIONFLE%MPT OR PPPROVED E U SF� W%DESW HCRRA CNANHA88EN, MN MINNEAPOLIS. IN BTONM SEWER AND DRNNAOEC BECTIONB NA LETNLS 1r1PlANj 9 smloae� �mmiwri m�meir. w.a®rw swm n w.> n wa n �wN� �wm.mv r°OOX�a.wn�m`w'...�nm�ex®�awnw ' wio�m.�aew oneramnnwawx�.nwn, .�.Nu�i.� n. nnn ew..ewM"•� a...a�oMCI HCRRA MINNEAPOLIS, MN GHINEJA 4 N, MIN SEEDING PIAN a�muun °aoo. IMf urtinunx aenuu ..oeom.. GHINEJA 4 N, MIN SEEDING PIAN HCRRA MINNEP MIS, MN oEpuL: mEE PtANrINo LANDSLIDE REPAII CIUNMA8 M MN . pia x�enHmrirw.�vxw�xve �„AR�TYYWW.xOw.N.c T I0Qppp1E.0}n0A MYW N..Nx f M ,N�,rlrnxRx,M.x P]rA,IM W 1Yr,rCRYr.�.F4161 M (I,IWOItP W.rY�MPMx1,4 "x wurnrrrnxrswArx,.wx • .Yaua..xMWCvw xY.W UYe4ue[W w.r tl�rY u�WI.I,R.M Iwsx ,.MoomEM.CWCKBLOT TPM ANCHOR PATTERN 400 AL. rTURF PEIFO CIMENT MAT TOP ANCHOR TRENCH ILTERMINATION RATON A CWR TRENGH 809: DESIGN xxrtrxn,�uxx.HCRR CHANRA66En. MN MINNEAPOLIS. MN RfSTORATWN GFTA Attachment 4 Draft Specifications for Horizontal Directional Drilling S -7p( (2503) 24" HDPE PIPE SEWER -DIRECTIONAL DRILLED (2503.603) PART 1: GENERAL 1.01 SUMMARY A. Section includes providing all materials, equipment, and labor to complete Horizontal Directional Drilling (HDD). B. Various methods will be considered, provided they can generally follow the design profile in constructing the pipeline from the starting access point to the ending access point. 1.02 REFERENCES A. The following are complete titles of references cited in this Section. The date of the standard is that in effect as of the certification date, unless noted otherwise. American Petroleum Institute (API) a. API Bulletin D20: Directional Drilling Survey Calculation Methods and Terminology b. API RP 1313-1: Recommended Practice for Field Testing Water-based Drilling Fluids. 2. American Society for Testing Materials (ASTM) a. ASTM A240: Standard Specification for Chromium and Chromium -Nickel Stainless Steel Plate, Sheet, and Strip for Pressure Vessels and for General Applications 1.03 SUBMITTALS A. Installation Plan including: Experience and qualifications information including the following: a. A list of at least 10 similar projects completed by the company, including the name of owner, location, project environment (i.e. urban work, waterbody crossing), pipeline and/or casing diameter(s), length of installation, and contact names and phone numbers. b. A list of key personnel assigned to the project including title, experience, and personal references. 1) The field supervisor shall have at least 3 years of experience and shall be at the site at all times during the boring/drilling installation. 2. Site access requirements. 3. Major Equipment including the following: a. Type and capacity of drilling rig to be used for the project, including thrust and rotary torque. b. Type and capacity of the mud mixing system. C. A list of any specialized support equipment required. 4. A detailed plan and profile of the bores indicating the location and footprints of all equipment, staging areas, pipe storage areas, location of entry and exit pits, and location of drilling fluids containment pits (as applicable) to be plotted at a scale no smaller than 1 inch equals 20 feet horizontal and vertical. 5. A detailed installation plan including the following: a. Depiction of Contractors proposed plan and profile of pipeline to be installed including denoted entry and exit points, entry and exit angles, bend radiuses, and points of intersection (PIs). b. Construction methods, including diameter of pilot holes, number and size of pre - reams, use of rollers, baskets, and side booms to suspend and direct pipelines during pullback, and number and sections in which the pipelines are to be installed. C. Description of installation sequencing, including pilot hole, reaming, and pullback for pipeline. d. Type, operating range, and degree of accuracy of tracking equipment. e. Drilling fluid mix design. f. Pipelinejoining methods. g. Measures to be employed and monitoring to be performed to prevent overstressing of pipeline during installation. 6. A Quality Control Plan detailing personnel and associated responsibilities, inspections, and organization for ensuring the quality of construction required by these Specifications. The plan shall include a table listing methods, frequencies, and acceptable conditions and tolerances. The plan shall explain the methods and locations for obtaining samples for testing and reporting schedules. Copies of quality control forms shall be submitted for review and approval. A plan describing drilling fluid and cuttings management methods including: a. Details of drilling fluid types, cleaning and recycling equipment, estimated flow rates, and procedures for minimizing drilling fluid escape b. Method(s) of drilling fluid and slurry containment Method(s) of recycling drilling fluids and spoils d. Method(s) of transporting drilling fluids and spoils off the site e. Disposal plan for drilling mud and spoils A spill plan in the event of a spill of drilling fluids, hydraulic fluids, and/or any other fluids or substances other than potable water. The plan shall include measures to communicate the spill to Engineer and a plan to contain and clean the affected area. B. A description of measures to be employed to prevent hydraulic fracturing of overburden soils and drilling fluid migration. A plan of action in the event of hydraulic fracturing and/or drilling fluid migration from the drill alignment shall also be included. 9. A plan for leak testing installed pipeline. 10. A plan of action to be followed in the event of a failed pipeline installation and/or failed post -installation leak test. 11. Submit Installation Plan to Engineer at least 21 days prior to mobilizing equipment. B. Manufacturer's product data including: Technical product data and installation instructions for all water system materials and products. C. Shop drawings including: 1. Piping materials, size, locations, and elevations. Include details of underground structures, valves, connections, restrained joints, and anchors. Show interface and spatial relationship between piping and proximate structures. D. Test results and certificates including: 1. For each fusion joint provide all process information, time, temperature and pressure in the form of a written log 2. Leakage Test and Hydrostatic Pressure Test. Submit for approval 1 copy of results of leakage and hydrostatic pressure test upon completion of backfilling operations. 3. Conductivity Test. Submit for approval 1 copy of results of conductivity test upon completion of backfilling operations. 4. Bacteriological Tests. Submit for approval 1 copy of results of bacteriological tests upon completion. E. Record Drawings: 1. At Project closeout, submit for information Record Drawings of installed piping and products including locations and elevations. 1.04 QUALITY ASSURANCE A. Manufacturer's Qualifications. Firms regularly engaged in manufacture of water systems materials and products, of types and sizes required, whose products have been in satisfactory use in similar service for not less than 5 years. B. Installer's Qualifications. Installer shall have at least five years experience in horizontal directional drilling and have installed horizontal directional drilled pipe at least as large as 12 inches in diameter for a minimum of 10 projects within the last 5 years. 1. Installers shall have equipment capable of installing pipeline in segments of up to 500 LF. It is the intent of the pipeline layout that access pits will be located only at the inlet and outlet locations shown on the Drawings (e.g., no intermediate access pits in between inlet and outlet). 1.05 DELVIERY AND STORAGE A. Materials delivered and placed in storage shall be protected from weather, contamination, degradation, and damage. 1.06 MEASUREMENT AND PAYMENT A. Measurement shall be made of the number of lineal feet of satisfactorily installed 24 -inch HDPE pipe, including inlet and outlet, as shown on the Drawings and approved by the Engineer. B. Payment shall be made under 2503.603 (24" HDPE Pipe Sewer -Directional Drilled) at the Contract price per lineal foot, which shall be compensation in full for all work included in this specification. PART 2: PRODUCTS 2.01 HIGH DENSITY POLYETHYLENE PIPE (HDPE) A. ASTM D3350 with a cell classification of 445474C, and a PPE rating of PE4710. The pipe produced from this material shall have the dimensions and wall thickness as set forth in ASTM F714 for the size and Dimension Ratio (DR) 17. B. Each HDPE pipe length shall be marked with the manufacturer's name or trademark, nominal size and DR, cell classification, and extrusion date, period of manufacture or lot number. C. All HDPE pipe and fittings shall be from a single manufacturer, who is fully experienced, reputable and qualified in the manufacture of the HDPE pipe to be furnished. The pipe shall be designed, constructed, and installed in accordance with the best practices and methods and shall comply with these Specifications. D. Contractor is responsible for compatibility between pipe materials, fittings, and appurtenances. 2.02 TRACER WIRE FOR HDPE A. Solid copper No. 10 or stainless steel No 10 tracer wire. B. Splicing tracer wire for horizontal directional drilling will not be allowed. 2.03 DRILLING FLUID (SLURRY) A. Stable colloidal suspension of bentonite in water and shall be controlled in accordance with API RP 13B-1. B. Admixtures may be incorporated into the drilling fluid if approved by Engineer. PART 3: EXECUTION 3.01 LOCATION OF WORK A. The Work shall be located as shown on the Drawings. In general, boring pits may be located within the project construction limits and as accepted by Engineer. B. It may be necessary for the Engineer to shift lines a reasonable amount to avoid an obstruction to the construction work or to reduce right of way difficulties. The Contractor will not be allowed any additional compensation due to minor shift of lines. Additional compensation will be allowed only for lengthening of lines greater than 2% of the overall length, or for providing additional fittings. 3.02 EXAMINATION A. Examine the area and conditions for performing pipeline installation via HDD methods. If unsatisfactory conditions occur during Work, notify Engineer and do not proceed with Work until unsatisfactory conditions have been corrected. B. It shall be Contractors responsibility to determine to its own satisfaction the location and nature of all surface and subsurface obstacles and the soil and water conditions that will be encountered during construction. C. Provide Engineer with access to Contractors work areas at all time, and provide Engineer with the location and profile of all drilled alignments. 3.03 PREPARATION A. Contractor shall make arrangements to locate all existing utilities and underground facilities in the areas of Work. If any are to remain in place, Contractor shall provide adequate means of protection during HDD installation operations. B. Contractor shall protect existing streams, structures, utilities, roads, and other facilities from damage caused by settlement, lateral movement, undermining, washout, and other hazards created by HDD pipeline installation. C. Surface water shall be controlled sufficiently to permit HDD pipeline installation. 3.04 GENERAL A. All polyethylene pipe shall be cut, fabricated, and installed in strict conformance with the pipe manufacturer's recommendations. Joining, laying, and pulling of polyethylene pipe shall be accomplished by personnel experienced in working with polyethylene pipe. The pipe supplier shall certify in writing that the Contractor is qualified to join, lay, and pull the pipe or representative of the pipe manufacturer shall be on site to oversee the pipe joining. Expense for the representative shall be paid for by the Contractor. B. Storage Pipes shall be stored on level ground, preferably turf or sand, free of sharp objects which could damage the pipe. Stacking of the polyethylene pipe shall be limited to a height that will not cause excessive deformation of the bottom layers of pipes under anticipated temperature condition. Where necessary due to ground conditions, the pipe shall be stored on wooden sleepers, spaced suitably and of such widths as not to allow deformation of the pipe at the point of contact with the sleeper or between supports. C. Handling Pipe The handling of the joined pipeline shall be in such a manner that the pipe is not damaged by dragging it over sharp and cutting objects. Ropes, fabric, or rubber - protected slings and straps shall be used when handling pipes. Chains, cables, or hooks inserted into the pipe ends shall not be used. Two slings spread apart shall be used for lifting each length of pipe. Pipe or fittings shall not be dropped onto rocky or unprepared ground. Slings for handling the pipeline shall not be positioned at butt -fused joints. Sections of the pipes with cuts and gouges exceeding 10 percent of the pipe wall thickness or kinked sections shall be removed and the ends rejoined. 2. The open ends of all sections of joined and/or installed pipe (not in service) shall be plugged at night to prevent animals or foreign material from entering the pipeline or pipe section. 3. Waterproof nightcaps of approved design may be used but they shall also be so constructed that they will prevent the entrance of any type of natural precipitation/ into the pipe and will be fastened to the pipe in such a manner that the wind cannot blow them loose. 4. The practice of stuffing cloth or paper in the open ends of the pipe is not allowed. S. Where possible, the pipe shall be raised and supported at a suitable distance back from the open end such that the open end will be below the level of the pipe at the point of support. 3.05 EXCAVATIONS A. Entry and exit pits shall be excavated to a depth allowing installation of the pipeline as shown on the Drawings. B. All excavations shall be in accordance with applicable OSHA requirements. 3.06 INSTALLATION A. Install pipelines by means of horizontal directional drilling. Assemble, support, and pretest the pipeline prior to installation in the directional drill tunnel. B. Horizontal directional drilling shall consist of the drilling of a small diameter pilot hole from one end of the alignment to the other, followed by enlarging the hole diameter for the pipeline insertion. The exact method and techniques for completing the directionally drilled installation will be determined by the Contractor, subject to the requirements of these Specifications. C. Monitor the route taken by the drilling unit utilizing the downhole survey calculation methods discussed in API Bulletin D20. A surface monitoring system may be allowed in lieu of the downhole calculation method. Approval of surface monitoring shall be at the discretion of the Engineer based on the Engineer's evaluation of the particular system that is proposed. D. Drilling fluid consisting of a bentonite slurry shall be using during drilling and back -reaming operations. Drilling fluid consisting solely of water will not be permitted. E. Drilling fluid shall remain in the annular space between the pipeline and the borehole upon completion of the installation. F. Joining Pipe Sections Each length of pipe shall be inspected and cleaned as necessary to be free of debris immediately prior to joining. 2. Pipes shall be joined to one another by means of thermal butt -fusion. Pothylene and class lengths to be joined by thermal butt -fusion shall be of the same type, grade, polyethylene compound and supplied from the same raw material supplier. 3. Mechanical connections of the polyethylene pipe to auxiliary equipment shall be through flanged connections which shall consist of the following: a. A polyethylene -stub end" shall be thermally butt -fused to the ends of the pipe. b. Provide ASTM A240, Type 304 stainless steel backing flange, 125 -pound, ANSI B16.1 standard, and gaskets as required by the manufacturer. C. Stainless Steel bolts and nuts of sufficient length to show a minimum of three complete threads when the joint is made and tightened to the manufacturer's standard. Retorque the nuts after 4 hours. d. Butt -Fusion Joining: Butt -fusion of pipes shall be performed in accordance with the manufacturer's recommendations as to equipment and technique. Butt -fusion joining shall be 100% efficient offering ajoint weld strength equal to or greater than the tensile strength of the pipe. G. Allow a minimum 8 to 24 hour relaxation period as specified by the manufacturer or industry standards prior to connecting or attaching any appurtenances to or restraining the inserted HDPE pipe. H. Tolerances Pipe installed by the directional drilled method must be located in plan as shown on the Drawings, must be no shallower than shown on the Drawings, and must be no closer than minimum offsets shown on the Drawings, unless otherwise approved. Plot the actual horizontal and vertical alignment of the pilot bore at intervals not exceeding 30 feet. This '.as built" plan and profile shall be updated as the pilot bore is advanced. At all times, provide and maintain instrumentation that will accurately locate the pilot hole and measure drilling fluid flow and pressure. Grant Engineer access to all data and readout pertaining to the position of the bore head and the fluid pressures and flows. 2. Employ experienced personnel to operate the directional drilling equipment and, in particular, the position monitoring and steering equipment. No information pertaining to the position or inclination of the pilot bores shall be withheld from Engineer. 3. Each exit point shall be indicated with an over -length tolerance of 5 feet for directional drills of 1,000 linear feet or less and 20 feet for directional drills of greater than 1,000 linear feet and an alignment tolerance of 5 feet left/right with due consideration of the position of the other exit points and the required permanent easement. The alignment of each pilot bore must be approved by Engineer before pipe can be pulled. If the pilot bore fails to conform to the above tolerances, Engineer may exercise option to require a new pilot boring to be made. 4. After the pipe is in place, cleaning pigs shall be used to remove residual water and debris. After the cleaning operation, provide and run a sizing pig to check for anomalies in the form of buckles, dents, excessive out -of -roundness, and any other deformations. The sizing pig run shall be considered acceptable if the survey results indicate that there are no sharp anomalies (e.g. dens, buckles, gouges, and internal obstructions) greater than 2 percent of the nominal pipe diameter, or excessive ovality greater than 5 percent of the nominal pipe diameter. For gauging purposes, dent locations are those defined above which occur within a span of five feet or less. Pipe ovality shall be measured as the percent difference between the maximum and minimum pipe diameters. For gauging purposes, ovality locations are those defined above which exceed a span of five feet. Ream and Pullback Reaming: Reaming operations shall be conducted to enlarge the pilot after acceptance of the pilot bore. The number and size of such reaming operations shall be conducted at the discretion of Contractor. 2. Pulling Loads: The maximum allowable pull exerted on the HDPE pipelines shall be measured continuously and limited to the maximum allowed by the pipe manufacturer so that the pipe or joints are not over stressed. 3. Torsion and Stresses: A swivel shall be used to connect the pipeline to the drill pipe to prevent torsional stresses from occurring in the pipe. 4. The lead end of the pipe shall be closed during the pullback operation. 5. At all times, handle the HDPE pipe in a manner that does not over stress the pipe. Vertical and horizontal curves shall be limited so that wall stresses do not exceed 50% of yield stress for flexural bending of the HDPE pipe. If the pipe is buckled or otherwise damaged, the damaged section shall be removed and replaced by Contractor at Contractor's expense. Take appropriate steps during pullback to ensure that the HDPE pipe will be installed without damage. 6. Tracer wire shall be pulled along with the HDPE pipe in order to locate it in the future. Conductivity between HDPE sections shall be continuous. Handling Drilling Fluids and Cuttings 1. During the drilling, reaming, or pullback operations, the Contractor shall make adequate provisions for handling the drilling fluids, or cuttings at the entry and exit pits. To the greatest extent practical, these fluids must not be discharged into a waterway. When Contractor's provisions for storage of the fluids or cuttings on site are exceeded, these materials shall be hauled away to a suitable legal disposal site. After completion of the directional drilling work the entry and exit pit locations shall be restored to original conditions. Comply with all permit provisions. 2. Pits constructed at the entry or exit point area shall be so constructed to completely contain the drill fluid and prevent its escape. Excess drilling fluid shall be contained in a lined pit, a containment pond, or via another Engineer approved containment method at exit and entry points until recycled or removed from the site. 3. Utilize drilling tools and procedures which minimize the discharge of any drill fluids. Comply with all mitigation measures listed in the required permits and elsewhere in these Specifications. 4. To the extent practical, maintain a closed loop drilling fluid system. 5. Minimize drilling fluid disposal quantities by utilizing a drilling fluid cleaning system which allows the returned fluids to be reused. 6. Make all diligent efforts to minimize the amount of drilling fluids and cuttings spilled during the drilling operation and provide complete clean-up of all drilling fluid overflows or spills. 3.07 ENVIRONMENTAL PROVISIONS A. The Horizontal Directional Drilling operation shall be operated in a manner to eliminate the discharge of water, drilling mud and cuttings to adjacent waters or land areas during construction. Provide equipment and procedures to maximize the recirculation or reuse of drilling mud to minimize waste. All excavated pits used in the drilling operation shall be lined by Contractor with heavy duty plastic sheeting with sealed joints to prevent the migration of drilling fluids and/or ground water. B. Visit the site and become aware of all structures and site limitations at the directional drill locations. Contractor is responsible for providing a drilling plan outlining procedures to prevent drilling fluid from adversely affecting the surrounding area. C. The general work areas at the entry and exit shall be enclosed by a berm to contain unplanned spills or discharge. D. Waste cuttings and drilling mud shall be processed through a solids control plan, comprised as a minimum of sumps, pumps, tanks, centrifuges, material handlers, and haulers all in a quantity sufficient to perform the cleaning/separating operation without interference with the drilling program. The cuttings and excess drilling fluids shall be disposed offsite and shall be dewatered and dried by Contractor to the extent necessary for offsite disposal. Water from the dewatering process shall be treated by Contractor to meet permit requirements and disposed of locally. The cuttings and water for disposal are subject to being sampled and tested. The construction site and adjacent areas will be checked frequently for signs of unplanned leaks or seeps. E. Equipment (graders, shovels, etc.) and materials (such as groundsheets, hay bales, booms, and absorbent pads) for cleanup and contingencies shall be provided in sufficient quantities by Contractor and maintained at all sites for use in the event of inadvertent leaks, seeps or spills. F. Waste drilling mud and cuttings shall be dewatered, dried, and stock piled such that it can be loaded by a front end loader, transferred to a truck and hauled offsite to a suitable legal disposal site. The maximum allowed water content of these solids is 50% of weight. G. Treatment of water shall satisfy regulatory agencies before it is discharged. 3.08 POST -INSTALLATION TELEVISING A. Televise pipeline after completion of installation. The pipe shall be cleaned prior to any televising. The Contractor shall be responsible for cleaning the pipe, and keeping it free of debris until final project acceptance by Engineer. The televising camera shall be mounted on a skid so that it is centered laterally in the pipe. The camera shall be equipped with sufficient lights to completely illuminate the interior of the pipe within the range of the camera. A monitor shall be provided with seating facilities to allow three or more persons to view the picture continuously. The television camera, transmitting equipment, and monitoring equipment shall combine to provide a picture on the monitor screen which is free from distortion and clean enough to distinguish between hairline cracks, "pipe marks", etc. A digital recording shall be made of the entire footage of pipe televised. The linear footage of pipe televised shall be integrated into the recording for ease of identification of pipe being viewed. B. Provide a written report identifying pertinent data as shown on the videotape. A diagram of the project with all televising indexed on it shall be included. If televising is interrupted for more than five days, an interim index diagram shall be furnished. Recording(s) shall be digitally provided to the Engineer in conjunction with the report. 3.09 FIELD QUALITY CONTROL A. Allow pipeline to be inspected by Engineer upon installation completion. 3.10 SITE RESTORATION A. Restore all areas disturbed by construction in kind to existing grade. B. The ground surface along each drill path will be observed by Engineer for signs of settlement, heave, hydraulic fracturing, or other indication of impact that appears to have occurred due to the HDD installation process. Contractor shall be responsible for the cost of measures required to quantify the affected area(s) and restore the site due to settlement, heave, hydraulic fracturing, or other impact that appears to have occurred due to the HDD process. Attachment 5 Joint Application Form for Activities Affecting Water Resources in Minnesota Joint Application Form for Activities Affecting Water Resources in Minnesota This joint application form is the accepted means for initiating review of proposals that may affect a water resource (wetland, tributary, lake, etc.) in the State of Minnesota under state and federal regulatory programs. Applicants for Minnesota Department of Natural Resources (DNR) Public Waters permits MUST use the MPARS online permitting system for submitting applications to the DNR. Applicants can use the information entered into MPARS to substitute for completing parts of this joint application form (see the paragraph on MPARS at the end of the joint application form instructions for additional information). This form is only applicable to the water resource aspects of proposed projects under state and federal regulatory programs; other local applications and approvals may be required. Depending on the nature of the project and the location and type of water resources impacted, multiple authorizations may be required as different regulatory programs have different types of jurisdiction over different types of resources. Regulatory Review Structure Federal The St. Paul District of the U.S. Army Corps of Engineers (Corps) is the federal agency that regulates discharges of dredged or fill material into waters of the United States (wetlands, tributaries, lakes, etc.) under Section 404 of the Clean Water Act (CWA) and regulates work in navigable waters under Section 10 of the Rivers and Harbors Act. Applications are assigned to Corps project managers who are responsible for implementing the Corps regulatory program within a particular geographic area. State There are three state regulatory programs that regulate activities affecting water resources. The Wetland Conservation Act (WCA) regulates most activities affecting wetlands. It is administered by local government units (LGUs) which can be counties, townships, cities, watershed districts, watershed management organizations or state agencies (on state-owned land). The Minnesota DNR Division of Ecological and Water Resources issues permits for work in specially -designated public waters via the Public Waters Work Permit Program (DNR Public Waters Permits). The Minnesota Pollution Control Agency (MPCA) under Section 401 of the Clean Water Act certifies that discharges of dredged or fill material authorized by a federal permit or license comply with state water quality standards. One or more of these regulatory programs may be applicable to any one project. Required Information Prior to submitting an application, applicants are strongly encouraged to seek input from the Corps Project Manager and LGU staff to identify regulatory issues and required application materials for their proposed project. Project proponents can request a pre - application consultation with the Corps and LGU to discuss their proposed project by providing the information required in Sections 1 through 5 of this joint application form to facilitate a meaningful discussion about their project. Many LGUs provide a venue (such as regularly scheduled technical evaluation panel meetings) for potential applicants to discuss their projects with multiple agencies prior to submitting an application. Contact information is provided below. The following bullets outline the information generally required for several common types of determinations/authorizations. • For delineation approvals and/or jurisdictional determinations, submit Parts 1, 2 and 5, and Attachment A. • For activities involving CWA/WCA exemptions, WCA no -loss determinations, and activities not requiring mitigation, submit Parts 1 through 5, and Attachment B. • For activities requiring compensatory mitigation/replacement plan, submit Parts 1 thru 5, and Attachments C and D. • For local road authority activities that qualify for the state's local road wetland replacement program, submit Parts 1 through 5, and Attachments C, D (if applicable), and E to both the Corps and the LGU. Minnesota Interagency Water Resource Application Form February 2014 Page 1 of 15 Submission Instructions Send the completed joint application form and all required attachments to: U.S Army Corps of Engineers. Applications may be sent directly to the appropriate Corps Office. For a current listing of areas of responsibilities and contact information, visit the St. Paul District's website at: htti?://www.mvp.usace.army.mil/Missions/Regulatory.aspx and select "Minnesota" from the contact Information box. Alternatively, applications may be sent directly to the St. Paul District Headquarters and the Corps will forward them to the appropriate field office. Section 401 Water Quality Certification: Applicants do not need to submit the joint application form to the MPCA unless specifically requested. The MPCA will request a copy of the completed joint application form directly from an applicant when they determine an individual 401 water quality certification is required for a proposed project. Wetland Conservation Act Local Government Unit: Send to the appropriate Local Government Unit. If necessary, contact your county Soil and Water Conservation District (SWCD) office or visit the Board of Water and Soil Resources (BWSR) web site (www.bwsr.state.mn.us) to determine the appropriate LGU. DNR Public Waters Permitting: In 2014 the DNR will begin using the Minnesota DNR Permitting and Reporting System (MPARS) for submission of Public Waters permit applications (https:/Iwebappsll.dnr state.mn us/moars/public/authentication/login). Applicants for Public Waters permits MUST use the MPARS online permitting system for submitting applications to the DNR. To avoid duplication and to streamline the application process among the various resource agencies, applicants can use the information entered into MPARS to substitute for completing parts of this joint application form. The MPARS print/save function will provide the applicant with a copy of the Public Waters permit application which, at a minimum, will satisfy Parts one and two of this joint application. For certain types of activities, the MPARS application may also provide all of the necessary information required under Parts three and four of the joint application. However, it is the responsibility of the Applicant to make sure that the joint application contains all of the required information, including identification of all aquatic resources impacted by the project (see Part four of the joint application). After confirming that the MPARS application contains all of the required information in Parts one and two the Applicant may attach a copy to the joint application and fill in any missing information in the remainder of the joint application. Minnesota Interagency Water Resource Application Form February 2014 Page 2 of 15 Project Name and/or Number: PART ONE: Applicant Information If applicant is an entity (company, government entity, partnership, etc.), an authorized contact person must be identified. If the applicant is using an agent (consultant, lawyer, or other third party) and has authorized them to act on their behalf, the agent's contact information must also be provided. Applicant/Landowner Name: Hennepin County Regional Railroad Authority (HCCRA), Jessica Galatz Mailing Address: 701 41h Avenue 5, Suite 400, Minneapolis MN 55415 Phone: 612-348-2691 E-mail Address: Jessica.galatz@hennepin.us Authorized Contact (do not complete if same as above): Sarah Johnson Mailing Address: 325 S Lake Avenue, Suite 700, Duluth MN, 55802 Phone: 218-529-7159 E-mail Address: sjohnson@barr.com Agent Name: Tyler Conley Mailing Address: 4300 MarketPointe Dr, Suite 200, Minneapolis, MN 55435 Phone: 952-832-2600 E-mail Address: tconley@barr.com PART TWO: Site Location Information County: Carver County City/Township: Chanhassen Parcel ID and/or Address: 25990600,252640080, 257560510, 250360200, and 250360700 Legal Description (Section, Township, Range): Sections 25, 36, Township 116 West, Range 23 N and Section 30, Township 116 West, Range 22 North Lat/Long(decimal degrees): 44.821518/-93.525386 Attach a map showing the location of the site in relation to local streets, roads, highways. Refer to Figure 1. Approximate size of site (acres) or if a linear project, length (feet): 9.3 acres If you know that your proposal will require an individual Permit from the U.S. Army Corps of Engineers, you must provide the names and addresses of all property owners adjacent to the project site. This information may be provided by attaching a list to your application or by using block 25 of the Application for Department of the Army permit which can be obtained at: http //www mvp usace armv mil/Portals/57/docs/regulatory/RegulatoryDocs/engform 4345 2012oct.pdf PART THREE: General Project/Site Information If this application is related to a delineation approval, exemption determination, jurisdictional determination, or other correspondence submitted prior to this application then describe that here and provide the Corps of Engineers project number. This application is related to the Chanhassen Slope Failure project number 2015-04215-MMJ. A wetland delineation was previously conducted in August 2015. This wetland delineation report was approved on December 18, 2015 (Appendix A). A second wetland delineation was completed on September 2019, for the expanded project area. This wetland delineation has been reviewed by the technical evaluation panel and the approval letter is attached. Minnesota Interagency Water Resource Application Form February 2014 Page 3 of 15 Describe the project that is being proposed, the project purpose and need, and schedule for implementation and completion. The project description must fully describe the nature and scope of the proposed activity including a description of all project elements that effect aquatic resources (wetland, lake, tributary, etc.) and must also include plans and cross section or profile drawings showing the location, character, and dimensions of all proposed activities and aquatic resource impacts. Proiect Description: The scope of the project includes landslide repairs on a portion of the Minnesota Bluffs LRT Regional Trail (trail) in Chanhassen, MN owned by the Hennepin County Regional Railroad Authority (HCRRA). Two areas will be repaired as part of this project —the north repair area and the south repair area. Project access will be from Highview Drive in Eden Prairie, proceeding southwest along the trail to the site, and also from Flying Cloud Drive through the Moon Valley Aggregate operated property (final access route through Moon Valley Aggregate operated property pending property owner authorization). Landslide repairs in the south repair area will include stabilizing the south slope, repairing the south culvert outlet area and constructing a new storm sewer and drainage ditch to direct water into the repaired area. Existing trail profile grades will be reduced with the embankment slopes regraded to less steep grades and finished with turf reinforcement mats. The existing damaged concrete headwall will be removed and existing riprap will be salvaged for reuse. The south culvert outlet area will be repaired with riprap, boulder cross vanes, and a stilling basin. Work in the north area will include removal of existing pipe debris, placement of riprap fill on north slope, and abandonment of the existing pipe crossing beneath the trail. Drainage will be rerouted from north pipe area via new buried storm sewer and lined drainage channel, which will discharge to the south culvert outlet area.Please refer to Appendix B for the complete set of design plans and layout of the aforementioned project featrues. Proiect Purpose and need In 2014, a large rain event (presidential declared disaster 41823) caused the slopes supporting the trail to fail. The trail has since been closed due to slope instability and public safety concerns. The purpose of the proposed project is to stabilize the trail slopes, reopen the trail, and thereby reconnect a six-year closure of a Tier 1 Alignment of the Regional Bicycle Transportation Network. Aquatic Resources Two wetland delineations were conducted within the project area. The first delineation was completed in August 2015. The Second wetland delineation was completed in September 2019 to accommodate the proposed construction limits in their entirety. The wetland delineations identified two wetland areas (0.49 acres) and one unnamed stream channel within the project area (Figure 2). The two wetland areas (Wetland 1, wetland 2) are incidental wetlands located within the ditch of the trail. Both wetlands contained of three communities; shallow marsh, shrub -carr, and wet meadow. The shallow marsh segment of the wetland is located on the northern end of the proposed access route. As the wetland extends southwest, the slopes gradually increase causing the plant community to change from a shallow marsh to shrub - carr and wet meadow. Using the Cowardin classification method the wetland areas were classified as palustrine emergent wetlands that are partially seasonally flooded and temporarily flooded and ditched (PEMAd/PEMCd). The unnamed stream was originally delineated as part of the 2015 wetland delineation report. The stream channel was classified as a type 1(RUBA) seasonally flooded sparsely vegetated stream channel. Work conducted in Aquatic Resources The proposed repairs will require work to be conducted within the two delineated wetlands and unnamed stream. A constructed 10 -foot wide access road is required along the existing trail to provide access for construction materials and equipment. Portions of the trail corridor are too narrow and require placement of temporary fill in the existing ditches (wetlands 1 and 2) to create the required 10 -foot wide access route. Approximately 0.06 acres of temporary fill will be placed within wetlands 1 and 2 (Appendix B, Pg G-05). Once construction is completed, the fill will be removed and the ditches will be returned to as close to the pre -project existing conditions as possible. Minnesota Interagency Water Resource Application Form February 2014 Page 4 of 15 The proposed repair work requires 0.025 acres (86 cubic yards) of riprap be placed within approximately 79 linear feet of the existing stream channel. This portion of stream has been previously impacted due to installing riprap for an emergency repair in 2016. An additonal, 0.092 acres (64 cubic yards) of riprap will be placed below the ordinary high water level downstream from the emergency repair area. The placement of this riprap will impact approximately 294 linear feet of stream channel and help further protect the stream banks and prevent further bank erosion and sedimentation downstream (Appendix 8, pg C-13). Schedule Tree clearing would be completed in the spring of 2020. Construction is anticipated to begin in the summer/fall of 2020 and commence by the end of 2020. Special considerations Threatened and Endangered Species A threatened and endangered species assessment was completed for the proposed project. The review identified two federally listed species and five state listed species occurring within one -mile of the project area (Appendix C). Rare natural Communities No records of rare natural communities are shown in the NHIS database within the project area. Special Fish and Wildlife Resources The project is expected to improve fish and wildlife habitat along the unnamed stream channel. The stream is an intermittent stream and does not support fish populations. Stabilization of the adjacent slope and stream bank will help improve downstream water quality by reducing the amount of sediment loading into the stream channel. The project will not block or impede potential fish passage. Cultural Resources In 2015, a review of records at the Minnesota State Historic Preservation Office (MSHPO) was requested to identify any previously recorded archaeological, historical, or architectural resources within the project area. Per the Minnesota Archaeological Inventory and Historic Structures Inventory for the project area, no archaeological sites were identified and one historic feature was identified within Section 25, T116N, R23W (Appendix D). This property will not be affected by the proposed project. In November 2019, a second record search was submitted to MSHPO for the expanded project area. No additional cultural resources were identified. Groundwater sensitivkv The project will not directly impact groundwater since excavations will occur up to 10 feet below the ground surface. Sensitive surface Waters The MDNR Pubilc Waters Inventory (PWI) did not identify any basins or watercourses within the Project area. No sensitive surface waters such as impaired waterbodies or trout waters were identified within the project area. Tree Removal It is anticipated the proposed project will require tree removal around the north and south repair area. Large trees will be avoided to the degree practical. Tree clearing will be conducted between November 1 and March 31 to limit impacts to sensitive wildlife species. All trees removed with >6" dbh will be replaced in accordance with the City of Chanhassen's permit requirements (Appendix 6, R-02). Status of Other Approvals Table 1 below includes the status of other approvals required by the project. Minnesota Interagency Water Resource Application Form February 2014 Page 5 of 15 Table 1, Status of Other Regulatory Agency Submittals Unit of Government Permit or Approval Status City of Chanhassen Interim Use Permit To be Submitted in December, 2019 Wetland Delineation boundary and Approved, see attached letter type confirmation submitted 11/6/2019 City of Eden Prairie Application for Utility Right of Way To be submitted in spring 2020 permit Minnesota Interagency Water Resource Application Form February 2014 Page 6 of 15 Project Name and/or Number: PART FOUR: Aquatic Resource Impact' Summary If your proposed project involves a direct or indirect impact to an aquatic resource (wetland, lake, tributary, etc.) identify each impact in the table below. Include all anticipated impacts, including those expected to be temporary. Attach an overhead view map, aerial photo, and/or drawing showing all of the aquatic resources in the project area and the location(s) of the proposed impacts. Label each aquatic resource on the map with a reference number or letter and identify the impacts in the following table. 'if impacts are temporary; enter the duration of the impacts in days next to the "T". For example, a project with a temporary access 111, .� , would be removed after 220 days would be entered "T (220)". =Impacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the Bowline of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 ft (300 square feet). sThis is generally only applicable if you are applying for a de minimis exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A". 4Use Wetland Plants and Plant Community Types of Minnesota and Wisconsin 3b Ed. as modified in MN Rules 8420.0405 Subp. 2. sRefer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: ' The term impact" as used in this joint application form is a generic term used for disclosure purposes to Identify activities that may require approval from one or more regulatory agencies. For purposes of this form R is not meant to indicate whether or not those activities may require mitigation/replacement. Minnesota Interagency Water Resource Application Form February 2014 Page 7 of 15 Type of Impact Duration of Ewatershed ounty, Major Aquatic Resource Aquatic (fill, excavate, Impact Overall Size of #, Bank ID (as noted on Resource Type drain, or Permanent (P) Size of Impact' Aquaticand overhead view) (wetland, lake, remove or Temporary Resource 3 Service Area # Area s tributary etc.) vegetation) (T)' of Impact Stream 1 Tributary Fill P 77ft (0.025 N/A Carver County Watershed #33 JNone (Maintenance) acres) BSA #7 Stream 1 Tributary Fifl (bank P 296ft 0.092 ( N/A Carver County Watershed #33 stabilization) acres) BSA #7 1,2 Warver etland Fill T (90) 0.06 acres N/A county Wat rshed #33 BSA #7 C.11 ,Ani 'if impacts are temporary; enter the duration of the impacts in days next to the "T". For example, a project with a temporary access 111, .� , would be removed after 220 days would be entered "T (220)". =Impacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the Bowline of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 ft (300 square feet). sThis is generally only applicable if you are applying for a de minimis exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A". 4Use Wetland Plants and Plant Community Types of Minnesota and Wisconsin 3b Ed. as modified in MN Rules 8420.0405 Subp. 2. sRefer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: ' The term impact" as used in this joint application form is a generic term used for disclosure purposes to Identify activities that may require approval from one or more regulatory agencies. For purposes of this form R is not meant to indicate whether or not those activities may require mitigation/replacement. Minnesota Interagency Water Resource Application Form February 2014 Page 7 of 15 PART FIVE: Applicant Signature ❑ Check here if you are requesting a pre -application consultation with the Corps and LGU based on the information you have provided. Regulatory entities will not initiate a formal application review if this box is checked. By signature below, I attest that the information in this application is complete and accurate. I further attest that I possess the authority to undertake the work described herein. signature:`- G 0.-.J, � Date: I%/13 119 I hereby authorize to act on my behalf as my agent in the processing of this application and to furnish, upon request, supplemental information in support of this application, Minnesota Interagency water Resource Application Form February 2014 Page 8 of 15 Project Name and/or Number: Attachment A Request for Delineation Review, Wetland Type Determination, or Jurisdictional Determination By submission of the enclosed wetland delineation report, I am requesting that the U.S. Army Corps of Engineers, St. Paul District (Corps) and/or the Wetland Conservation Act Local Government Unit (LGU) provide me with the following (check all that apply): ❑ Wetland Type Confirmation ❑ Delineation Concurrence. Concurrence with a delineation is a written notification from the Corps and a decision from the LGU concurring, not concurring, or commenting on the boundaries of the aquatic resources delineated on the property. Delineation concurrences are generally valid for five years unless site conditions change. Under this request alone, the Corps will not address the jurisdictional status of the aquatic resources on the property, only the boundaries of the resources within the review area (including wetlands, tributaries, lakes, etc.). ❑ Preliminary Jurisdictional Determination. A preliminary jurisdictional determination (PJD) is a non-binding written indication from the Corps that waters, including wetlands, identified on a parcel may be waters of the United States. For purposes of computation of impacts and compensatory mitigation requirements, a permit decision made on the basis of a PJD will treat all waters and wetlands in the review area as if they are jurisdictional waters of the U.S. PJDs are advisory in nature and may not be appealed. ❑ Approved Jurisdictional Determination. An approved jurisdictional determination (AID) is an official Corps determination that jurisdictional waters of the United States are either present or absent on the property. AJDs can generally be relied upon by the affected party for five years. An AID may be appealed through the Corps administrative appeal process. In order for the Corps and LGU to process your request, the wetland delineation must be prepared in accordance with the 1987 Corps of Engineers Wetland Delineation Manual, any approved Regional Supplements to the 1987 Manual, and the Guidelines for Submitting Wetland Delineations in Minnesota (2013). http://www.mvp.usace.army.mil/MissionsZRegulatory/De lineationJDGuidance.aspx Minnesota Interagency Water Resource Application Form February 2014 Page 9 of 15 Project Name and/or Number: Attachment B Supporting Information for Applications Involving Exemptions, No Loss Determinations, and Activities Not Requiring Mitigation Complete this part if you maintain that the identified aquatic resource impacts in Part Four do not require wetland replacement/compensatory mitigation OR if you are seeking verification that the proposed water resource impacts are either exempt from replacement or are not under CWA/WCAjurisdiction. Identify the specific exemption or no -loss provision for which you believe your project or site qualifies: WCA: 8420.0105 Subp. 2. D. USACE: Nationwide Permit 13: Bank stabilization and Nationwide Permit 3: Maintenance Provide a detailed explanation of how your project or site qualifies for the above. Be specific and provide and refer to attachments and exhibits that support your contention. Applicants should refer to rules (e.g. WCA rules), guidance documents (e.g. BWSR guidance, Corps guidance letters/public notices), and permit conditions (e.g. Corps General Permit conditions) to determine the necessary information to support the application. Applicants are strongly encouraged to contact the WCA LGU and Corps Project Manager prior to submitting an application if they are unsure of what type of information to provide: WCA Under 8420.0105 Subp. 2. D WCA does not regulate impacts to incidental wetlands. The two delineated wetlands that would be temporarily impacted by the proposed project are manmade ditched wetlands. These ditches are meant to convey water away from the trail. However, due to the lack of slope, water has Fended in the trail area creating a narrow wetland within an upland area. The project will place approximately 0.06 acres of fill within the incidental wetland area. This fill will be temporary and removed upon completion of the project. The ditches will then be restored to as close to the pre -project existing conditions as possible. USACE: It is anticipated that work within Waters of the U.S. can be completed under Nationwide Permit 3 and/or Nationwide Permit 13. Maintenance Activities: The proposed project would need to repair 0.025 acres (86 cubic yards) of riprap within approximately 79 linear feet of the existing stream channel. Some riprap was originally placed in this segment of the stream channel as part of a previous emergency repair needed to stabilize the south culvert outlet. Since then the riprap has been displaced during subsequent flood and runoff events. The proposed project would salvage existing riprap and also install additional riprap to further protect the area from future erosion. Bank Stabilization Activities: Bank stabilization activities necessary for erosion control or prevention, such as vegetative stabilization, bioengineering, spills, riprap, revetment, gabion baskets, stream barbs, and bulkheads, or combination of bank stabilization techniques. In order to stabilize the bank of the unnamed stream, 0.092 acres (64 cubic yards) of riprap will be placed below the ordinary high water level. The placement of riprap will impact approximately 294 linear feet of stream channel. Minnesota interagency Water Resource Application Form February 2014 Page 10 of 15 Project Name and/or Number: Attachment C Avoidance and Minimization Project Purpose, Need, and Requirements. Clearly state the purpose of your project and need for your project. Also include a description of any specific requirements of the project as they relate to project location, project footprint, water management, and any other applicable requirements. Attach an overhead plan sheet showing all relevant features of the project (buildings, roads, etc.), aquatic resource features (impact areas noted) and construction details (grading plans, storm water management plans, etc.), referencing these as necessary: Avoidance. Both the CWA and the WCA require that impacts to aquatic resources be avoided if practicable alternatives exist. Clearly describe all on-site measures considered to avoid impacts to aquatic resources and discuss at least two project alternatives that avoid all impacts to aquatic resources on the site. These alternatives may include alternative site plans, alternate sites, and/or not doing the project. Alternatives should be feasible and prudent (see MN Rules 8420.0520 Subp. 2 Q. Applicants are encouraged to attach drawings and plans to support their analysis: Minimization. Both the CWA and the WCA require that all unavoidable impacts to aquatic resources be minimized to the greatest extent practicable. Discuss all features of the proposed project that have been modified to minimize the impacts to water resources (see MN Rules 8420.0520 Subp.4): Off -Site Alternatives. An off-site alternatives analysis is not required for all permit applications. If you know that your proposal will require an individual permit (standard permit or letter of permission) from the U.S. Army Corps of Engineers, you may be required to provide an off-site alternatives analysis. The alternatives analysis is not required for a complete application but must be provided during the review process in order for the Corps to complete the evaluation of your application and reach a final decision. Applicants with questions about when an off-site alternatives analysis is required should contact their Corps Project Manager. Minnesota Interagency Water Resource Application Form February 2014 Page 11 of 15 Project Name and/or Number: Attachment D Replacement/Compensatory Mitigation Complete this part if your application involves wetland replacement/compensatory mitigation not associated with the local road wetland replacement program. Applicants should consult Corps mitigation guidelines and WCA rules for requirements. Replacement/Compensatory Mitigation via Wetland Banking. Complete this section if you are proposing to use credits from an existing wetland bank (with an account number in the State wetland banking system) for all or part of your replacement/compensatory mitigation requirements. Wetland BankBank County Major Credit Type Account # tY Watershed # Service Number of Credits Area # Cif applicable) Applicants should attach documentation indicating that they have contacted the wetland bank account owner and reached at least a tentative agreement to utilize the identified credits for the project. This documentation could be a signed purchase agreement, signed application for withdrawal of credits or some other correspondence indicating an agreement between the applicant and the bank owner. However, applicants are advised not to enter into a binding agreement to purchase credits until the mitigation plan is approved by the Corps and LGU. Project -Speck Replacement/Permittee Responsible Mitigation. Complete this section if you are proposing to pursue actions (restoration, creation, preservation, etc.) to generate wetland replacement/compensatory mitigation credits for this proposed project. WCA Action Eligible Corps Mitigation Credit % Credits Major for Credit' Compensation Acres County Technique' Requested Anticipated' Watershed # Bank Service Area # 3Refer to the name and .�.�...-» .....u_-:_ . _. .._...__.._.....r.... ��..���—nl,.. nuieo 20.0526. 'Refer to the technique listed in St. Paul District Policy for Wetland Compensatory Mitigation in Minnesota. 31f WCA and Corps crediting differs, then enter both numbers and distinguish which is Corps and which is WCA. Explain how each proposed action or technique will be completed (e.g. wetland hydrology will be restored by breaking the tile......) and how the proposal meets the crediting criteria associated with it. Applicants should refer to the Corps mitigation policy language, WCA rule language, and all associated Corps and WCA guidance related to the action or technique: Attach a site location map, soils map, recent aerial photograph, and any other maps to show the location and other relevant features of each wetland replacement/mitigation site. Discuss in detail existing vegetation, existing landscape features, land use (on and surrounding the site), existing soils, drainage systems (if present), and water sources and movement. Include a topographic map showing key features related to hydrology and water Flow (inlets, outlets, ditches, pumps, etc.): Minnesota Interagency Water Resource Application Form February 2014 Page 12 of 15 Project Name and/or Number: Attach a map of the existing aquatic resources, associated delineation report, and any documentation of regulatory review or approval. Discuss as necessary: For actions involving construction activities, attach construction plans and specifications with all relevant details. Discuss and provide documentation of a hydrologic and hydraulic analysis of the site to define existing conditions, predict project outcomes, identify specific project performance standards and avoid adverse offsite impacts. Plans and specifications should be prepared by a licensed engineer following standard engineering practices. Discuss anticipated construction sequence and timing: For projects involving vegetation restoration, provide a vegetation establishment plan that includes information on site preparation, seed mixes and plant materials, seeding/planting plan (attach seeding/planting zone map), planting/seeding methods, vegetation maintenance, and an anticipated schedule of activities: For projects involving construction or vegetation restoration, identify and discuss goals and specific outcomes that can be determined for credit allocation. Provide a proposed credit allocation table tied to outcomes: Provide a five-year monitoring plan to address project outcomes and credit allocation: Discuss and provide evidence of ownership or rights to conduct wetland replacement/mitigation on each site: Quantify all proposed wetland credits and compare to wetland impacts to identify a proposed wetland replacement ratio. Discuss how this replacement ratio is consistent with Corps and WCA requirements: By signature below, the applicant attests to the following (only required if application involves project-specific/permittee responsible replacement): All proposed replacement wetlands were not: • Previously restored or created under a prior approved replacement plan or permit • Drained or filled under an exemption during the previous 10 years • Restored with financial assistance from public conservation programs • Restored using private funds, other than landowner funds, unless the funds are paid back with interest to the individual or organization that funded the restoration and the individual or organization notifies the local government unit in writing that the restored wetland may be considered for replacement. The wetland will be replaced before or concurrent with the actual draining or filling of a wetland. An irrevocable bank letter of credit, performance bond, or other acceptable security will be provided to guarantee successful completion of the wetland replacement. Within 30 days of either receiving approval of this application or beginning work on the project, I will record the Declaration of Restrictions and Covenants on the deed for the property on which the replacement wetland(s) will be located and submit proof of such recording to the LGU and the Corps. Applicant or Representative: Signature: Minnesota Interagency Water Resource Application Form February 2014 Title: Date: Page 13 of 15 Project Name and/or Number: Attachment E Local Road Replacement Program Qualification Complete this part if you are a local road authority (county highway department, city transportation department, etc.) seeking verification that your project (or a portion of your project) qualifies for the MN Local Government Road Wetland Replacement Program (LGRWRP). If portions of your project are not eligible for the LGRWRP, then Attachment D should be completed and attached to your application. Discuss how your project is a repair, rehabilitation, reconstruction, or replacement of a currently serviceable road to meet state/federal design or safety standards/requirements. Applicants should identify the specific road deficiencies and how the project will rectify them. Attach supporting documents and information as applicable: Provide a map, plan, and/or aerial photograph accurately depicting wetland boundaries within the project area. Attach associated delineation/determination report or otherwise explain the method(s) used to identify and delineate wetlands. Also attach and discuss any type of review or approval of wetland boundaries or other aspects of the project by a member or members of the local Technical Evaluation Panel (TEP) or Corps of Engineers: In the table below, identify only the wetland impacts from Part 4 that the road authority has determined should qualify forthe LGRWRP. Wetland Impact ID (as noted on overhead view) Type of Impact Size of Impact (fill, excavate, Existing Plant Community (square feet or Type(s) in Impact Areal drain) acres to 0.01) County, Major Watershed #, and Bank Service Area # of Impactz !Use Wetland Plants and Plant Community Types of Minnesota and Wisconsin 3' Ed. as modified in MN Rules 8420.0405 Subp. 2. 'Refer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. Discuss the feasibility of providing onsite compensatory mitigation/replacement for important site-specific wetland functions: Please note that under the MN Wetland Conservation Act, projects with less than 10,000 square feet of wetland impact are allowed to commence prior to submission of this notification so long as the notification is submitted within 30 days of the impact. The Clean Water Act has no such provision and requires that permits be obtained prior to any regulated discharges into water of the United States. To avoid potential unauthorized activities, road authorities must, at a minimum, provide a complete application to the Corps and receive a permit prior to commencing work. By signature below, the road authority attests that they have followed the process in MN Rules 8420.0544 and have determined that the wetland impacts identified in Part 4 are eligible for the MN Local Government Road Wetland Replacement Program. Road Authority Representative: Title: Signature: Minnesota Interagency Water Resource Application Form February 2014 Date: Page 14 of 15 Technical Evaluation Panel Concurrence: Project Name and/or Number: TEP member: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: TEP member: Date: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes []No Signature: TEP member: Date: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: TEP member: Date: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: Date: Upon approval and signature by the TEP, application must be sent to: Wetland Bank Administration Minnesota Board of Water & Soil Resources 520 Lafayette Road North Saint Paul, MN 55155 Minnesota Interagency Water Resource Application Form February 2014 Page 15 of 15 Figures 3 +. j o . Eastwood Ct or. i t 12 CwA, 3 I / a� o 'a .� t . _� ••y a % % r y�., ".pt { 3 e. (t •',f1 Ct'f+i J' Fd fix. �I ,"'�. , a r" ,oa} �k f .'.f''• '� 1.$. A,,f � ."Y♦,, r 1 '}r• k e.R r..w ¢;�'. }(° I ,r >✓Fi^^{i r! P C� r 1 1� ♦ %ka �•st:. t! wP?°� C.? - !a �1y- ' ^�` .l'. d C11 4tj .. �'• �'r� Z.•. ' ►'+ a ••1 kk, .: it ,.e •/�tt �f P �1 V r. "''ai�• Y 2`d` r / Minnesota Bluff Rivers LRT Regional Trail OConstruction Limits L7 County Boundary QPublic Land Survey Section i 0 700 Feet Imagery Source; NearMaP, April 2019 r It t: 441 N t 1 pioneer Tr r ® Wetland Sample Location Wetland Classifications N O Construction Limits Type 3 O —� Approximate Stream Channel Type 6 0 100 K Delineated Wetlands Feet Imagery Source; NearMap, April 2079 4 Ar- . A 7 21 E) Wetland Sample Location Wetland Classifications MConstruction Limits Type 6 0 100 kRR --10- Approximate Stream Channel IMEMEEZ= K Delineated Wetlands Feet Imagery Source; Near Map, Apri12079 -m r' Fffl ;4i,, _ 9 - .tet � a .. `x•'.�i, � - - ,{lk. _..� .. ,,•.lei t �+a _r,�S• ->� Ste.'' OConstruction Limits Wetland Classifications O — 2015 Delineated Wetlands C3 Type 1 . N , IARR —♦ Approximate Stream Channel Type 6 0 00 -SVIChanhassen, Minnesota - , Delineated Wetlands Feet Imagerysource: Ne rMap, Apri12019 31, i � 1 F �y �d . 1..t. .. f �i 61 M1 O Construction Limits Delineated Wetlands OWETLAND DELI • I • N o - ,� 2015 Delineated Wetlands Wetland Classifications Type 1 p too 1 ivet luffs '•• • Minnesota •..•• LRT BARR �♦ Approximate Stream Channel � Chanhassen, Minnesota m"O ff � c --♦ Culvert Pipe Feet Imagery Source, NearMap, April 2079 FIGURE 2 d �,. t .,:��: APPENDIX A MN Wetland Conservation Act Notice of Decision Project Name and/or Number: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization PART ONE: Applicant Information If applicant is an entity (company, government entity, partnership, etc.), an authorized contact person must be identified. If the applicant is using an agent (consultant, lawyer, or other third party) and has authorized them to act on their behalf, the agent's contact information must also be provided. Applicant/Landowner Name: Jessica Galatz, Hennepin County Regional Railroad Authority Mailing Address: 701 Fourth Avenue South, Suite 400 Phone: 612-348-2691 E-mail Address: jessica.galatz@hennepin.us Authorized Contact (do not complete if same as above): Mailing Address: Phone: E-mail Address: Agent Name: Joel Swenson, Barr Engineering Mailing Address: 4700 West 77" St, Minneapolis, MN 55435 Phone: 952-832-2799 E-mail Address: jswenson@barr.com PART TWO: Site Location Information County: Carver Parcel ID and/or Address: Legal Description (Section, Township, Range): Lat/Long (decimal degrees): -93.527 44.819 City/Township: Chanhassen 536, T116N, R23W Attach a map showing the location of the site in relation to local streets, roads, highways. Approximate size of site (acres) or if a linear project, length (feet): 8.13 acres If you know that your proposal will require an individual Permit from the U.S. Army Corps of Engineers, you must provide the names and addresses of all property owners adjacent to the project site. This information may be provided by attaching a list to your application or by using block 25 of the Application for Department of the Army permit which can be obtained at: htto://www mvo usace armv mil/Portals/57/docs/regulatory/Regulato!yDocs/engform 4345 2012oct odf PART THREE: General Project/Site Information If this application is related to a delineation approval, exemption determination, jurisdictional determination, or other correspondence submitted prior to this application then describe that here and provide the Corps of Engineers project number. Describe the project that is being proposed, the project purpose and need, and schedule for implementation and completion. The project description must fully describe the nature and scope of the proposed activity including a description of all project elements that effect aquatic resources (wetland, lake, tributary, etc.) and must also include plans and cross section or profile drawings showing the location, character, and dimensions of all proposed activities and aquatic resource impacts. Minnesota Interagency Water Resource Application Form February 2014 Page 3 of 11 Project Name and/or Number: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization PART FOUR: Aquatic Resource Impact' Summary If your proposed project involves a direct or indirect impact to an aquatic resource (wetland, lake, tributary, etc.) identify each impact in the table below. Include all anticipated impacts, including those expected to be temporary. Attach an overhead view map, aerial photo, and/or drawing showing all of the aquatic resources in the project area and the location(s) of the proposed impacts. Label each aquatic resource on the map with a reference number or letter and identify the impacts in the following table. 'If impacts are temporary; enter the duration of the Impacts in days next to the "T". For example, a project with a temporary access fill that would be removed after 220 days would be entered "T (220)". 'Impacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary Impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the flowline of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 ft (300 square feet). 'This is generally only applicable if you are applying for a de minimis exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A". 4Use Weiland Plants and Plant Commualty Types of Minnesota and Wisconsin 3'd Ed. as modified In MN Rules 8420.0405 Subp. 2. 'Refer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: PART FIVE: Applicant Signature ® Check here if you are requesting a pre -application consultation with the Corps and LGU based on the information you have provided, Regulatory entities will not initiate a formal application review if this box is checked. By signature below, I attest that the information in this application is complete and accurate. I further attest that I possess the authority to undertake the work described herein. Signature: Date: gJ(P115 I hereby authorize to act on my behalf as my agent in the processing of this application and to furnish, upon request, .)bQ.1 SWZXT Sor) r QE supplemental information in support of this application. $ol(r E'iAirleal�rlo, 1 The term "impact" as used in this joint application form is a generic term used for disclosure purposes to identify activities that may require approval from one or more regulatory agencies. For purposes of this form it is not meant to Indicate whether or not those activities may require mitigation/replacement. Minnesota Interagency Water Resource Application Form February 2014 Page 4 of 11 Type of Impact Duration of yp Existing Plant County, Major Aquatic Resource Aquatic (fill, excavate, Impact Overall Site of Community Watershed #, ID (as noted on Resource Type drain, or Permanent (P) Site of Impact z Aquatic Type(s) in and Bank overhead view) (wetland, lake, remove or Temporary Resource' Impact Area' Service Area M tributary etc.) vegetation) (T) of Impact Area 'If impacts are temporary; enter the duration of the Impacts in days next to the "T". For example, a project with a temporary access fill that would be removed after 220 days would be entered "T (220)". 'Impacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary Impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the flowline of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 ft (300 square feet). 'This is generally only applicable if you are applying for a de minimis exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A". 4Use Weiland Plants and Plant Commualty Types of Minnesota and Wisconsin 3'd Ed. as modified In MN Rules 8420.0405 Subp. 2. 'Refer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: PART FIVE: Applicant Signature ® Check here if you are requesting a pre -application consultation with the Corps and LGU based on the information you have provided, Regulatory entities will not initiate a formal application review if this box is checked. By signature below, I attest that the information in this application is complete and accurate. I further attest that I possess the authority to undertake the work described herein. Signature: Date: gJ(P115 I hereby authorize to act on my behalf as my agent in the processing of this application and to furnish, upon request, .)bQ.1 SWZXT Sor) r QE supplemental information in support of this application. $ol(r E'iAirleal�rlo, 1 The term "impact" as used in this joint application form is a generic term used for disclosure purposes to identify activities that may require approval from one or more regulatory agencies. For purposes of this form it is not meant to Indicate whether or not those activities may require mitigation/replacement. Minnesota Interagency Water Resource Application Form February 2014 Page 4 of 11 Project Name and/or Number: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization Attachment A Request for Delineation Review, Wetland Type Determination, or Jurisdictional Determination By submission of the enclosed wetland delineation report, I am requesting that the U.S. Army Corps of Engineers, St. Paul District (Corps) and/or the Wetland Conservation Act Local Government Unit (LGU) provide me with the following (check all that apply): ® Wetland Type Confirmation ® Delineation Concurrence. Concurrence with a delineation is a written notification from the Corps and a decision from the LGU concurring, not concurring, or commenting on the boundaries of the aquatic resources delineated on the property. Delineation concurrences are generally valid for five years unless site conditions change. Under this request alone, the Corps will not address the jurisdictional status of the aquatic resources on the property, only the boundaries of the resources within the review area (including wetlands, tributaries, lakes, etc.). ® Preliminary Jurisdictional Determination. A preliminary jurisdictional determination (PJD) is a non-binding written indication from the Corps that waters, including wetlands, identified on a parcel may be waters of the United States. For purposes of computation of impacts and compensatory mitigation requirements, a permit decision made on the basis of a PJD will treat all waters and wetlands in the review area as if they are jurisdictional waters of the U.S. PJDs are advisory in nature and may not be appealed. ❑ Approved Jurisdictional Determination. An approved jurisdictional determination (AJD) is an official Corps determination that jurisdictional waters of the United States are either present or absent on the property. AJDs can generally be relied upon by the affected party for five years. An AID may be appealed through the Corps administrative appeal process. In order for the Corps and LGU to process your request, the wetland delineation must be prepared in accordance with the 1987 Corps of Engineers Wetland Delineation Manual, any approved Regional Supplements to the 1987 Manual, and the Guidelines for Submitting Wetland Delineations in Minnesota (2013). htto://www.mvo usace armv mil/Missions/Regulatory/DelineationJDGuidance asox Minnesota Interagency Water Resource Application Form February 2014 Page 5 of 11 Minnesota Wetland Conservation Act Notice of Decision Local Government Unit (LGU) Address Ci of Chanhassen 7700 Market Boulevard, PO Boz 147 Chanhasse MN 55317 TI�TII ♦Tl/��T Applicant Name Project Name Dau of Application Hennepin County Regional RanMN o s� none 10/2015 01lication - Number Authority Trull Attach site locator map. of Decision ® Wetland Boundary or Type ❑ No -Loss ❑ Exemption ❑Sequencing ❑ Replacement Plan ❑ Banking Plan Technical Evaluation Panel Findings'and Recommendation ff any): ❑ ,Approve ❑ Approve with conditions ❑ Deny Summary (or attach): 2. LOCAL GOVERNMENT ITNIT DECISION Dau of Decision: December 15, 2015 ❑ Approved ® Approved with conditions (include below) ❑ Denied BWSR Forms 11-2s-09 Pa' of 3 LGU Findings and Conclusions (attach additional sheets as necessary): Baa Enginecring, on behalf of the Hennepin County Regional Rail Authority (HCRRA), has Performed a wetland determination and boundary delineation for the site located along the LRT Regional Trail, between Pioneer Trail and TH 101 in Chanhassen, MN, and within the SE '/s of Section 25, TI 16N, R23W. This delineation identified two wetland basins on-site. Wetland Area 1 is located at the NE portion of the site, upslope from a stream channel. This has been identified as a Type 2 (PEMB) wet meadow seepage wetland. Wetland Area 2 is an intermittent stream channel located at the southern portion of the site. This wetland was identified as a Type 1, seasonally flooded stream in the delineation report, however this basin fails to meet the hydrophytic vegetation criterion and therefore is not considered jurisdictional under the MN Wetland Conservation Act. None of the wetland areas identified in the delineation are identified on the National Wetland Inventory Map, or the DNR Public Waters Map. Based upon our review, the City of Chanhassen, as the LGU responsible for administration of Minnesota R. 8420, concurs with the delineated boundary and types as identified in the wetland determination and delineation report prepared by Barr Engineering, dated August 2015, and the wetland boundaries shown within the report. The Application for Wetland Boundary and Type was noticed on November 10*° 2015. No additional comments were received from the Technical Evaluation Panel members or from the public. This concludes our review. Upon the provision of the electronic representation of the delineated boundaries (*.shp or *.dwA this delineation will be considered approved For Lrcement Plans usin credits from the State Wetland Bank: Bank Account # Bank Service Area County Credits Approved for Withdrawal (sq. ft. or nearest .Ol acre Replacement Plan Approval Conditions. In addition to any conditions specified by the LGU, the approval of a Wetland Replacement Plan is conditional upon the following: ❑ Financial Assurance: For project -specific replacement that is not in -advance, a financial assurance specified by the LGU must be submitted to the LGU in accordance with MN Rule 8420.0522, Subp. 9 (List amount and type in LGU Findings). ❑ Deed Recording: For project -specific replacement, evidence must be provided to the LGU that the BWSR "Declaration of Restrictions and Covenants" and "Consent to Replacement Wetland" fomes have been filed with the county recorder's office in which the replacement wetland is located. ❑ Credit Withdrawal: For replacement consisting of wetland bank credits, confirmation that B WSR has withdrawn the credits from the state wetland bank as specified in the approved replacement plan. Wetlands may not be impacted until all applicable conditions have been met! BWSR Forms 11-25-09 of 3 Page 2 LGU Authorized Si ature: Signing and mailing of this completed form to the appropriate recipients in accordance with 8420.0255, ' ll arvry rvt,r nrra,.no .., _. Additio s Subp. 5 provides notice that a decision was made by the LGU under the Wetland Conservation Act as specified above. If additional details on the decision exist, they have been provided to the landowner and are available from the LGU upon est• Name Title Terrance Jeffery, WDC Water Resources Coordinator Phone Number and E-mail 1411arx FDate 952.227.1168 ef�zl`e�`s eff cLchanh ssen.mn.us its from local, state, and federal agencies may be required. Check with all appropriate authorities before commencing work in or near wetlands. Applicants proceed at their own risk if work authorized by this decision is started before the time period for appeal (30 days) has expired. If this decision is reversed or revised under appeal, the applicant may be responsible for restoring or replacing all wetland impacts. This decision is valid for three years from the date of decision unless a longer period is advised by the TEP and specified in this notice of decision. 3. APPEAL OF THIS DECISION Pursuant to MN Rule 8420.0905, any appeal of this decision can only be commenced by mailing a petition for appeal, including applicable fee, within thirty (30) calendar days of the date of the mailing of this Notice to the following as indicated: L;necs: one: Appeal of an LGU staff decision. Send Appeal of LGU governing body decision. petition and $50_00 fee (if applicable) to: Send petition and $500 filing fee to: Chanhassen City Council Executive Director c/o Todd Gerhardt, City Manager Minnesota Board of Water and Soil Resources 7700 Market Blvd, PO Box 147 520 Lafayette Road North Chanalusen, MN 55317 St, Paul MN 55155 4. LIST OF ADDRESSEES ® SWCD TEP member: Chip Hentges, Aaron Finke ® BWSR TEP member: Ben Meyer ❑ LGU TEP member (if different than LGU Contact): ® DNR TEP member (notice only): ® DNR Regional Office (if different than DNR TEP member): ® WD or WMO (if applicable): Linda Loomis, Lower MN River Watershed District ® Applicant (notice only) and Landowner (if different): Jessica Galatz, HCRRA ® Members of the public who requested notice (notice Only): Joel Swenson, Barr Engineering ® Corps of Engineers Project Manager (notice only) Melissa Jenny ❑ BWSR Wetland Bank Coordinator (wetland bank plan applications only): BWSR Forms 11-25-09 Page 3 of 3 5. MAILING INFORMATION ➢For a list of B WSR TEP representatives, see: www.bwsr.state.mn.us/aboutbwsr/workareas/WCA areas. df ➢For a list of DNR TEP representatives, see: www.bwsr.state.mn.us/wetlands/wca/DNR TEP contacts odf Reg. Env. Assess. Ecol Div. Ecol Resources 2115 Birchmont Beach Rd. NE For a map Reg. Env. Assess. Ecol Div. Ecol. Resources 1201 E. Hwy. 2 Grand Rapids, MN 55744 ive Regions, see: ho: Reg. Env. Assess. Ecol. Div. Ecol. Resources 1200 warm Road St Paul, MN 55106 ➢For a list of Corps of Project Managers, see: www.mvp.usue.armv.mil/remilatory/default.@V.?pggeid=687 or send to: %Dept. of the Army, Corps of Engineers, St. Paul District ATTN: CO -I?. 190 Fifth Street East St. Paul, MN 55101-1638 ➢For Wetland Bank Plan applications, also send a copy of the application to: Minnesota Board of Water and Soil Resources Wetland Bank Coordinator 520 Lafayette Road North St. Paul, MN 55155 6. ATTACHMENTS Reg. Env. Assess, Ecol. Div. Ecol. Resources 261 Hwy. 15 South New Ulm, MN 56073 In addition to the application, list any other attachments: ® Joint Water Resources Application for Approval of Wetland Type and Boundary, dated November &, 2015 ® Wetiand Delineation Report, dated August 2015. BWSR Forms 11-25-09 of 3 Page 4 �IBOARD OF WATER AND SOIL RESOURCES Minnesota Wetland Conservation Act Notice of Decision Local Government Unit: City of Chanhassen =Authority Applicant Name: Jessica Galatz, Hennepin County RegionaApplicant Representative: Sarah Johnson, Barr EngineerinProject Name: HCRRA Minnesota River Bluffs LRT Regionation Update LGU Project No. (if any): Date Complete Application Received by LGU: 10/30/2019 Date of LGU Decision: 12/5/2019 Date this Notice was Sent: 12/9/2019 WCA Decision Type - check all that apply ®Wetland Boundary/Type ❑Sequencing ❑Replacement Plan ❑Bank Plan (not credit purchase) ❑No -Loss (8420.0415) ❑Exemption (8420.0420) Part:❑A❑B ❑C❑DOE OF ❑G ❑H Subpart:02030405 0607 0809 Replacement Plan Impacts (replacement plan decisions only) Total WCA Wetland Impact Area: Wetland Replacement Type: ❑ Project Specific Credits: ❑ Bank Credits: Bank Account echnical Evaluation Panel Findings and Recommendations (attach if any) ❑ Approve ❑ Approve w/Conditions ❑ Deny N No TEP Recommendation .GU Decision ❑ Approved with Conditions (specify below)' ® Approved' ❑ Denied List Conditions: Decision -Maker for this Application: N Staff ❑ Governing Board/Council ❑ Other: Decision is valid for: N 5 years (default) ❑ Other (specify): ... ..........�,nra BwSR confirms the withdrawal of any required wetland bank credits. For Project - specific replacement a f nancial assurance per MN Rule 8420.0522, Subp. 9 and evidence that all required forms hove been recoraea on the title of the property on which the replacement wetland is located must be provided to the LGU for the approval to be valid. .GU Findings - Attach document(s) and/or insert narrative proviaing me odmb w.. _ _�� ��-•-•-•• N Attachment(s) (specify): Wetland Delineation Figure N Summary: The LGU reviewed the site in the field on October 29, 2019. No comments were received from the TEP and the LGU concurred with the boundary and type observed In the field. must consider any Attached Project Documents 1 BWSR NOD Form - November 5, 2019 LE Site Location Map ❑ Project Plan(s)/Descriptions/Reports (specify): Appeals of LGU Decisions If you wish to appeal this decision, you must provide a written request within 30 calendar days of the date you received the notice. All appeals must be submitted to the Board of Water and Soil Resources Executive Director along with a check payable to BWSR for $500 unless the LGU has adopted a local appeal process as identified below. The check must be sent by mail and the written request to appeal can be submitted by mail or e-mail. The appeal should include a copy of this notice, name and contact information of appellant(s) and their representatives (if applicable), a statement clarifying the intent to appeal and supporting information as to why the decision is in error. Send to: Appeals & Regulatory Compliance Coordinator Minnesota Board of Water & Soils Resources 520 Lafayette Road North St. Paul, MN 55155 [ravis.germundsonkdstate mn us Does the LGU have a local appeal process applicable to this decision? N Yes' ❑ No 'If yes, all appeals must first be considered via the local appeals process. Local Appeals Submittal RPM,flram.n}c (l ai i -,+a ...:k.. - -- -- -- --- •••��• �_�_ �_ _�• .� aNN�a, �uunuudi requtremems, tees, etcas applicable) Send petition and $50.00 to 7700 Market Boulevard, PO Box 147, Chanhassen, MN 55317 Notice Distribution (include name) Required on all notices: N SWCD TEP Member: Aaron Finke N BWSR TEP Member: Ben Carlson N LGU TEP Member (if different than LGU contact): Todd Gerhardt, City of Chanhassen, AndF tt, WSBN DNR Representative: Leslie Parris, Jennie SkanckeN Watershed District or Watershed Mgmt. Org.: Linda Loomis, Lower MN River Watershed DN Applicant (notice only): Jessica Galatz, Hennepin County Regional Rail Authority NConsultant (notice only): Sarah Johnson, Barr Engineering; Tyler Conley, Barr Engineering vpuunar or AS AppliCoble: N Corps of Engineers: Marian Weitzenkamp ❑ BWSR Wetland Mitigation Coordinator (required for bank plan applications only): N Members of the Public (notice only): Leslie Stovring, Eden Prairie LGU; Erik Henricksen, City of Chanhassen; Terry Jeffery, RPBCWD ❑ Other: rSignature: Date:aw _ ! —1 T' s notice and accpmpany,nR appGUGoe. materials maybe un[ dectroniWlfy or try mail. The LGU +nay opt tosetrd a summary of the application to members of the public upon request per $420.0255, Subp. J. BWSR NOD Form — November 5, 2019 a r' I r7 ® Wetland Sample Location Wetland Classifications WETLAND DELINEATION Construction Limits Type 6 Minnesota River Bluffs LRT p 100 ''•• • .•z Puw A. Approximate Stream Channel Minnesota F� Delineated Wetlands Feet Imagery Sou¢e; NeurMap, April 2019 t i i v Y +. _ � -4 � s' dt � "� •Y S��T � y— OConstruction Limits Wetland Classifications - 2015 Delineated Wetlands W O Type 1 N - BARR —♦ Approximate Stream Channel Type 6 0 i00 •.. . NOMENE::= Chanhassen, Minnesota ..- Delineated Wetlands FW Imagery Source; NearMap. April 2019 FIGURE 6 T -T! s , P K .1 Y y' _ \ q � � yl•y Y � i ., 1 6- r L�yy . M Construction Limits 6 Delineated Wetlands y �— 2015 Delineated Wetlands N Wetland Classifications • •.. /� 0 100 Type 1 '-.. B- �► Approximate Stream Channel W y MMMMM Culvert Pipe Feet Imagery Source; NearMap, April 2019 - QConstruction Limits — 2015 Delineated Wetlands —� Approximate Stream Channel Culvert Pipe O 0 100 Feet Imagery Source, NeorMap, April 2019 J APPENDIX B Plan Set Refer to Attachment 3 for the Design Plan Set APPENDIX C Threatened and Endangered Species Review Memorandum resourceful. naturally. BARR engineering and environmental consultants - Technical Memorandum To: File From: Tyler Conley Subject: Threatened and Endangered Species Review Date: 12/05/2019 Project: Chanhassen Slope Failure Project Barr Engineering Co. (Barr) has completed a threatened and endangered species desktop review for the Hennepin County Regional Railroad Authority (HCRRRA) Slope Failure Project. The project area consists of 9.58 acres centered on the Minnesota River Bluffs LRT Regional Trail. Located within the City of Chanhassen and City of Eden Prairie Minnesota, Section 23, T1 16W, R23N. Federally listed species are protected by the federal government under the Endangered Species Act and require consideration for projects involving federal permits. State listed species are protected under Minnesota's Endangered and Threatened Species Law and must be considered for state level permitting requirements. The project area was reviewed for federal and state listed species and their associated habitats that may be found in the project area. This desktop review was completed in November 2019 using a combination of data available from the United States Fish and Wildlife Service (USFWS) and the Minnesota Department of Natural Resources (MNDNR). 1.1 Federally listed species The USFWS Information, Planning, and Conservation System (IPaQ identified two federally listed species as occurring within the project area, the northern long-eared bat (Myotic septentrionalis; federally threatened) and the Rusty patched bumble bee (Bombus a((nis; federally endangered). No designated critical habitat for any federally listed species is located within the project area. The northern long-eared bat inhabits caves, mines, and forests. According to the MNDNR, the nearest hibernacula is over 6.7 miles southwest of the project area, and no maternity roost trees have been identified within the vicinity of the project area. To minimize the potential impact on the species tree clearing will be conducted between November 1 and March 31. Therefore, project clearing activites completed prior to April 1, 2020 are anticipated to have no effect on northern long-eared bat. Rusty patched bumble bees are typically found in grasslands with flowering plants from April through October. They are typically nesting in underground and abandoned rodent cavities or clumps of grasses above ground as nesting sites. During the winter months, queens typically overwinter in underground cavities in upland forests dominated by maple -basswood or oak -hickory trees. The project area is located within USFWS designated High Potentail Zone for the rusty patched bumble bee. The USFWS Section 7 guidance recommends USFWS consultation for projects located within the High Potential zone. Ban Engineering Co. 4300 MorketPointe Drive, Suite 200, Minneapolis, MN 55435 952.832.2600 www.barr.com To: File From: Tyler Conley Subject: Threatened and Endangered Species Review Dale: 12/05/2019 Page: 2 1.2 State -listed species Barr Engineering Co. (Barr) has a license agreement (LA -B98) with the MNDNR for access to the Natural Heritage Information System (NHIS) database, which was queried in November 2019 to determine if any rare species could potentially be affected by the proposed Project. Two state -listed species have been previously recorded within the project area; American ginseng (Panax quinque(olius), and smooth rock cress (eoechera loevigafo). In addition, the NHIS database identified five, state -endangered, threatened, special concern or watchlist species have been documented within one mile of the proposed project area (Table 1). Five native plant communities were also noted. Table 1 Rare Species Documented within One Mile of Proposed Project Area According to MNDNR NHIS -�---� Federal Common Name Scientific Name Status State Status Primarily found in oak savanna communities, though it occurs in dry prairies and oak woodlands. Plants show Kitten -tails Besseya bullii N/! Threatened a preference for partial to open light and upper slopes. Some populations exhibit a preference for less xeric north facing slopes in prairie habitats. Soils are most often sandy to gravelly, well -drained soil derived from alluvium or limestone. Smooth Rock Cress Boechera laevigata N/A Special concern Found to occur on slopes in mesic deciduous forests. Lark Sparrow P Chondestes Typically in dry short prairie grasslands in grammacus N/A Special concern areas with sand or gravel spoils with some bare ground and scattered trees. American Ginseng Panax quinquefolius no None Special concern Typically found in well-developed forest soil, mesic loamy soil. Gophersnake Pituophis catenifer Special concern Prefers well -drained, loose sandy and gravel soils. • .••.•.apvuiue: naps./rwww-annstate.mn.us/rsg/index.html Kitten tails is the only state listed threatened species identified within one mile of the project area. Primary habitat for the species consists of oak savanna communities on north facing slopes. No such habitat is present within the project area. The majority of the project area is densely wooded deciduous forest with a southeast facing slope. No dry prairie is present. Therefore it is unlikely for the species to be located within the project area. The remaining state listed species are listed as species of special concern. These species are monitored by the DNR but are not protected under state law. APPENDIX D SHPO Historical/Architectural Resource CR -CHC -049 Memorandum resourceful. naturally. engineering and environmental consultants BARR Technical Memorandum To: Jessica Galatz From: Joel Swenson Subject: SHPO Historical/Architectural Resource CR -CHC -049 Date: 09/15/2015 Project: 23101014.00/004-100 c: Kristin Alstadt As part of finalizing Task 2 and moving into final design, Task 3, the HCRRA (Hennepin County Regional Rail Authority) and the Barr design team needed to understand the existence and extents of any wetlands or fens within HCRRA right-of-way. This would include anything that would impact the design option selected by HCRRA. A preliminary desktop review of the site was performed by Barr staff in February, 2015. A complete wetland delineation was recently performed June 17, 2015. A report summarizing the preliminary and final wetland delineation findings was submitted to the HCRRA in July. In addition to the wetland delineation, the Minnesota State Historical Preservation Office was contacted by Barr staff to perform a database search for potential historical and archaeological resources within this area of Section 25 and 36, of Township 116, Range 23 in the City of Chanhassen within Carver County. According to the SHPO database, a historic feature (CR -CHC -049) is placed south of the landslide as shown on Figure 1(also attached). Figure 1. Historical/Architectural resource database results Barr Engineering Co. 4700 West 77th Sheet, Suite 200, Minneapolis, MN 55435 952.832.2600 www.barr.com To: Jessica Galatz From: Joel Swenson Resource CR -CHC -049 Subject. SHPO Historical/Architectural Dote: 09/15/2015 Paas- 2 The Historic feature is listed as a house (highlighted in yellow in Figure 2). History/Architecture Inventory ]RatZ,SFt.E 6m� m r. wra aq. @ of ar r�wn 6.a. CnrT'T : cavrtoars�: ar6... a1�6n ecu.m.161tco. Mid u6 n usa-srsv iilddiddOa al�;as N 161�Cd Ky I16 n l6 > at�fb DM*,W.65U US1111®aa]OROet 116 U M x1 61, 13, �min iya 615n16tam5 116 n M WM, QQLOY 4mem11AtlYI SHrtltldelpfie 116 U Qg,OB r n6ypA. lid b n m- ma nulc6so �®��6 �6H�dy6mR 116 U X SR''HE Figure 2. Historical/Arcnnecrurar nrvemury To further investigate the potential for cultural resources within the project area or vicinity, Barr staff scheduled a visit to the SHPO office to pull the file for this Inventory Number CR -CHC -049. Upon arriving at the office, it was determined that a file had not been created for this inventory number as of the afternoon of July 10, 2015. Julie Hillenbrand (a grant process facilitator at SHPO) left a voicemail with Barr staff KNA the next morning on July 11, 2015 stating that their independent contractor who they hire to create the files has not provided them with any documentation for this inventory number. Julie and Tom Cinadr (property information/database searches at SHPO) both indicated that they had no idea when they expected to receive files for this inventory number. Chanhassen landslide Repair Project Interim Use Permit Application Prepared on behalf of Hennepin County Regional Railroad Authority Prepared for City of Chanhassen December 2019 Chanhassen Landslide Repair - Interim Use Permit Application List of Figures Figure 1 Site Location Figure 2 LiDAR Map Figure 3 National Wetlands Inventory Map Figure 4 Wetland Delineation Map Figure 5 FEMA Floodplain Map Figure 6 Public Water Inventory Map Figure 7 Water Table Depth Figure 8 Water Table Elevation Figure 9 Well Locations List of Attachments Attachment 1 Proof of Ownership Attachment 2 Landowner List Attachment 3 Construction Design Plans Attachment 4 Draft Specifications for Horizontal Directional Drilling Attachment 5 Joint Application Form for Activities Affecting Water Resources in Minnesota P1MaAMM%IO\2913I014LOna des �n C^a^hot!'e^fY'2RALO4 C�onhosser jppe F'ure Cori'Pb^s\M'ohFies\Pami•."ng\CN o� Cnorho \Chonnofyen'OPJ..o I Introduction This application is prepared to fulfill the City of Chanhassen Interim Use Permit requirements as outlined in the City Code Chapter 7, Article III, Section 7-35. The application is organized to correspond to each numbered item under Section 7-35 (b). Project Description The scope of the project includes landslide repairs on a portion of the Minnesota Bluffs LRT Regional Trail in Chanhassen, MN owned by the Hennepin County Regional Railroad Authority (HCRRA). Two areas will be repaired as part of this project — the north repair area and the south repair area. Project access will be from Highview Drive in Eden Prairie, proceeding southwest along the trail to the site, and also from Flying Cloud Drive through the Moon Valley Aggregate operated property (final access route through Moon Valley Aggregate operated property pending property owner authorization). Landslide repairs in the south repair area will include stabilizing the south slope, repairing the south culvert outlet area and constructing a new storm sewer and drainage ditch to direct water into the repaired area. Plans for redirecting the water were provided to the Lower Minnesota River Watershed District for review and comment on December 12, 2019. The response from the watershed district will be provided to the City upon receipt. Existing trail profile grades will be reduced with the embankment slopes regraded to less steep grades and finished with turf reinforcement mats. The existing damaged concrete headwall will be removed and existing riprap will be salvaged for reuse. The south culvert outlet area will be repaired with riprap, boulder cross vanes, and a stilling basin. Work in the north area will include removal of existing pipe debris, placement of riprap fill on north slope, and abandonment of the existing pipe crossing beneath the trail. Drainage will be rerouted from north pipe area via new buried storm sewer and lined drainage channel, which will discharge to the south culvert outlet area. 2 Interim Use Permit Application Item 1: The name and address of the operator and owner of the land, together with proof of ownership. If the operator and owner are different, both must sign the application. Contact Information Owner. Hennepin County Regional Railroad Authority Mailing Address: 701 4th Ave. S, Suite 400, Minneapolis MN 55415 Contact Person: Jessica Galatz, Project Manager Phone Number: (612) 348-2691 Email: iessica.galatz@henneoin us Alternate Contact Person: Kristine Stehly, Project Engineer Phone Number. (612) 348-6370 Email: kristine.stehlyCalhennepin.us Proof of ownership is provide in Attachment 1. Item 2: The correct legal description of the property where the activity is proposed to occur. All that part of a variable width strip of land in Sections 34, 35, 36 and 25, Township 116, Range 23, Carver County, Minnesota, being former railroad right of way. Subject to existing public roads and highways, and easements of record, if any. Item 3: A certified abstract listing the names of all landowners owning property within 500 feet of the boundary of the property described above. The City of Chanhassen provided the applicant with a list of landowners located within 500 feet of the property boundary on December 2, 2019. Refer to Attachment 2. Item 4: Specifications of the following, using appropriate maps, photographs and surveys: Full project specifications are provided in the construction design plans as Attachment 3. Draft specifications for horizontal directional drilling (HDD) are provided as Attachment 4. Once a final copy of the HDD specifications is available it will be provided to the city. a. Proposed grading plan Refer to the attached construction design plans, sheet G-08 (Attachment 3). b. Proposed stockpile sites Stockpiling will occur in the areas identified as staging areas on plan sheet G-05 (Attachment 3). There is limited space for stockpiling material on the site. The contractor will likely choose to put any excavated material directly in trucks to export from the site and stockpile temporarily stripped topsoil on site. It is likely that material will also need to be imported and stockpiled at the site within the staging areas on plan sheet G-05 (Attachment 3). Imported material will include riprap, granular filter, and topsoil. c. The physical relationship of the proposed designated site to the community and existing development. The project site is located on a portion of the Minnesota Bluffs LRT Regional Trail in the Rice Lake area just north of Flying Cloud Drive. The project will take place on Hennepin County Regional Railroad Authority property. Two repair areas are part of this project — north repair area and south repair area. A gravel pit owned by Moon Valley Aggregate is located southeast of the south repair area. There are no other residential, commercial or industrial developments immediately adjacent to the north and south repair areas. Residential areas are located on either side of the trail in the northeast portion of the project area (Figure 1). The northeast portion of the trail will be used for construction access only. d. Site topography and natural features including location of watercourses and waterbodies. The trail slopes down from the northeast towards the southwest with an approximate elevation of 880 feet at the northeast access point coming down to 830 feet at the south repair area. Topography on either side of the trail is variable but generally downward sloping. Refer to sheet G-08 (Attachment 3) and Figure 2 for elevation contours within the project area. Wetlands are located on either side of the trail along the access with a small percentage located within the construction limits (Figure 3 and 4; sheets G-05 and G- 06, Attachment 3). A small wetland is located northeast of the north repair area outside of the construction limits (Figure 4). A stream channel runs adjacent to the trail from the northeast. The stream channel is outside of the construction limits at the north repair area and flows under the trail via the south culvert in the south repair area (Figure 4). No other waterbodies are located within the project footprint. The site is not within a designated floodplain (Figure 5). A Public Water Inventory basin (unnamed) is located northwest of the access at Highview Drive but is not within project limits and will not be impacted by construction activities (Figure 6). e. The description and quantity of material to be excavated. Excavated material will include soil and riprap. The total estimated quantity of excavated material is: • Excavation — common (non -contaminated material): 19,990 cubic yards • Excavation — special (contaminated soil): 2824 cubic yards The trail lowering portion of the project will require extensive excavation and some of the material on the surface is contaminated. Contaminated soil will be exported offsite to an approved waste disposal facility. No new soil will be needed as the finished grade is much lower than existing grade. f. The depth of water tables throughout the area. Refer to Figures 7 and 8 for water table depths/elevations. Depth to water table is approximately 0 to 25 feet in most of the south repair area, 25 to 75 feet along the trail and, 0 to 25 feet in the north repair area. g. The location and depth of wells and buried garbage, water and fill. There are no public or domestic wells within the project footprint, refer to Figure 8. No buried garbage or fill was identified at the site. Item 5: The purpose of the operation. The purpose of the planned work is to repair landslides along a portion of the Minnesota Bluffs LRT Regional Trail that occurred in 2014. In addition to the landslide repairs, a new storm sewer and drainage channel are proposed to be constructed on the south side of the trail that will drain to the south culvert area. The south culvert will also undergo repairs. The culvert located in the north repair area will be filled and abandoned in place. Item 6: The estimated time required to compete operation. Tree clearing will occur prior to the work required to complete the repairs. In total, construction time is expected to be no greater than ten months. Item 7: Hours and months of operation. Work will occur within regular hours, starting no earlier than 7:00 a.m. and finishing no later than 6:00 p.m. on a daily basis. Work is anticipated to occur between the months of February and December of 2020. Item 8: A tree survey indicating the location and type of all trees over six inches in caliper. In a heavily wooded area only the boundaries of the tree areas must be indicated on the survey. A tree survey was conducted to identify trees over 6 inches in diameter at breast height (dbh). The area within the construction limits is heavily wooded. Collecting individual tree locations was not feasible given that the area is heavily wooded. Instead, a square measuring 2,500 square feet was surveyed in three different locations along the south repair area. On average, about 7 trees at or above 6 inches dbh were identified within the surveyed squares. Tree clearing will take place in areas as necessary within the limits of construction (Attachment 3) and will be avoided to the extent practicable. Trees over 6 inches dbh that are removed during construction will be counted and replanted at a 1:1 ratio within the construction limits during restoration as space allows. Some areas where trees will be removed will not be replanted due to new features being constructed. Refer to sheet R-03 (Attachment 3) for the tree replacement plan. Item 9: An end use landscape plan and interim screening plan for the operation period. The restoration plan is provided in Attachment 3, sheets R-01 through R-04. An interim screening plan is not applicable to this project. Item 10: The plan of operation, including processing, nature of the processing and equipment, location of the plant source of water, disposal of water and reuse of water. Not applicable. Item 11: Travel routes to and from the site and the number and type of trucks that will be used. Access to the north repair area will be from Highview Drive along the trail. An access road will be constructed from Highview Drive for truck and equipment access. An application for a right-of-way permit will be submitted to the City of Eden Prairie once the contractor has been selected and construction dates are finalized. The City of Eden Prairie permit is required to obtained authorization for constructing a temporary access route in the City of Eden Prairie right-of-way. The timeline for submitting the application in late winter/spring of 2020 and the application requirements have been discussed with the City of Eden Prairie. Access to the south repair area will be from Flying Cloud Drive via Moon Valley Aggregate property (pending owner approval). Equipment used will include a backhoe or similar excavator, small bulldozers, light bobcat(s), and trucks to transport personnel, equipment and material. Beyond the direct access routes into the project area, it is anticipated that most construction related traffic would use County Highway 1 and County Highway 61. Item 12: Plans for drainage, erosion and sediment control and dust control. No drainage will occur as part of this project. Erosion and sediment control best management practices (BMPs) are outlined in the storm water pollution prevention plan (SWPPP) included in Attachment 3, sheets C-05 and C-06. Item 13: A restoration plan providing for the orderly and continuing restoration of all disturbed land to a condition equal to or better than that which existed prior to the earth work. Such plan shall illustrate, using photographs, maps and surveys where appropriate, the following: a. The contour of the land prior to excavation and proposed contours after completion of excavation and after completion of restoration. Refer to Figure 2 for current topographic contours and refer to Attachment 3, sheet G-08 for topographic contours after project completion (regraded area along trail modifications). b. Those areas of the site to be used for storage of topsoil and overburden. The site does not currently contain much topsoil. It is anticipated that the contractor will strip what topsoil they can and stockpile it in the staging areas, but most of the topsoil used in site restoration will likely need to be imported. c. A schedule setting forth the timetable for excavation of land lying within the extraction facility. Refer to items 6 and 7 for a schedule of the proposed activities. d. The grade of all slopes after restoration, based upon proposed land uses, and description of the type and quantity of plantings where revegetation is to be conducted. Refer to Attachment 3, sheets G-08 for area that will be regraded and sheets R-01 through R-03 for the restoration plans. The construction area will be re -seeded using MnDOT approved seed mixes. Types of seed mixes are outlined on the restoration plan (sheet R-01, Attachment 3) with a total area to be seeded of up to 7.41 acres. e. The criteria and standards to be used to achieve final restoration as well as intermittent stabilization. Intermittent stabilization will be achieved with the use of erosion and sediment control BMPs. Final restoration will be achieved per the restoration plan (sheet R-01 through R-03, Attachment 3). For further information refer to the SWPPP on sheets C-05 and C-06 (Attachment 3). Item 14: A statement identifying the applicant's program to insure compliance with the permit conditions, method of response to complaints and resolving conflicts that may arise as a result of complaints. HCRRA will obtain coverage under the Minnesota Pollution Control Agency's General Permit for Construction Stormwater. As such, required inspections under that coverage will be completed and will serve as means to oversee compliance with the permit conditions. Conflicts that are brought to the City's attention can be directed to Jessica Galatz (612) 348-2691. Item 15: Unless exempt under Minnesota Rules, an environmental assessment worksheet, if required by the city. Not applicable. Item 16: A wetland alteration permit, if required by the City Code, which shall be processed concurrently with the excavation permit application. Ajoint application form for activities affecting water resources in Minnesota was submitted to the U.S. Army Corps of Engineers and serves to fulfill the city's wetland alteration requirement. It is provided as Attachment 5 for reference. The application materials are supported by field delineations completed in 2015 and 2019. Delineation work was confirmed by the City of Chanhassen's technical evaluation panel, as noted in the attached application materials. v I x v qo k to I Pioneer Tr y� `i'- r . ✓:_ .. � I+ d r E.Pl,eIt Fr. l�. _ ., 0`4 ... � 1 L �. - t r � I Eod0. t'-- tl -• : ] i Or- Ir t �. *, aY' •. a�., ;✓ t' �`.' r f- Y' - .VOge Farm Tr �a { ., It e, s < ♦ , ( r r ate,^ o l5'''Oi' 990'9 Minnesota Bluff Rivers -_ j Municipal Boundary LRT Regional Trail Public Land OConstruction Limits 0 Survey Section County Boundary v I W r� h �j `Settle., Ct. Alf I _I I, VVY 99O^ul` OHM @EM ym9 oa�c ° i O 0 700 Feet Imagery Source, NeorMop, April 2019 Pioneer Tr - i;a ` cf m ' .�. ' -. %• 900 *1,. �• _ .� ba°4 yC- i ..' /O i 6 ExPIolef" a o - • _,d.•... G �l t -�' j` +P lk 4r n;"�c \ �. �1o< `�•. i:'. p.� Ve°PO .�V,oge Fary Tr �A ��• to � �.q O .� � � M I '!A' a . � • f � 1 { y .'', . MY-��,! i ,'� ill '!' 1 � � �• ... ` L 4 .• n EAl 920 ar r �,�QQ •° 0a,0 �ti �860) 820 �' -° ✓ 210 •ta' S � �'�. ,, _ ,,. .. � do(•r''�> _ 1 .� ,�. +1 'q� iC\oma ♦ f gu Ji O Construction Limits LIDAR MAP Minnesota River " Surface Elevation (Carver Co., 2011) 0 700 '•• • •.-Bluffs .• • BARR —\_- 10 -foot Contour _ c - Feet 2 -foot Contour e Imagery Source, NeorMap, Aprd 2019 •r c �r•�Ti 'PUBG �a �,�x..7�'•� PEMCd + .. It I PEMA L la PUBGx •` W - T .�. -, - ---F - t PEMCd . • ne PEM1 PEMC s � �.PUBFd e ,- o '97 PEMCd r �oa9� 5!v'� 993�J - �� �'si•79 a,c^eer `. t a 1 { PFO1C PEMC i i 11UBFl PEMF Fee[ Construction Limits Freshwater Forested/Shrub Wetland eerb'ooµ0 PEMC. n- O Public Land Survey Section (-�:, Freshwater Pond - BARR _ County Boundary � Lake ' • ' •'' �� Wetlands (National Wetlands Inventory) Chanhassen, Minnesota Freshwater Emergent Wetland Imagery Source; NeorMop, April 2079 FIGURE 3 0 E • • f . . •r c �r•�Ti 'PUBG �a �,�x..7�'•� It I L la PUBGx •` .�. PUBGx " rte' v. o '97 Voge Farm Tr .�, r �oa9� 5!v'� 993�J r �oa9� - �� �'si•79 r { PFO1C N o oa i 11UBFl PEMF Fee[ Construction Limits Freshwater Forested/Shrub Wetland n- O Public Land Survey Section (-�:, Freshwater Pond - BARR _ County Boundary � Lake ' • ' •'' �� Wetlands (National Wetlands Inventory) Chanhassen, Minnesota Freshwater Emergent Wetland Imagery Source; NeorMop, April 2079 FIGURE 3 e �* aV •" P AL W. � `3 F;ooeertt , r �y 0 N � N • O Construction Limits WETILAND DELINEATION MAPN Approximate Stream Channel O Minnesota River Bluffs LRT BARR Delineated Wetlands 0 100 ' •. • - • • - • . F� • . Imagery Source' NearMop, Aprd 2019 FIGURE 4 $6- 4T X O 4r Ir W, b Ilk 4s Construction Limits WETLAND DELINEATION MAP 00- Approximate Stream Channel O esota River Bluffs LRT BARR (:�3 Delineated Wetlands 0 100 Chanhassen, Minnesota Feet Imagery Source, NearMap, April 2019 FIGURE 4 .-. 4w'. % V11 41t Vol 4k it O Construction Limits WETLAND DEUNEATIONI MA Approximate Stream Channel O ota River Bluffs LRT BARR C3 Delineated Wetlands 0 100 Chanhassen, Minnesota Feet Imagery Source, NearMap, April 2019 FIGURE 4 '♦� s r ` r. :.t ♦ Ali- �. rh r � - V' C �. 4 Ilk y � t O Construction Limits NWETLAND IDEUNEATION - —♦ Approximate Stream Channel O -River? 0 100 '-.. ..' .. i BARR �♦ Culvert Pipe Minnesota ( Delineated Wetlands Feet Imagery Source,, NeorMop, April 2019 FIGURE 4 S / o l t �r OConstruction Limits O Approximate Stream Channel Minnesota River Bluffs LRT BARR --- 0- Culvert Pipe 0 100 NIEMEN::= ''.. •. .. Chanhassen, Minnesota o Feet Imagery Source; NearMap, April 2019 FIGURE 4 a� t4 •! • S / o l t OConstruction Limits O Approximate Stream Channel Minnesota River Bluffs LRT BARR --- 0- Culvert Pipe 0 100 NIEMEN::= ''.. •. .. Chanhassen, Minnesota o Feet Imagery Source; NearMap, April 2019 FIGURE 4 0 0 700 F O Construction Limits FEMA Flood Hazard OPublic Land Survey SectionSpecial Flood Hazard Area with ® Base Flood Elevation (Zone AE) L----- County Boundary Area of Minimal Flood Hazard (Zone X) v� O 900 \ e �I e� SJ q I � Q � •ffii� J P jr' E4011T,Tr i\ Q� o cc e I Pd qe e 1r jZ 4 9.�0 YW1I • sio\ ^ V/� Ile ege Fa rm g0 n �r� I//��'/ a e�../N• , ' � r X930 J O O O �/J� �r P ✓ � �p e N � A I.' o e 8,e 910 � 'o 9� c 930 T o � 790 O.. Note: N 0 700 j _ Water table elevation data is from the County Atlas Series, Feet COQ Carver County, Atlas C-21, Part B, Plate 6; Minnesota DNR O Construction Limits >10 to 25 Imogery Source; NearMop, Apri11079 WATER DEPTH - Q Public Land Survey Section >25 to 50MinnesotaTABLE River r —j County Boundary >50 to 75 BARRL-- ry Chanhassen, Minnesota Depth to Water Table (ft) Surface Elevation (Carver Co., 2011) = 0 to 10 '-\, 10 -foot Contour FIGURE 7 v�o 900 i ae. } , • ♦ t O s 11 e 010 .9b`n. . ♦ - n - 10 •t � m 0 > Pioneer tr� � 910 9,0 9t0 � o � I _ t, .. •"Z900' � /' � 1.6 e 4 e > ExPtprer Tr epi a 9 Y\.U/ • !� 1l• I •- 2.1•�4���. .• • • * X11 Voge Farm Tr r '>O ICE� I� tet' a r , <920 0 O 2 a0ye g a O d m 'o e' Sattlert Q 830 tl' _ arQ I y30 � o o � c B90 920 t & • \>� 0yo o O I O AC J>O � a/iU� \/ Q _y.. 0/ter/IfIe\00 1 la0 J .n 9P u �1IU, I Note: Gi T90 >so Water table elevation data is from the County Atlas Series, Carver County, Atlas C-21, Part B, Plate 6; Minnesota DNR s N o 700 J Feet �' 6 Imagery Source; NearMap, April 2019 $ ^s ti - O Construction Limits >725 to 750 >875 to 900 Public Land Survey Section >780 to 800 >900 to 925 WATER TABLE ELEVATION MinnesotaRiver BARR�'—" County Boundary >800 to 825 >925 to 950 t""IlllllllllllllllllllllllllI Water Table Elevation (ft MSL) >825 to 850 Surface Elevation (Carver Co., 2011) Chanhassen, Minnesota a - >700 to 725 >850 to 875 '—Ni 10 -foot Contour FIGURE 8 Attachments Attachment 1 Proof of Ownership - Hopkins to Chaska Deed 5754384 Authorization No. 7246 +-� DEED N0. 86511 THE GRANTOR, CHICAGO AND NORTH WESTERN TRANSPORTATION Ul COMPANY , a Del awa ra r.orporat i on, whose principal office is located at 0 o O 165 N. Canal Street, Chicago, Illinois, for the consideration of 0 G 0 TEN AND NO/100 (SIO.n0) DOLLARS, conveys and quittlaims to HENNEPIN 1 1 COUNTY REGIONAL RAILROAD AUTHORITY, a Minnesota political subdivision C! M Ctand local government unit of the State of Minnesota, 2400-A Government Center, Minneapolis, Minnesota 55487, GRANTEE, all interest to the ,.,following described real est.te situated in the Counties of Hennepir r4 r: eland Carver, and the State of Minnesota, to wit: II 1 •� V HENNEPIN COUNTY, MINNESOTA 1 1 N Strips of land of varying widths bein3 part of Grantor's KI n o railroad right of way from Hopkins to Chaska located 1n the " County of Hennepin, State of Minnesota, including :11 of i� Grantor's rights of way and other real property associated therewith, not previously conveyed and not excluded and excepted herein, all as located over, across and unon the following described lands, to wit: Beginning at the South 'g line of Excelsior Avenue in the Southwest Quarter of Section 19, Township 117 North, Range 21 Nest of the Fifth Principal $ C Meridian; thence extending Southwesterly and continuing o 'u across the following described sections: 5 "� TOWNSHIP 117 NORTH, RANGE 21 WEST OF THE FIFTH PRINCIPAL MERIDIAN G I. V Section 19 - Southwest Quarter of L) TOWNSHIP 117 NORTH RANGE 22 NEST OF THE FIFTH PRINCIPAL MERIDIAN n ^ 130 °.; a 8 0 Section 24 - South Half of the Southeast Quarter 4) 0 o O u Section 25 - Northwest Quarter of the Northeast Quarter; (3 p North Half of the Northwest Quarter (Gli Section 26 - East Half of the Northeast Quarter; Government y N d ZZ Lot 4; Government Lot 3; Government Lot 2; Government Lot I Section 27 - Southeast Quarter of the Southeast Quarter !� Section 34 - Northeast Quarter; West Half of the Southeast I Quarter; East Half of the Southwest Quarter t• _ A • TOWNSHIP 116 NORTH RANGE 22 WEST OF THE FIFTH PRINCIPAL MERIDIAN t♦• L1 V� n d' t4tvNC4M Section Section 3 - 4 - Northwest Quarter Southeast Quarter of the Northeast Quarter part of which is described in Certificate of Title •�-. `•� No. 49402; East Half of the Southeast Quarter N Section 9 - Northeast Quarter; West Half of the Southeast O o Quarter; Southwest Quarter a- Section Section 16 - 17 - Northwest Quarter East Half of the Northeast Quarter; Southeast .w. Quarter; Southeast Quarter of the Southwest. quarter } o o d P 0 0 0 Section Section 19 - � Southeast Q Quarter of the Northeast Quarter; 0 o p North Half of the Southeast Quarter; Government M �. N I s} 1 e4 'N •,Section 30 - Lot 3 Government Lot 1; Government Lot 2; Northwest !. Quarter of the Southwest Quarter. }i e4 j --)i CARVER. COUNTY, MINNESOTA ' ;Z: Strips of land of varying width being part of Grantor's 1 railroad right of way from Hopkins to Chaska located in the County of Carver. State of Minnesota, including all of OGO�-. i Page 1 of 4 Pages _ I DEED NO. 86511 Authorization No. 1246 Grantor's rights of way and other real property associated therewith, not previ•r•=sly conveyed and not excluded and excepted herein, t:l as 1—ated over, across and upon the following described lands, to wit: TOWNSHIP 116 NORTH, RANGE 23 NEST OF THE FIFTH PRINCIPAL MERIDIAN Section 25 - Government Lot 3: Southeast Quarter Section 36 - Northwest Quarter of the Northeast Quarter; Northeast Quarter of the Northwest Quarter; Government Lot 3; Government Lot 4 Section 35 - South Half of t.e Northeast Quarter; South Half of the Northwest Quarter; Northwest Quarter of the Southwest Quarter Section 34 - Northeast Quarter of the Southeast Quarter; Northwest Quarter of the Southeast Quarter thence continuing Southwesterly across the Southwest Quarter of the Southeast Quarter of said Section 34, Township 116 North, Range 23 Hest of the Fifth Principal Meridian to Granter's Milepost 32, "ation 1151+40, being a line drawn at right angles to Grantor's original main track center line at a point thereon distant 1,245 feet Southwesterly from its Intersection with the North line of the Southwest Quarter of the Southeast Quarter of said Section All according to the Government Survey thereof. Together with and including all of Grantor's right, title and interest in "as is" condition as of the date of this deed, in and to all bridges and culverts (but not trackage, signal and communication facilities) situated upon said real estate. Subject to: (1) Roads and highways, if any. (2) Covenants, easements, conditions, and restrictions of record. (3) Rights of any government agency, public or quasi -public utilities to occupy said premises for the use and main- tPnanr.P of existing ennduits, sewers, drains, water mains, gas lines, electri, power lir^s, and other utilities, whether or not of record. By the acceptance of this conveyance, the Grantee, for itself and/or its heirs, successors, transferees and assigns, hereby agrees Page 2 of 4 Pages DEED NO. 86511 Authorization No. 7246 to, at its sole cost and expense to take all steps necessary to comply with any and all governmental requirements relating to the conveyance of said real estate, including land subdivision or use requirements and payments for any a..d all transfer taxes or other taxes and fees inci- dt:;tal to the recordation of the deed, except for documentary stamps. In the event Grantee falls .o comply with any such requirement and Grantor is obligated so to comply. then Grantee shall be liable for all costs, fees, expenses, interests and judgments against Grantor, and the same shall constitute a lien against said real estate until full pay- ment by Grantee. Further, this conveyance is made upon the express condition that the Grrntor, its successors and assigns, shall ha;c the right to enter upon the above described real estate, for a period of ninety (90) days (weather permitting) from the date of this conveyance or until June 3C, 1991, whichever is later, within which to remove all railroad tracks and appurtenances thereto, or any signal and communication facilities from said real estate and adjoining real estate. After said removal, Grantor will make the necessary repair of street, roa.l and highway crossing surfaces. The Seller certifies that the Seller does not know of any well, on the described real property.___,_.. .. .. .. ..._. _ FTAT2 DM Til DUE lXnox /�o AND PRIOR TAXES PAID atPr. Of Paorlair Tu a PUmW atwaos 0. V. RLED� NOT REQ. O TRANSFER ENTERED }1'vIEF 14 —1LXTk' FEB 27 1991 FEB ?1 1991 PiDF:;r rn: u= If�IN�Vj "ATY MINN.UT�. 14 XV A— ;A101 CEPUTY DATED this 20th day of December 1990 . Signed, Sealed and Delivered in CHICAGO AND NORTH WESTERN Presence ��o��f:// ,,/( 11 TRANSPORTATION COMPANY ( .CL&: tLLa.... �So dI ,ij DY "^ .'d gi iIAYPfi bt"'6"'t1 7—r• 1 ,t Attest ` m o ANNE E. REAT1 �' 11 i'�%I/lits �'�• Page 3 of 4 Pages STATE OF ILLINOIS) COUNTY OF f. 0 0 K Ss 1, RICHARD S. KENNERLEY, a Notary Public duly commissioned and qualified in and for the County and State aforesa'.d, 00 HEREBY CERTIFY that RICHARD 0. TAYLOR an^ ANNE E. KEATING , to me personally known and known to me to be, respectively, Vice President. and Assistant Secretary of CHICAGO AND NORTH WESTERN TRANSPORTATION COMPANY, a Delaware corporation, and the identical persons whose names are subscrib.:d to the foregoing instrument, appeared before me this day in person, and being first duly sworn by me, severally acknowledged to me that they are, respectively, Vice President and Assistant Secretary of said corporation; that as such officers they signed, sealed and delivered said instrument in behalf of said corporation by authority and order of it:; Board of Directors, as the free and voluntary act and deed of said corporation, and as their own free and voluntary act; that the seal affixed to said instrument is the seal of said corporation; and that said corporation executed said instrument for the uses and purposes therein set forth. IN WITNESS WHEREOF, I have hereunto set my hand and affixed my official seal as such Notary Public, at Chicago, Illinois, this 20th day of December 1990. ornn.tauL nvy mown S. KDBAIUY Not y Pub in and for the ""Aar ruwc ltara or aLM of ook, In the Stat of I1 nois MY mi.rsla m. Nov. 1"m RICHARD S. K NERLEY My Commission Expires: November 8, 1992 Sou//�r..��f S%tef Ltre/ /f✓✓a /'n nffA>< CCN �/^ Nn S.T4,67-O0/(b (IH ✓Pl 44 763) This instrument was prepared by .Chicago and North Western Transporta- tion Company, 165 North Canal Street, Chicago, Il llnois 60606. L-171-17 Page 4 of 4 Pages 5754338.1 128FE09115!39 C5754384 CON $5.00 12SFE89115:39 C5754384 DOC $10.00 i crz :I:;:,xtrncm[.R URIfSC:F:[PP.; 5ro ct; iJ'!I:rll:�l 91 FEB 29 PH 3: 40 c ruv:'xt K%54 ^8` u rt.xl.u.ntx Dai 'rYQ&�J' Attachment Chanhassen Landslide Repair— Interim Use Permit Application LANDOWNER LIST- provided by City of Chanhassen 12-2-19 PIN TAX—NAME TAX—ADD Ll TAX_ADD_1-2 SITEADD 254090030 MATTHEW J CHRISTENSEN 10 PIONEER TRL CHANHASSEN, MN 553178627 10 PIONEER TRL 257560410 JOE MORRISON 100 8TH AVE S UNIT 106 HOPKINS, MN 55343- 10029 TRAILS END RD 253350020 SUSAN V RECH 1000 HESSE FARM RD CHASKA, MN 553189520 1000 HESSE FARM RD 257560390 TINA RISCH 10005 TRAILS END RD CHANHASSEN, MN 553174594 10005 TRAILS END RD 253350030 JOHN D & BARBARA J FORCE 1001 HESSE FARM RD CHASKA, MN 553189527 1001 HESSE FARM RD 257560130 CHRISTOPHER & MICHELE A 1 FAZI 10012 TRAILS END RD CHANHASSEN, MN 553174594 10012 TRAILS END RD 2575604001 DANIEL JOST 10017 TRAILS END RD CHANHASSEN, MN 553174594 10017 TRAILS END RD 253350010 PAUL W & SUSAN M ALLEN 1002 HESSE FARM RD CHASKA, MN 553189520 1002 HESSE FARM RD 257560140 JUDY E MANEY TRUST 10024 TRAILS END RD CHANHASSEN, MN 553174594 10024 TRAILS END RD 257560150 STACEY M BURROUGHS REV TRUST 10036 TRAILS END RD CHANHASSEN, MN 55317 10036 TRAILS END RD 257560160 MICHAEL KANE 10048 TRAILS END RD CHANHASSEN, MN 553174594 10048 TRAILS END RD 257560420 HEATHER HOLLAND NEUBAUER 10053 TRAILS END RD CHANHASSEN, MN 55317 10053 TRAILS END RD 257560170 MATTHEW T KEEN 10060 TRAILS END RUN CHANHASSEN, MN 55317 10060 TRAILS END RD 257560430 WILLIAM & ELIZABETH PETA 10065 TRAILS END RD CHANHASSEN, MN 553174594 10065 TRAILS END RD 257560180 CHRISTOPHER & ERIN WETMORE TRUSTS 10072 TRAILS END RD CHANHASSEN, MN 553174594 10072 TRAILS END RD 257560440 PAUL A & SHERYL A CARLSON 10077 TRAILS END RD CHANHASSEN, MN 553174594 10077 TRAILS END RD 257560190 SCOTT ANSETH 10084 TRAILS END RD CHANHASSEN, MN 553174594 10084 TRAILS END RD 257560200 DANIEL W ABERCROMBIE 10096TRAILS END RD CHANHASSEN, MN 553174594 10096 TRAILS END RD 257560500 SETTLERS WEST LP 10096 TRAILS END RD CHANHASSEN, MN 553174594 9841 TRAILS END RD 257560210 PHILIPPE 0 SCHWOB 10112 TRAILS END RD CHANHASSEN, MN 553174593 10112 TRAILS END RD 253300100 RUSSELL A LEIGHTON JR 1025 HESSE FARM RD CHASKA, MN 553189527 1025 HESSE FARM RD 253320160 MARY E BRIOL 10377 HEIDI LN CHASKA, MN 553189516 10377 HEIDI LN 253320270 MICHAEL PARADIS REV TRUST 10421 BLUFF CIR CHASKA, MN 553189534 10421 BLUFF CIR 253320230 BEVERLY 1 ZIMMER 10440 BLUFF CIR CHASKA, MN 55318 10440 BLUFF CIR 253320250 SCOTT LINDBLAD 10441 BLUFF CIR CHASKA, MN 553189534 10441 BLUFF CIR 253320240 WILLIAM N DECOULOS 10460 BLUFF CIR CHASKA, MN 553189534 10460 BLUFF CIR 257420120 ELIZABETH M VOGEL REV TRUST 105 PIONEER TR CHANHASSEN, MN 553178660 105 PIONEER TRL 253300110 KEVIN E & JANET S WINTER 1075 HESSE FARM RD CHASKA, MN 553189527 1075 HESSE FARM RD 254090010 BRYAN & ANGELA MALONEY LIV TRUST 108 PIONEER TRL CHANHASSEN, MN 553178659 108 PIONEER TRL 253300120 NANCY MADSEN REV TRUST 1101 HESSE FARM RD CHASKA, MN 553189526 1101 HESSE FARM RD 250360700 BEATRICE I ZWIERS IRREV TRUST 11111 DEUCE RD ELKO, MN 55020-9591 220 FLYING CLOUD DR 250360200 MOON VALLEY AGGREGATES INC 11111 DEUCE RD ELKO, MN 55020 100 FLYING CLOUD DR 250350800 GORAN PUDIC 1161 BLUFF CREEK DR CHASKA, MN 55318 1161 BLUFF CREEK DR 250350700 ALAN L10NGERIUS 1190 BLUFF CREEK DR CHASKA, MN 553189515 1190 BLUFF CREEK DR 253300140 LEO RICHARD DEE & KAREN COUGHLIN DEE TRS 1201 HESSE FARM CIR CHASKA, MN 553189518 1201 HESSE FARM CIR 253320260 MAREN DVORAK 1221 BLUFF CREEK DR CHASKA, MN 553189515 11221 BLUFF CREEK DR 253300150 BRIAN JAY BIELKE 1225 HESSE FARM CIR CHASKA, MN 55318 1225 HESSE FARM CIR 253250050 JEFFREY M GOOD 1231 BLUFF CREEK DR CHASKA, MN 553189515 1231 BLUFF CREEK DR 253250040 THOMAS GNANAPRAGASAM 1251 BLUFF CREEK DR CHASKA, MN 55318 11251 BLUFF CREEK DR 253300160 MAUREEN ANN GRAZZINI TRUST 253250030 NICHOLAS WARITZ 257980010 P R KELLY PROPERTIES LLC 250350500 HEIDIR MOE 3.01162E+12 JOSH & JULIE TAYLOR 250351810 SKIP S COOK 250250800 WILLIAM C GRIFFITH 250360100 RILEY PURGATORY BLF CRK WS 3.01162E+12RYAN & HEATHER ZICK 3.01162E+12 WESTON T & LARUA K ROPER 3.01162E+12 I GREGORY & COLLEEN WEBER 3.01162E+121 MICHAEL & CARIN VIERTEL 3.01 3.01 3.01 7 JEFFREY V & JENNIFER 1 JIOVANj RICHARD 1 & SUSAN J LANAHAN WILLIAM & PATRICIA BARTRAM RUSSELL J BARTO II DAN & VALERIE TESTER STEVEN JON & ANGELA S SMITH MAX LAUREANO RUSSELL & YVONNE BARTO RUSSELLJ &YVONNE LBARTO MATHEW JOHNSON KEVIN FALCONER WANDA SYNSTELIEN CHARLIE D HAZZARD 4LVIN R LEBENS MICHAEL S SPIESS FE OF MINNESOTA - DNR REAL ESTATE HOLDINGS LLC tTIN K & KATHLEEN M SCHUI THER LYNN SILVA ISTOPHER R KNUTSON N C SCHWANKE FLYING CLOUD LLC ES A & BONNIE B SWANSEN Chanhassen Landslide Repair— Interim Use Permit Application LANDOWNER LIST - provided by City of Chanhassen 12-2-19 HESSE FARM CIR BLUFF CREEK DR 1510 MIDWAY LN 15506 VILLAGE WOODS DR 185 PIONEER TRL 18681 LAKE DR E 18936 EXPLORER TR 18945 EXPLORER TR 56 VOGEL FARM TR 30 VOGEL FARM TR 14 VOGEL FARM TR 3 WOODSTONE LN FLYING CLOUD DR FLYING CLOUD DR FLYING CLOUD DR 6TH ST S SW STREE LAKOTA LN LAKOTA LN FLYING CLOUD DR LAKOTA LN LAFAYETTE RD PLEASANTVIEV LAKOTA LN LAKOTA LN FLYING CLOUD DR LAKOTA LN 4TH AVE S SUITE 4 i uammnm aur u A, KE, MN 55372 - MN 55318951' PRAIRIE, MN 55347-1439 HASSEN, MN 553178660 HASSEN, MN 55317 PRAIRIE MN 55347 PRAIRIE MN 55347 PRAIRIE MN 55347 PRAIRIE MN 55347 PRAIRIE MN 55347 PRAIRIE MN 55347 RIA, MN 55386-963! ;A, MN 55318-9532 ;A. MN 553189532 MN 553189457 MN 55318 MN 553189457 MN 553189533 MN 55318 MN 553189533 MN 55318 MN 55155-4045 5SEN, MN 55317 MN 553189453 MN 553189456 MN 553189502 N : MN 1251 HESSE FARM CIR 1271 BLUFF CREEK DR 550 FLYING CLOUD DR 1201 BLUFF CREEK DR 19018 VOGEL FARM TR 10551 GREAT PLAINS BI 18936 EXPLORER TR 18945 EXPLORER TR 18948 EXPLORER TR 18957 EXPLORER TR 19042 VOGEL FARM TR 19066 VOGEL FARM TR 19090 VOGEL FARM TR 19114 VOGEL FARM TR 410 LAKOTA LN 230 FLYING CLOUD DR LAKOTA LN LAKOTA LN LAKOTA LN LAKOTA LN FLYING CLOUD DR FLYING CLOUD DR FLYING CLOUD DR LAKOTA LN W LAKOTA LN FLYING CLOUD DR LAKOTA LN Chanhassen Landslide Repair— Interim Use Permit Application LANDOWNER LIST- provided by City of Chanhassen 12-2-19 3.01162E+12 CITY OF EDEN PRAIRIE 8080 MITCHELL RD EDEN PRAIRIE MN 55344 61 ADDRESS UNASSIGNED 250351710 HAGEN LAWN & LANDSCAPE LLC 850 FLYING CLOUD DR CHASKA, MN 553189503 850 FLYING CLOUD DR 3.01162E+12 MARK W & SUZAN R KAMMER 9600 HIGHVIEW DR EDEN PRAIRIE MN 55347 9600 HIGHVIEW DR 257420110 JONATHAN P & JOANN DIMINO 9751 MEADOWLARK LN CHANHASSEN, MN 553178826 9751 MEADOWLARK LN 3.01162E+12 KARL REYNOLDS & CHRISTI HART 9800 TRAILS END RD EDEN PRAIRIE MN 55347 9800 TRAILS END RD 3.01162E+12 THOMAS A & KELLY A HOPPER 9805 TRAILS END RD EDEN PRAIRIE MN 55347 9805 TRAILS END RD 3.01162E+12 KRISTA A HAYEK & PETER N WHITE IV 9812 TRAILS END RD EDEN PRAIRIE MN 55347 9812 TRAILS END RD 3.01162E+12 MICHAEL & AMY RUETZ 9817 TRAILS END RD EDEN PRAIRIE MN 55347 9817 TRAILS END RD 252640160 NATHAN H GRIFFITHS 9821 DEERBROOK DR CHANHASSEN, MN 553178550 9821 DEERBROOK DR 3.01162E+12 JEFFREY J HOLM & JENNIFER EKEREN-HOLM 9824 TRAILS END RD EDEN PRAIRIE MN 55347 9824 TRAILS END RD 257560010 MICHAEL A & CHRISTINE M MANNO 9836 TRAILS END RD CHANHASSEN, MN 553174591 9836 TRAILS END RD 252640150 TRUST AGREEMENT OF RICHARD & CATHERINE M 9841 DEERBROOK CHANHASSEN, MN 553178550 9841 DEERBROOK DR 257560020 DANIELS LAUN 9848 TRAILS END RD CHANHASSEN, MN 553174591 9848 TRAILS END RD 257560300 SCOTT LAUERMAN 9853 TRAILS END RD CHANHASSEN, MN 553174591 9853 TRAILS END RD 257560030 SARAH 1 BREIT 9860 TRAILS END RD CHANHASSEN, MN 55317 9860 TRAILS END RD 252640140 ANN K LONSTEIN REVOCABLE TRUST 9861 DEERBROOK DR CHANHASSEN, MN 553178550 9861 DEERBROOK DR 257560040 JASON BURLAGE 9872 TRAILS END RD CHANHASSEN, MN 55317 9872 TRAILS END RD 252640130 JOHN M & LINDA REVIER 9881 DEERBROOK DR CHANHASSEN, MN 553178550 9881 DEERBROOK DR 252640120 RYAN & COURTNEY DUNLAY 9901 DEERBROOK DR CHANHASSEN, MN 553178552 9901 DEERBROOK DR 257560310 AJEFFREY KARSCHNIK 9905 TRAILS END RD CHANHASSEN, MN 55317 9905 TRAILS END RD 257560050 JARED JOHN GRUNIG 9912 TRAILS END RD CHANHASSEN, MN 55317 9912 TRAILS END RD 257560320 ELIZABETH A FARRELL 9917 TRAILS END RD CHANHASSEN, MN 55317 9917 TRAILS END RD 252640110 KIRK D HEISSEL 9921 DEERBROOK DR CHANHASSEN, MN 55317 9921 DEERBROOK DR 257560060 JASON EMMETT 9924 TRAILS END RD CHANHASSEN, MN 55317 9924 TRAILS END RD 257560330 LENNARTJ JOHNSON 9929 TRAILS END RD CHANHASSEN, MN 553174592 9929TRAILS END RD 257560070 WILLIAM J ROUSE 9936 TRAILS END RD CHANHASSEN, MN 553174592 9936 TRAILS END RD 252640100 ROSS L HABBEN 9941 DEERBROOK DR CHANHASSEN, MN 55317 9941 DEERBROOK DR 257560340 JON FRANSWAY 9941 TRAILS END RD CHANHASSEN, MN 553174592 9941 TRAILS END RD 257560080 STEVEN C KIMES 9948 TRAILS END RD CHANHASSEN, MN 553174592 9948 TRAILS END RD 257560350 ROBERT G DAUB REV TRUST 9953 TRAILS END RD CHANHASSEN, MN 553174592 9953 TRAILS END RD 257560090 XIANGDONG LIN 9960 TRAILS END RD CHANHASSEN, MN 553174592 9960 TRAILS END RD 252640090 JENNIFER M PALMQUIST 9961 DEERBROOK DR CHANHASSEN, MN 553178552 9961 DEERBROOK DR 257560360 CHRISTOPHER C ATTERBERRY 9965 TRAILS END RD CHANHASSEN, MN 553174592 9965 TRAILS END RD 257560100 JAMES DOBCHUK 9972 TRAILS END RD CHANHASSEN, MN 553174592 9972 TRAILS END RD 257560370 STEVEN R PASCHKE 9977 TRAILS END RD CHANHASSEN, MN 553174592 9977 TRAILS END RD 252640070 PAULJ TAUNTON 9980 DEERBROOK DR CHANHASSEN, MN 553178551 9980 DEERBROOK DR 252640080 JIMMY M & MARY E ROANE 9981 DEERBROOK DR CHANHASSEN, MN 55317 19981 DEERBROOK DR 257560110 RANDALLS & MELODEE D BROOKS 9984 TRAILS END RD CHANHASSEN, MN 553174592 19984 TRAILS END RD 257560380 MATTHEW 1 WILLIAMS 9989 TRAILS END RD CHANHASSEN, MN 55317 19989 TRAILS END RD 257560120 RICHARD BARBARI 9996 TRAILS END RD CHANHASSEN, MN 553174592 9996 TRAI LS END RD Chanhassen Landslide Repair—Interim Use Permit Application LANDOWNER LIST - provided by City of Chanhassen 12-2-19 256010020 PCH DEVELOPMENT LLC I PO BOX 94 SHAKOPEE, MN 55379 110520 GREAT PLAINS BLVD Attachment 3 Construction Design Plans MINNESOTA BLUFFS LRT REGIONAL TRAIL LANDSLIDE REPAIRS MINNESOTA COUNTY MAP CONTACTS: ENGINEERCOMALT: Mae PeYmn Ban ENYeNYNCo. 4300 LlerfelPaiM p. M'nsryW.LN 55x35 9528tt3BNI nOeYvgEsr.mm S�+TA4T_' Hm C MIF Lang -n PaivgE qutlonly 101 FouN. 5.. 15 4W 612 p b.MN 5$415 513318-3191 Jetau.GaFtr®lanepnm -'Ll7 GOPHER;.: STATZ UBE —Allcm GOPHER STATE ONE CALL. GILL BEFORE YOU DIG. 1JIOD-252-1166 REVISION HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY (HCRRA) % ATION IUNTY _N, MN. RNE61r0tf/. RFIEAR® n e G u u T6Fd1 MTE RELEASED 1 PLAN: PROJECT LOCATION 0 545 +aao N BLALE IN EEEf B R ENGNEERING CO. 43 MMKETPOINTE GRNE MINNEAPOLIS 0 APOLIS. MN 55135 11.1 11 F..IN.:.ma� HCRRA MINNEAPOLIS, MN INDEX OF SHEETS G-01 _ TITLE SHEET, PROJECT LOCATION, AND SHEET INDEX G-02 .... LEGEND, NOTES, ABBREVIATIONS, AND ALIGNMENT CONTROL DATA G-03 .... STATEMENT OF ESTIMATED QUANTITIES G-04 .... SITE ACCESS, STAGING, AND TRAFFIC CONTROL - OVERALL PLAN AND NOTES G-05 .... SITE ACCESS, STAGING, AND TRAFFIC CONTROL - PLANS G-06 .... SITE ACCESS, STAGING, AND TRAFFIC CONTROL - PLAN AND DETAILS G-07 .... TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY G-08 .... PROJECT LAYOUT PLAN C-01 .... EXISTING CONDITIONS - PLAN C-02 .... EXISTING CONDITIONS - PHOTOS C-03 .... REMOVALS AND TEMPORARY EROSION CONTROL PLAN C-04 .... TEMPORARY EROSION CONTROL DETAILS C-05 .... STORM WATER POLLUTION PREVENTION PLAN (SWPPP) C-06 ---- STORM WATER POLLUTION PREVENTION PLAN(SWPPP) C-07 .... TRAIL MODIFICATIONS - PLAN AND PROFILE C-08 .... TRAIL MODIFICATIONS - CROSS SECTIONS C-09 .... TRAIL MC DIFICATIONS - CROSS SECTIONS 610.... TRAIL MODIFICATIONS - TYPICAL SECTIONS 611 .... SOUTH AREA SLOPE REPAIR - PLAN 612 .... SOUTH AREA SLOPE REPAIR - SECTIONS 613 .... SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR - PLAN 614 .... SOUTH AREA CULVERT OUTLET REPAIR - PROFILE AND SECTIONS 615 .... SOUTH AREA CULVERT OUTLET REPAIR - SECTIONS AND DETAILS C-16 .... STREAMBANK REPAIR - DETAIL C-17 .... NORTH AREA SLOPE REPAIR - PLAN 618 .... NORTH AREA SLOPE REPAIR - PROFILE, SECTION, AND DETAIL C-19 .... STORM SEWER AND DRAINAGE CHANNEL - PLAN AND PROFILE C-20 .... STORM SEWER AND DRAINAGE CHANNEL - SECTIONS AND DETAILS 621 .... STORM SEWER AND DRAINAGE CHANNEL - SECTIONS AND DETAILS R-01 .... SEEDING PLAN R-02 .... EROSION CONTROL BLANKET AND MULCH PLAN R-03 .... TREE PLANTING PLAN R-04 .... RESTORATION DETAILS GENERAL NOTES: 1. TOPOGRAPHIC SURVEY INFORMATION SHOWN IN THIS PLM SET IS A COMBINATION OF DATA FROM: SURVEY CONDUCTED BY BMR ENGINEERING CO. IN JANUARY 2015, SURVEY CONDUCTED BY STONEBROOKE IN JANUARY 2019 AND MDDNR 2011 UDM TOPOGRAPHY, 2. IMAGERY: COPYRIGHT PICTOMETRY INTERNATIONAL CORP AND HENNEPIN COUNTY, MINNESOTA 2015. 3. HORIZONTAL DATUM AND COORDINATE SYSTEM: CARVER COUNTY COORDINATES, NAM HARN, US SURVEY FEET. 4. VERTICAL DATUM: NGVD29. LANDSLIDE REPAIRS CHANHASSEN,MN TITLE SHEET, PROJECT LOCATION, AND SHEETINDEX 90% DESIGN NOT MI Z ONSTRU00N LEGEND ABBREVIATIONS --790-- EXISTING INDEX CONTOUR --788--- EXISTING INTERMEDIATE CONTOUR 0 sat EXISTING PARCEL LINE -55 EXISTING STORM SEWER - FO - EXISTING FIBER OPTIC - x EXISTING FENCE LINE O EXISTING CONSERVATION EASEMENT I.E. EXISTING STREAM THALWEG MH EXISTING STREAM EXTENTS -MITI- EXISTING WETLAND - - - - - - - CONSTRUCTION LIMITS -790- PROPOSED INDEX CONTOUR -TOO- PROPOSED INTERMEDIATE CONTOUR -6- PROPOSED STORM SEWER -X - PROPOSED FENCE - - - - CLEARING LIMITS Mlm.03 SILT FENCE 124.6 PROPOSED RIPRAP 55811321 STAGING AREA 0 W-1 2015WILBORING 0 K-1 EXISTING PIEZOMETER 0 sat M18 SOIL BORING S ST -7 2019 SOIL BORING REVISION CB CATCH BASIN CLP. CAST -IN-PLACE CLEM CONTROLLED LOW STRENGTH MATERIALS CMP CORRUGATED METAL PIPE CONC. CONCRETE EL. ELEVATION FES FLARED END SECTION I.E. INVERT ELEVATION MH MANHOLE MnDOT MINNESOTA DEPARTMENT OF TRANSPORTATION NWL NORMAL WATER LEVEL RCP REINFORCED CONCRETE PIPE TRM TURF REINFORCEMENT MAT CMPA CORRUGATED METAL PIPE MCH SYMBOLS LIMITS OF SUCTION Q/Tl SEC!/ON /DEMI£IER 1 31.42/04. %FEREACBS 10 94Ei 4Cl�W 6 IL410 UI SECTION VIEW CALL OUT SAMION IDENTIFIER (TMP.) 1 SECTION: GRAPHICS STANDARDS t SCAlP 1=t SMTMN %£E%,4065 ITYP.) '"" sFsnox is rru3n-em ON SECTION VIEW TITLE DETAIL IDENTLFIER 1 10 DETAIL REFS%4.095 9R R:Y 6 158]10 UII DETAIL VIEW CALL OUT DETAIL IDENTIFIER (TMP.) DETAIL: GRAPHICS STANDARDS 10 SCALE 1-1 DETAIL REFE%AeES (TTP.) SMR/ DEAL 5 WEO-O7f p 1. CONTRACTOR SHALL LOCATE AND FIELD VERIFY ALL EXISTING UTILITIES PRIOR TO WORK. 2. ALL EXISTING ROADS. PARKING LOTS. TRAILS, SIGNS, OR SIMILAR SHALL NOT BE DISTURBED DURING CONSTRUCTION. CONTRACTOR SHALL COORDINATE SURVEYS WITH THE ENGINEER TO DOCUMENT PRE-OONSTRUCTION EXISTING CONDITION ISSUES. 3. CONTRACTOR SHALL INSTALL AND MAINTAIN ALL EROSION CONTROL SNIPS PRIOR TO COMMENCEMENT OF GRADING FOR EACH LOCATION DURING CONSTRUCTION. EROSION CONTROL PLANS ARE PROVIDED INSIDE THE PROJECT STORMWATER POLLUTION PREVENTION PLAN ISWPPPI. 4. CONSTRUCTION UMRS AS SHOWN ME APPROXIMATE FINAL CONSTRUCTION UMITS TO BE COORDINATED WITH THE OWNER AND STAKED IN THE FIELD - 5. CLEARING AND GRUBBING TO BE PERFORMED ONLY WITHIN GRADING LIMITS AND ACCESS ROUTES UNLESS OTHERWISE DIRECTED BY ENGINEER. 6. TREES TO BE CLEARED WILL BE MARKED IN THE FIELD BY ENGINEER. ALL TREES -8'IN DIAMETER NOT MARKED FOR REMOVAL SHALL BE PROTECTED. 7. TREES IDENTIFIED BY ENGINEER FOR ADDITIONAL PROTECTION SHALL BE PROTECTED AGAINST ROOT COMPACTION, DAMAGE AND DISFIGUREMENT IN ACCORDANCE WITH MnDOT SPEC. 2572. PROTECTION OF TREES NOT IDENTIFIED TO BE REMOVED SHALL BE INCIDENTAL. B. CONTRACTOR SHALL TAKE PRECAUTIONS TO MINIMIZE THE TRANSFER OF AQUATIC AND TERRESTRIAL INVASIVE SPECIES TO THE MAXIMUM EXTENT POSSIBLE. NYTHIixNeN.�'1�1�iew 6� mrtff w43gA BEIFA9ED w e v u u TOTOIi RATE RHEAS® flNlR ENGINEERING CO. 4358 MANNEIPOINIE MME wmMNNEMOLIs. MN 55435 ALIGNMENT CONTROL DATA '.. NORTH AREA SLOPE REPAIR CONTROL DATA - ALIGNMENT -N' SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR CONTROL DATA - ALIGNMENT -C. TRAIL MODIFICATIONS CONTROL DATA - ALIGNMENT T TYPEBJG. STMT STATION STMT NORTHING TYPFJND. START STATION STARTNORTHING START EASTING BEARING LENGTH RADIUS M STATKXB PT STATION END STATION END NORTHING END EASTING L1 OMOIUT 154001,42 501528.73 5621WA7 IM.w 16624129 5580Mm 1 O.Wi 1&BE940 Y15Wm L2 158 = 164969A0 Mlm.03 1H033. 124.6 165161.70 55811321 ;.7 185W1.In 50124.37 Gt 2.74mT 15599193 MIMV WIW14T 143.6T 109)m N24mT 4.18327 4-1832T 166199.M 581819.41 L1 4.1522T 1M199.65 M1818.M 2.67.490 199.58 185115m 582587.34 6584.622 18535834 581994.04 p W7W 105358.34 581934.04 N30WIT Blm 1M m Bg2mT 6eM92T 6N8.92T 1584,439 M1002.54 L4 6r96.92T IMCNiY 581992.54 11085 PM ITT 185502.13 SM002.41 C3 84.110'm 15.558213 583167,41 N4V85'1TE 58.6 158410 Bg9m amAsT 8K3,467 INN,13 562121.28 LS B AST 18858.13 ME2128 30834' 12581.612 1 16581029 582309m '.. NORTH AREA SLOPE REPAIR CONTROL DATA - ALIGNMENT -N' SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR CONTROL DATA - ALIGNMENT -C. TYPEBJG. STMT STATION STMT NORTHING START FASTING BEARING LENGTH RADIUS PC STATION PT STATION END STATION END NORTHING END EASTING Lt OHBmC 155305.23 5101mlo MKYN .'3E BeID 14.709 16539!.40 5621WA7 0588.MC 16624129 5580Mm p 0585mC 1654.1,4 M36m 911tl4' £ S1.M' 2M.CP OMS.BSC 1H033. 1+50.$ 165161.70 55811321 m 1.M.m 185161.71 58211321 sl7 m 36.19 Bib 1H .AG iM6mc 1MBmc 161Z7m 558158.49 p 1588.SBC 18512/.58 582158.49 578'9917'W 58.6 35.9)' 1� 580 2.67.490 2.32.434 185115m 582587.34 '.. NORTH AREA SLOPE REPAIR CONTROL DATA - ALIGNMENT -N' DRAINAGE CHANNEL AND STORM SEWER CONTROL DATA -ALIGNMENT'S' TYPEE20. START STATION START NORTHING START EASTING BEARING LENGTH RADIUS PC STATION PT STATION END STATION END NORTHING END EASTB/G L1 0580.(ON 158115.58 558321,4194 558'21314 M2T OHT17N tM109.49 58212i.Q u 0 .m 163109.48 SSNE/IA3 380V11i)'E 142.24 4.00804. 158058.19 552551.58 '.. DRAINAGE CHANNEL AND STORM SEWER CONTROL DATA -ALIGNMENT'S' TYPEINO. START STATION START NORTHING STMT EASTING BEARING LENGTH RADIUS M STATION PT STATION EFA STATION ENO NORTHMG END EASTING L1 04.X1.008 184711m 562110.9) 4.3 --404 147.6 14.709 16539!.40 5621WA7 C1 14.7859 11511.40 552158,44 NN9T MAT 45880 1587858 1.58.148 1582145 155`24.41 5800738 L2 1582.145 165/24,43 582107.% 414'3R3'E 132,48' 3.15213 15. 33 59 m m 3luls IM&MM 5924.0.32 4.249192E 3234 19)m 3+15215 347.525 247825 16551 55225341 L1 347m8 155852.74 58229.41 1 4!5484 150.47 4.97.585 1551(gm 56265.81 L4 "7.935 1854.558 5021450 N'N9949E 30982 80/.795 18.875.17 58 .21 M 6582.758 1B l? 56249371 '4M,31RE 5209 8580879 185840.99 56243.58 LITP2 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN, MN LEGEND, NOTES, ABBREVIATIONS, AND ALIGNMENT CONTROL DATA 90% DESIGN NOTFORCONSTRUCflON STATEMENT OF ESTIMATED QUANTITIES ITEM NO. ITEM DESCRIPTION UNIT TOTAL ESTIMATED QUANTITY 2021.501 MOBILIZATION LUMP SUM 1 2051.501 MAINTENANCE St RESTORATION OF HAUL ROADS LUMPSUM 1 2101.505 CLEARING ACRE 4.30 2101.505 GRUBBING ACRE 4.30 2104.502 REMOVE CONCRETE HEADWALL EACH I 2104.502 REMOVE PIEZOMETER EACH 2 2104.502 SALVAGE BENCH EACH 1 1 2104.503 REMOVE WOOD RETAINING WALL UNFT 31 2104.503 REMOVE CHAIN LINK FENCE UN FT 2446 2304.503 REMOVE SEWER PIPE (STORM) (NORTH PIPE) UN FT 7 2104.607 SALVAGE RANDOM RIPRAP CUYD 147 2104.601 REMOVE MISCELLANEOUS DEBRIS (NORTH PIPE DEBRIS) LUMP SUM 1 2105.504 GEOTEXTILE FABRIC TYPE 5 SQYD 1616 2205.601 DEWATERING LUMPSUM 1 2305.601 CONSTRUCT ACCESS ROAD LUMPSUM 1 2105.607 EXCAVATION -SPECIAL CUYD 2824 2105.607 HAUL AND DISPOSE OF CONTAMINATED SOIL CUYD 3671 2106.501 EXCAVATION -COMMON CUYD 19,990 2106.523 COMMON EMBANKMENT(CV) CUYD 1809 2112.603 SUBGRADE PREPARATION UN FT 1027 2118.507 AGGREGATE SURFAUNG(M CUSS SPECIAL CUYD 96 3130.523 WATER (DUST CONTROL) MI IS 2211507 AGGREGATE BASE(CV) CLASS 5 ION YD 253 2451.507 COARSE AGGREGATE BEDDING (CV) CUYD 9 2501.502 95' SPAN GS PIPE -ARCH APRON EACH I 2501502 24' CAS PIPE APRON EACH 2 2503.603 24' HOPE PIPE SEWER-OIREC ZONAL DRILLED UN FT 302 2503.603 PLUG FILL AND ABANDON PIPE SEWER UNIT 115 2507.603 LINING CULVERT PIPE (95' SPAN) SPECIAL UN FT 7 2511.504 GEOTEXTILE FILTER, TYPE 4 SQYD 35 25IL507 RANDOM RIPRAP CUSS SPECIAL (SALVAGE) CUYD 147 2511.507 RAN DOM RIPRAP CLASS SPECIAL (mm) CUYD 444 2511.507 RANDOM RIPRAP CLASS SPECIAL (R470) CUYD 540 2511.507 RANDOM RIPRAP CLASS III CUYD 292 2511.507 RANDOM RIPRAP CUSS N cum m 2531.507 GRANULAR FILTER CUYD 101 2511.507 GRANULAR FILTER MOD (B3) cum 405 2511.602 PLACE BOULDER FA[H 20 2557.603 INSTALL CHAIN LINK FENCE UN FT 175 2573.501 STABILIZED CONSTRUCTION D(R WMP SLIM 2 2573.503 SILT FENCE, TYPE MS UN FT 10,422 2574.507 COMMON TOPSOIL BORROW CUYD 1536 2575504 EROSION CONTROL BLANKET CATEGORY 3N SQYD IZ440 2575.504 FLEXIBLE CONCRETE GEOGRID MAT SQYD 1272 2575.504 TU IIF REINFORCEMENT MATCATEGORY2 SQYD 2820 2575.504 MULCH MATERIALTYPE 4 SQYD 10,990 2575.505 SEEDING ACRE 7.41 i�R6 WEL�.1 RELEASED coapt WTEREiFISED M MIN zoo B RENGINEERINGCO. 11(1)20 0.b] MMKELPOINTE DRIVE AINNEMOLIS, MN 55135 MTG2 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN STATEMENT OF ESTIMATED QUANTITIES 90% DESIGN NOT FOR CONSTRUC77ON I 3RE ACGE35 NOTEB: 1 LOCATIONS OF UTILITIES AND OTHER INFRASTRUCTURE IN HIGHVIEWE MEA ME APPROXIMATE. VERIFY LOCATIONS PRIOR TO MOBILIZING TO SITE. CONTMCTORIS RESPDNSIBLE FOR UTILITY LOCATE AND FIELD RECONNAISSANCE. Z PoTENMLgCCE55 p0UfES NiE$HOVIX pITfE PUJIS. IFCCMRACTORWISHESTOUSE M ALTERNATE ACCESS RIXIIE U MUST BE REVIEWED APPROVED BY ENGINEER PRM TO USE. S. TEMPORARY WE LAND FILL IS ONLY ALLOWED IN THE LOCATIONS SHOWN ON THE PLANS. DO NOT PLACE FILL IN WETLMDSDITCHES OUTSIDE OF THESE AREAS. 4. SUMR MATERIAL PROPOSED FOR TEMPORARY FILL TO ENGINEER FON REVIEW. 5 MAMTAW FLOW IN ORCHES AND CONTROL WATER DURING CONSTRUCTION. THIS MAY INVOLVE THE N13TAWTDN OF PIPES AND POTENTIALLY PUMPS. S. THE FOLLOWING ITEMS ME INCIDENTALTO PAY ITEM MH 501 MA ITENMCE B RESTORATION OF HAUL HOMES 6.1. TRIMMING PND CLEARINGTREESIALONCACCESSROUTE 62 FURNISHINGANO INSiAILING GEOTEXTILEFABRIC IN WERAN S 8]. FURNI]HINO PND IN STALLING TEMPORARY FILL IN WETLVIDS 54. CONTROLLING WATER MO MAINTAINING DRAINAGE IN DITCHES THROUGHOUT CONSTRUCTION. 65. PLACEMENT OF ADOITIOI% L FILL ANGOR GRAVEL SURFACING OUTSIDE OF WETU ND AREAS AS CONTRACTOR DEEMS NECESSARY TO ACCESS THE SITE 6.6 REMOVAL OF GEOTEXTILE FABRIC AND TELiORARY FILL FROM WET ANDS UPON THE COMPLETION OF CONSTRUCTION 67. SEEDING IMPACTED WET -MDS UPON THE COMPLETION O CONSTRUCTN]N. 66. REGRADING THE TRAIL FROM HIGHNEW DRIVE TO THE LANDSLIDE UPON COMPLETION OF CONSTRUCTION AND RESTORING THE TRAIL TO PRE -CONSTRUCTION CONDITIONS OR BETTER TO THE EATISFACTICNOFENGMEER. FURNISHING AND INSTALLING AGGREGATE SURFACING SHOWN ON DETAIL S ON SHEET G-0 WILL BE PAD UNDER SEPARATE PAY ITEM 69. ALGOODMATDN,PREPARATION, CONSTRUGTDN. AND RESTORATION ACTIVITIES ASSOCIATED WITH ACCESS THROUGH MOOT VALLEY AGGREGATE AND FROM HIGHVIEW DRIVE. ]. PAYITEM21"WI CONSTRUCT ACCESS ROAD IS PER THE CONSTRUCiDNO M ACCESS MA ROAD FROM HMEW DRIVE TO TIE REGIONAL T/WL AIST EABTOF PIONEER TRAML THE FOLLOWING REMS ARE INCIDENTAL TO PAY REM 210 WN CONSTRUCT ACCE66 RM,, 7"1. UTILITY UO TE MD AVOIDANCE OF UTILITIES IN VICINITY OF ACCESS ROAD. T2 ANYOESIGNNECESSMYFORACCESSROAD. T.R CLEARING AND GRUBBING PRIOR TO CONSTRUCTION OF ACCESS SOME) (IF NECEMVRY), 7A. BALVAGING ANDREINSTALLING MV SIGNS IN CONFLICT WITH ACCESS ROAD. 7.5. PROTECTION OR SALVAGING AND REINSTALLING EXISTING GUARDMIL. TA. SDCFFNG AND STOCKPILING TOPSOIL UNDER FOOTPRINT O i pF NECESSARYL ].T REMOVAL OF BINMINWS PAVEMENT (IF NECESSARY 7d WATER CONTROL, INCLUDING PIPES OR PUMPS TO MAINTAIN DRAINAGE TROUGH ACCESS ROAD DURING CONSTRUCTION. )A. IMPORT OF FILL TO CONSTRUCT ACCESS ROAD. I.% MAINTENANCE OF ACCESS ROAD DURING CONSTRUCTION. 7.11. REMOVAL OF TEMPORARY FILL FOR ACCESS ROAD T.IZ REPAIR OR REPLACEMENT OF MY BITUMINOUS PLACEMENT DAMAGED WPoIIG CONSTRUCTION 7.13, INSTALLING TOPSOIL SEED. AND MULCH ON EROSION CCNTRQ BLANKET TO RESTORE TO PRE CONSTRUCTION CONDITIONS OR BETTER TO THE SATISFACTION OF THE TRAFFIC SIGNS OT1 INGOT SIGN SIZE SIGN MESSAGE DWG. NO. SIGN NO. 3 Wit -10 ]6-.38' GO4 Rxi3A ]6•.36- RAIN aDBEO ME n SAW GOT T caosEO - R114 Y'.M GO6 GOT Ads- ��� •i �j� '+lei , ,�.YLN��� i 4 HALLA GREENS N _a GOLF COURSE 4Ilk 1 ~ F ti Fit � MI ! MNNESOTA BLUFFS LRT REGIONAL TRAIL - v ri •. •AV �s Of 14 ,A& �- III, � S'TE ACCESS FROM HIGHVIEW DRIVE a .. q av .�JtJIA*J7;�IF� Ili DETAILED PLAN •` b w .9dS C `+ i.... sEE A � I -• SOUTH REPAIR AREA. rt' ' ANTTICIPG ATED RIGHT OF ENTRY, ACCESS a • - '' !, f ROUTE TO BE FINALIZED WITH PPOPERT 'OWNER PRIOR TO CO`S•TRUCTGN. MOO EV - - AGGREGATE . � . •�• . . �T1^f1 ..•�'� -\�1 lk Z�M Rae G DD Mae- • • y 4 � S A •+4�Z �l � FI.ILNG OL i 1 PLAN: RALL ACCESS PLAN O 0 3m eBo N .. SCNB N FEET 900 DESIGN _ LANDSLIDE REPAIRS ---....—__.._. GF QIP BMR ENGINEERING CO. 1TH32019 23�()�D�4.(� fM,Fp,MEyoT,. IF 4300 MARI(ETPOINiE DRIVE CHANHASSEN, MN BAJMSuits v HCRRA OIENi PROJECT H=. R M,.mw.•E --MINNEAPOLIS'. MN S&35 A e C D o t 2"w-� P.P..MINNEAPOLIS, MN SITE ACCESS, STAGING, AND TRAFFIC CONTROLN0 MlE REVISION DESCRIPTION L�.gF TOPER MIE RELF/3FD �w•ivn° RR OVERALL PLAN AND NOTES G,aq p _ _ V WSTMG WMOIWL sTABRIZED CONSTRUCTION FRIT. '\ •1 �'. '1 -ME / / (flYOTECTOR SMVAGEARD REN3TN1 C •..K 4_ 9P FOLLOWING LONGrNUCTbNI ♦y/cr � :RREnvrD PYM Y close➢ _ TRAIL i PROTECT E%ISTING j ♦-' CIE LIFT STATION l7 P \ .• 9y,. ti Flir. 'L'c _ PA _ITYP.) a- S -� / -- - Ty LiI EIC RA coasrRWnoUMRsrROVVLINES WETLARDBOrvogav FENCEIX tNE ` \ Trr SITE ACCESS FROM COORDINATE GHVIEW r� 'gT'-Ot_5 MTR Cl oorsDlNnrE AccEss \ "�"�� ofHCRRA WITN CITY OF EDEN PRAIRI- - _ - - PROTECT EXISTING OULVERiS ANDHENNEPINCOUNry_ Oy ww MAINTAIN ORCH SEDACC -„—�n,— �•� '"Y'•'- - "`.THROUGH POSED ACCESS _-MINNESOTA BLUFF RT REGIONAL TRAIL-. 4� • -,I WT e *� ♦_ 11L. . • \ _ 1)B ROAD WRING CONSTRVrTL . t, r RESTORE TRA IL PER C>� UPON COMPLETION OF CONSTRUONION y� / , \ • ` _ _ +e`•• !` S / HCRRA - TEMPORARY WETW1D W I ':ss NG AREA 3V w l)T X r "TA+ .1,%.TRAIL T - .M- 0 1ACRES. SEE Z • e • _ LENGTH - �- _ ._ cwsEO _ REPAIR ORREPLACU -Z BHUMINOUS URAL UPON TgppURY IMPACT J oJ” Sy ` COARETpN OF Doz ACRES. sEE ., Q .. �aG J� CONSTRUCTION SEE 4 N _ TRP - N Ppb. NGO ♦ •r�. '.A'- LosI `. PACCESS a0A0 1 t^ CONSTRUCT ,r• _- �� J •� M ,`i• *y AS EA RY FOR EQUIPMENT ACCESS t' do GE `• � * �#-�•,+fR�i: � + c• .`'?+�� 1. '< . teP e y�cr oA \ 's�, . .. •BIW TRAIL i °fuOSE Gp 1 EXISTING GROUNDN: PLASITE ACCESS & STAGING ° _ _ w ISD- y SGLLE N IFFY ' SCALE .. -- ... _..... — — —_ — Y y RPBNtaAI'wOTMTIw Awx�u AAxn LANDSLIDE REPAIRS ENGINEERING CO. 1}/1YN19 2.'�101014.G'1 p x DR aax MARKFTroINTE DRIVE CHANHASSEN, MN ➢MIS HCRRA wEMr PRONECT w. MINNEAPOLIS, MN SITE ACCESS, STAGING, AND TRAFFIC CONTROL I ®K A B C D D 1 'j MMNNEAfiPOLIS,. MN W135 �M DAG. N,. G-06 -1M?I &,.-:eR, PLAN AND DETAILS D a MD BY DATE REVISION DESCRIPTION y,r TOFOR RATE REEMSED FA ao .& _ _ .one..F ulPz EXIST NORTHVA?1IAI01I1pH EXISTING TRAI E%RTN6 SOUTHVIETWNDDITCN ____ NOTES, m YWIDTN AT IMI i%9LOPE IXI SHONDER. TEMPORARY FILL`INSTALL LhODT TYPESGEOTEXI6E FABRIC PRgR ID SLCGE M:VI AT COMPLETION OF \ TO PLACINGFNLNWERAM OR PREFERREDFORM TREES OR .7 MIN FORM CONSTRUCTION REMWEAT COARETpN CF COµgTRIFTION OTHHER�EpBSFYRULCLFARANCE.YMW. \ Q SEE FLAN SHEETS FOR TRAIL STRIPING, IF APPLKNRE. -RESTORE WERND AIq OTCN qT IS BOULEVARD VNUES IN WUTH. BUT SIgULD BE A IN ONST CONSTRUCTION. OF Y. SIGN INSTNIATION NOT APPOCABLE IN ALL INCLUDINGEDMIXODSIIURSED OF WERNq AREAS. SEEOMI%TODISNDwoAREA9AFTER � 3%. REMOVING FBL AND GEOTF%IILF MW CLEARANCE 0 GE BETWEENEWEOF TRAIL ANO � EDGE OF SIGN. EWE SIGN 'JTYPE BPWEA3iBC SRUMINW 5 PgVEMENT L 1 \DETAIL: TEMPORARY WETLAND/DITCH FILLING us a cs S AGGREGATE BASE NOT TO SCALE to VERTICALCLEAR 1UBGRIN �L ZONEASMARTIN ZONEPB TRIMTREE ® EWTERIALAS IRECTET SUBGRAOE MATERIEL AS DIgECTED BY DINNER. TABLE 1 ACCORDINGLY BRNNGIES ACCORDBIGLY. INDIES. 18'MINUS GRADATIGN FOR r 1. BIRMNO1551411 BE RACED IN OTE LIFT. GSURFACING SAT Gx CNC.DN MCgFOdRNiTFMOO LaTRAa (CLASS SPECULL) _ uCLmAS.STSPEC. 3A1 3 BT SIEVE SIZE PERCETPA m 1aL ® AGGREGATE INSTALLATIONioRM O BASE STA1ATION A 1W Ci wDotSPED 2111 D EI YO\% _ A ERE CLUE"ARSOS SHAILBE CONSTRUCTED FROAIMPRVIOUS / 4 MATERIAL (4E.SITIJMINOJS.CONCRETE. PAMERS, ETC)SPECIAL STRIPINDWYCUTMY PY.ISEE RAN SHEETS) rMppAG9 10.10 ETOpREGCNSTRU,n,NCONDTIONS THTC K_y8_'M_INU_S_AG_GR-E_M-IE OR BETTER TOSATISFACTION OENGINEERSURFACING CLASS SPECIAL NOTES: (SE: TABLE FOR GRADAT CIN) W TOPSOIL (PVP,) 1. WMINUSAGCAEGATESLIRFAONGSWILBE10p%CgU31EOLNESTOE. 3. 1C MINUS AGGREGATE SURFACING MUST COME IRON pUEMER MINM & MATERIALS. IW OF BURNWU_E. MN. IN ORDER TO WTCH COLOR OF E%ISnNG 4 DETAIL: BITUMINOUS TRAIL RESTORATION TRNL NOT TO S NE 3 DETAIL: GRAVEL TRAIL RESTORATION SOr�B DESIGN SCALE .. -- ... _..... — — —_ — Y y RPBNtaAI'wOTMTIw Awx�u AAxn LANDSLIDE REPAIRS ENGINEERING CO. 1}/1YN19 2.'�101014.G'1 p x DR aax MARKFTroINTE DRIVE CHANHASSEN, MN ➢MIS HCRRA wEMr PRONECT w. MINNEAPOLIS, MN SITE ACCESS, STAGING, AND TRAFFIC CONTROL I ®K A B C D D 1 'j MMNNEAfiPOLIS,. MN W135 �M DAG. N,. G-06 -1M?I &,.-:eR, PLAN AND DETAILS D a MD BY DATE REVISION DESCRIPTION y,r TOFOR RATE REEMSED FA ao .& _ _ .one..F ulPz • r\' <�~� �y_• � �' of _ � � _ a }').� zz �e � � ;... a Z ., it -� �y, -ti ' Y +�`�-., �> - '•• `, moi, ��. jj��aa •illoILIKIL gELEgSEp1 A I B C D 0 TdFOR MTE RDFASB) 90% DESIGN NOT FOR CONSTRUCTION 4+ •s sHovm >y>�e LANDSLIDE REPAIRS �aD� uoo wroo=mow>E owv� E,F HCRRA CHANHASSEN, MN B -u M s�: m uwnEnvaus.>a+ urvz MINNEAPOLIS, MN _ _ TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY F' � i J P �'F-i f CM ._ ^ 4. a• �� 1� vo 14 1 PLAN' TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY o �m zoo .. SWENfEEf O 90% DESIGN NOT FOR CONSTRUCTION 4+ •s sHovm >y>�e LANDSLIDE REPAIRS �aD� uoo wroo=mow>E owv� E,F HCRRA CHANHASSEN, MN B -u M s�: m uwnEnvaus.>a+ urvz MINNEAPOLIS, MN _ _ TRAIL CLOSURE SIGNAGE EAST OF LAKE RILEY \D. pO\ -__ - 1111 1 I:i/ � ___-_ -'� _ � �'i'�/�� _ i/ /'// J/,/ /i / t � /P/ill/I Z i/ \ `\\ \ /i�_- � \ __ �-' _��- = '✓'wT� / _ (rf"1- - ' � (� NORTH AREA SLOPE REPAM_ Qf W SEE SHEET C-1] \\\\\ t ice i��-i �i-�'ii iiia /�/ 'y1/r/ / % .��\- J vARCEL ONE i i �� ��'iii'SjS iii__ _ \\\ _ __ /lr/'✓�//i/,mss ,/'! // �/ _ // , yyy \-` _= _ \ 1\ILII = _ CONSTRUCT LIMITS I PoTENMLN:CESSRWTE /�— _ _ I 1 _ - 1 \_-� TRNL MODIFICATION$ \ - - a ��r r NEW FENCE N1M+C6.03 / 1 $EE SHEET \\ -- _ �`�—• ',-.__ — • - c_^gn � ___•__ NSFEWE^`FENCE E1Ni FIBERPLINE - II_S•. e•J. DRIVE - - _N:losssi'MINNESOTABL s47615 OM s� � 1B5UB}2J IT1 e ME• OE%ISTING FENCE FILLL E%STNG NORTH PIPE WITH IN E SBV]S B3 �( \O • SB6•\ •�� \ �\ — GF —� GROLR AND ABANDON IN PLACE _ • 4 ---- �— SEE SHEET 1>48 - � � r,- � \ • \ -- ME SEETA NOPE IMPAIR i \d+ / / / � \ \ /N+o�'-' _— � --- - 9EE sr EGET c+s P L __ 1_ —_ POTENTIAL AccEss aouTE ST / NEW onuNAGE STREAM RE BANK PAIR \ \ _ _ '- y1�� 3.1 / i / CHANNEL SFf 514EEIGIS V I ON9�i \ /moi V a. :III IIIc II'�/l I//r 1v // / / '/ _ 1A111V111AVAVAA \\\ SOUTH AREA CULVERT 0l1T1ET CONSERVATION EASEMENT Ai \ \`` \1_ _ � /� :i J / J 1 I\1\\\ \\��\J\�\\\�\ •7� /' '/i 1 �\\Li\\�\II I\4N\\\� i lN ChaslauCipN UMrts JV l �/ ./\�/J _J�"\I --� „_ -�_C-I-F'A'`RM"1G- li1M1J_E�5 / �// � �- �__--�_ -___ __ _.-_�_-_�!_ i_ S �ce--=-__- _--�'/'-/i/il//l I�� �///�r�,� /''/ � _\-^_<\�__\___�'��•�'//'1 '/11' /.// /"W -m \1IAA1I �\1111111I1\ 1 l/1lll./o1:l1l11 1 1 j1111I11I11 \ BEATRICE I. _ \,_-_\ r' _ JPARC6LRE%i /J'/i IJ' ZWIERSON \I� \ '1 1 =.:-� _ r - / J //i/ _i / , /'/ / / , / / / -' __ - .., IRREV. TRUST / i/' i �' i/�� /�//. i I%/iii/ L� \\\\ 1\ I _\� ✓1 III! _ Y / J r 1 I I I \� 1: �\1 ( AGG�O/LTE \ I\`\I\ \ r / - �!/ f - // /' / '_�/ �' 11//i%i l / /'\\ 11 1 � -___�___ �•�iY-� � / I / / 1 \\ \\-\\ �\\\\� �_`'��_ \` �\\ `�\\I r// i��'/III '/ i / 1 1 I - /� l �_/' // / 1\\, / 11..11 _/'//_ Il I / I`\�.� _ � _ '- L _ ♦ \\ \\\ \\ \1 \\ \\ \ 11\ l f 1 ( / _ 1 • �' __.\Q`i1/ `\ 1L �:\ I \\LIQ:. 'r � / 4i'� \\\\�� J ��` \\ \\\\\ 1=\`\\\\ \ `\\\\ \11\ 1\LI \\ 1 1 \\ � I I /ii4\I �1, PLAN: PROJECT LAYOUT 4 L, sB w BCALE IN FEET 1. ewwswwe.uFw AS SHGWN "AA` +�T "u A•rAv+aha ?XEf S��T IiARRENGINEERING CO. 1v1v3o+9 HCRRA D� 4!mKETPOINTE OHNE EPI'i D MINNEEAPCiL n.MN Stas ArrP3 MINNEAPOLIS, MN REIEASEU A B C U U 1 2� - BARR 1 N0. By HK. APP. DATE REVISION DESCRIPTION TOIFOR PATE R9FARE0 a�1�-: ro^'^^ ArtP3 SUMMARY OF ANTICIPATED EASEMENT NEEDS LANDOWNER REASONEOREASEMENT M,TRMSI.M'MRSOM IRRREV. TRUST RIPMPATSOUTH PIPE OUTLET. MEAMBANY HEPMRS,OMINKEOMNMFI,5fAGINGAREA M!OSOUMSDELRACCIM A NVATUVAGGREwTE SOUIMSMSEEA= \\\ \\ \\ \\\VAN \ v VAAV AAAA A / J / , 11111A1 A I 1 ` /� i r SUMMARY OF ANTICIPATED EASEMENT NEEDS LANDOWNER REASONEOREASEMENT M,TRMSI.M'MRSOM IRRREV. TRUST RIPMPATSOUTH PIPE OUTLET. MEAMBANY HEPMRS,OMINKEOMNMFI,5fAGINGAREA M!OSOUMSDELRACCIM A NVATUVAGGREwTE SOUIMSMSEEA= LANDSLIDE REPAIRS CHANHASSEN,MN PROJECT LAYOUT PLAN 90% DESIGN 23101014.04 REV W G -0B D Bo �\ __--j/.i ' iii/!i�/i/ ' \\ \\il:i� \. __-_- -__- _/�lAil/''s�cv '4i4/t/ !I \, r,/ �e°°�� �1-11 \III � 1 � `I / i - -- --/ /J! �''�i_�=�J/��////�////�i�/��li/�/� /1/r7111 I -�_-_� _ ��J` � � � __ _ ��` •__-�_�-_ i= -- ' 111/ IIII I - "/mol l/- _ =-'J�; TF/ //Ali I //in\ \'\`\ ' /�iIIII! Li/i \/\I I _ \r EMSTW6 WERNDI 1111 1 _Tyo�x / J� � %�'��S_''��_-__- � ___ //�J/�f �' _ �� i' i'•i' ) /// __ / _ -_- '\\U\\.I r<'ri�-�-';_� - \ I I' ll�l //T APPROXIMATE 6_OPE- ' CONSTRUCTION LIMITS I-��MORTAL PIPE CROSSING S. sNEETOaO) >oo_ !_ i 11/I 1 - _ CHVNLINK FENCE _ - - -- �- g(i. S' E]64,MG aFl1[M----- - -aBd - - 8 -- A REGION AL _ 0u5nNG CNAWIINKFENCE- _-_ _-_T _ y — —SIS -5 = _ _- _— �T_ U SL Exlsnvc to Olv RT _ Ti _ EYJSTING FIBER OPTIC CABLE SS;'$ i -- R 80 ' nt MPgQI(♦NTE lA1DSllOE LIMITS j _ -_- -_ 9 ST -9 �F E%IsnHOTOx24, SH HEADWALL EXSUNG WOOXRETICEAlO ST -7 1 1 I (SEE PHOTOS 24, Ga31 - MOOVIAR BLCCN RETNNMG WNL f-�,r� '� SS =� S. / APPROXIMATE_ANDSUDESPOIL IPILEEXISTING STORM SEWER 35 r STA - i 1 t• �� - 1 NORTH PIPE UPSTREAM INLET -1 _- \ - l'-`� TELPoR/JIY REPNR RIPMP MEA � BEE PHOTON SHEET C42) _ O (SEE Pt10TO51J.5XFkT C@) EXISTING STREAM THALWEG - `\\ CONSERVATION EASEMENT \ v / �sT.5 ' fi�i�/ // // ' I I I I 11AtA: v��\vw�AAAN,\ \\ �� // J / :i / / 1 1 I \ \� \ O♦ \\\ \\\ EXISTING STREAM EXTENTS �''�' / 15 / / 1 I I I \\ \ f:ONSTRUCTION UMRG\1111 I l \. � _ Vii. r IIIA If _ _ — — :BEATRICE I.2WIERSON -.- _ IRREV. TRUST GENERAL NOTES. \ 'J 1. FIELDISRIFINFORLNTIONBAPPROXIIMTE MOSNALL BE I ��_ �- � ��! � / / / J / FIELD VERIFIE09Y CONIRACTOq. 11111 l� 1\ I �1 1 \I\ t ` L J'J' / / / (1,11 MOONVALLEI' Q \l l AGGREGATE \ \\ l f �tlrlj '\ 1/ f f - r - - � ` VA A „ ,- 1A v-_ vA •A.v\� 1 vAAA A vVA vA � ` Avg v` � � � � 1 PLAN: EXISTING CONDITIONS 4 ° 50 40 90% DESIGN . SCALE N IFFY NOT FOR CONSTRUCTION oTM��a �Q _- '�SMOWN LANDSLIDE REPAIRS %�`R PRaE`'r N°_ pi�� BMRIIUOO( Gca tvtrmts 23101014.04 <E•oP, _____ _ _ D/"� 43�MAR�IP�ITE ONNF P— EFT HCRRA CHANHASSEN, MN ua:xr PRaEcr NP. sN.mo MvrNEMGUS. MN 55435 MINNEAPOLIS, MN EXISTING CONDITIONS Nvrtwe REL fASEDA B ITE I E1 1 FO T Z �c �l - co: BARR PLAN UNG. NP. REv. No. N0. BY ITE REVISION DESCRIPTION �y� MIP2 C.01 D A. r PHOTO 1: EXISTING SOUTH (LOOKING C REL ED REVISION DESCRIPTION TGreOR PHOTO 3: EXISTING SOUTH PIPE OUTLET (10/29/2019) OATS RELEPSED PHOTO 4: EXISTING SOUTH PIPE OUTLET (10/29/2019) 84 RR ENGINEERING1}/�LN19 HCRRA a3oo MnRNErcDINre DRrvE w..� ERE sulN zoo MINNEAPOLIS. MN 35�--���.�rvz I MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN EXISTING CONDITIONS PHOTOS 90% DESIGN NOT FOR CONSTRO __ - _ - _ - .. - _ L – _ –`'_ – \ L -� J A r '�All II _. � A�`A - -��-•-�_ -�-- IB114/ = - S r .. / 90 iii �_.,�� 2♦ i ! _ —' PROPERTY LIFE ITYP.)� >\\\}! • % PinD TINGE%IS` f PIPE DEBRIS -- — SITE FROM E SHEETDRIV ` _ N (SE SITMLYMEW E -^ Gab) �REMOVE E%ISTINGWOpOEH FENCE t - ��� _ (-PROTECT APPROXIMATE LAN DSIIDE LIMITS - / E%ISTNGTMIL V SALVAGEE(ISTINGBEMCHANOPIALEIN / THEGMVELPARKINGLOTAOJACEMTO / BUUFFCREEKDR PARKOISTRICTSTAFF -- Qr WILLHAULBENCHESAWAY _1 _ __- ___ _-_ --_- _ RIVMISTING STING MODU M' / / _ REMOVE IXPOSED PORTON MINN@ ESOTABLUFFSLRTREGION - BLOCKRETAININGWuOF NORTH PIPE SEE G1B i = __� = _ _ — — �, —_ -- ��� A AL TRAIL I _ _ —�� � — - � , �,`��. �•` �- FILL EXISTING IX1iM 5&f _ _ � yY �• a PIPE WITH GRpR PNO _a r_� C 18 -"PHO%MATELANDSLIDE LIMITS I// / ' fiA_ _ _ II \ \ / SMNIOONM%A1:E. T-� —_ � a � v.—• N / REMOVEE%ISTING SILTFENCE(TYPI \ / CONCRETE HEADWALL - SEE e 1 / EROSION CONTOL LEGEND SALVAGE RIPRNPANI)STCKIFOR i pw - EXISTING gWPAP Fpi gEUSE� � ________ / � CONSTRUCTION LIMBS sEDwENnas SALVAGE EC6TINGND NJJPLACE LA EIN THE RA GATES PARKINGLOT AFIANDP TO FG GREEK \ VEL PIt J PARKINGLOTT STAFF RTO ALL. AWAY OR SLTFENCE PPAI(pISTgICT STAFF WILL FALL. AWAY CONSTRUCTION ENtRANLE \ i QO aTs CONSERVATION EASEMENT `�\ \ IXISTING 10' CONTOUR V CONSTRUCTION LIMITS ``\ _ /' •\ -. E%IS11N62LONTgM REMOVE AND DISPOSE EXISTING CLEppING LIMBS =PIEZOMETERS PER ENGINEEIF$DIRECTION / \ T% _ - srAGmcuEw _ r / EROSION aSEDIMENT CONTROL NOTES: r• ; /)`� 1. INSTALL PERIMETER EROSION CONITNI THE LOCATIONS SHOWN ON THE PLANS PRIOR TO T, TEMPOflAI1LYO PERMANENRYSTMILI2 LOON MXT1pNAREA.SWHK:HMVE r / / J ///f /) /\ I `\1� \`\l-%� _ -'/� THE COMMENCEMENT OF ANY LANG DISTURBANCE OR CONSTRUCTION ACTIVITIES UNDERGONE FINAL GRADING, AND ALL AREAS IN WHICH GRACING OR SITE BUILDING CONSTRUCTION OPERATIONS ARE NOT ACTIVELY UNDERWAY AGVNST ERWICN WE TO RAIN. \IJ 2 BEFORE BEGINNING CONSTRUCTION. INSTALL ROCK CONSTRUCTION WIND AND RUNNING WATER. STARILUATION TO BEGIN IMMEDIATELY MA BE COMPLETED ENTRANCE AT EACH POINT WHERE VEHICLES EXIT THE CONSTRUCTION SITE PRKJR TO WITXINMDAYS. USESEEDMOMULCH. EROSION CONTROL MATFING, ANdOR 500WNGANO �)/ •+'/%J COMMENCING ANY CLEARING'GRUBBING. REMOVAL, OR EARTHWORK ACTIVITIES . USE 2INCH STAKING IN GREEN SPACE AREAS REMOVE ALL TEMPORARY SYMHETC.STRUCTURAL, Oq GREATERDMµ RRMKINAWYRATL T61Nf.XE3 CKACROSBTHEENTIRE NON gIOMGRAOABLEEROSIONM'DSEDIMENTCONTROLDEVICESAFTERTESRENAS WIDTH OF TXE ENTRANCE. EXTEND THE ROCK ENTRANCE AT LEAST 5O FEET INTO THE UNDERGONE FINAL STABILIZATION WITH PERMANENT VEGETATION ESTABLISHMENT, FINAL CONSTRIKTION ZONE USING AGE0.TEMIlE FABRIC BENEATH THE AGGREGATE TO PREVENT STABIUTATION FOR PURPOSES OF THIS REMOVAL IS TI% ESTABLISHED COVER OVER I.1-, MIGRATION OF SOIL IMO THE ROCK FROM BELOW. DENUDED APER 3. REMOVE ALL SOILS AND SEDIMENTS TRACKED OR OTHERWISE DEPOSITED ONTO PUBLIC AND �B. CHANGES TO APPROVED EROSION CONTROL. PLAN GI PLMUST BE APPROVED BY THE ENNEER PRIVATE PAVEMENT AREAS. ATA MINIMUM REMOVALSIMLLBEONCEMILY. SWEEPINGSHALL PRIOR TO IMPLEMENTATION. CONTRACTOR TO PROVIDE INSTALLATION AND DETAILS FOR ALL _- _�/1 ,\ BE MAINTAINED THROUGHOUT THE DURATION OF THE CONSTRUCTION AND DONE IN A MANNER /F/{ i �/ i \\ -� - PROPOSED ALTERNATE TYPE DEVICES. / _ \ / 1 \\` _--_ TO PREVENT DUST BEING BLOWN TO ADJACENT PROPERTIES. { B. IF DEWATERING OR PUMPING OF WATER IS NECESSARY, THE CONTRACTOR IS RESPONSIBLE <. INSTALL INLET PROTECTION AT ALL PUBLIC AND PRIVATE CATLN &151N INLETS MUCH RECEIVE/ /• -J /���� _��\�__\\l III \11\ � �\ /�/Llll; \\\_•.-�'-) /��\�\ /J/ ��-- ANY NECESSARY PERMITS MUCH APPROVALS PRIOR TO DISCHARGE OF ANY r _ RUNOFF FROM THE DISTURBED AREAS. CONTRACTOR SHALL CLEAH. REMOVE SEDIMENT. pt FOR OBTAINING WATER FROM THE SITE. IF THE DISCHARGE FROM THE DEWATERING OR PUMPING PROCESS IS gEPLACESTORMDMNINLETPROTECTIONDEVICESONAROUTINEBASISSLIWTNATTNE TURBID OR CONTAINS SEDIMENT LADEN WATER, IT MUST BE TREATED THROUGH THE USE OF DEVICES ARE FULLY FUNCTIONALFORTHE NEXT RAIN EVENT SEDIMENT IN SYSTEM SEDIMENT TRAPS. VEGETATIVE FILTER STRIPS. OR OTHER SEDIMENT REDUCING MEASURES / 1 gNDIOR PLUGGING DRAINAGE THE RESPONSIBILITY OF THE CONTRACTOR MY S S TESIS ST ARE NOT ALLOWED FOR INLET PROTECTION. SUCH THAT THE DISCHARGE IS NOT VISIBLY DIFFERENT FROM THE RECEIVING WATER. 5. LOCATE SOIL OR DIRT STOCKPILES NO LESS T N 35 FEET FROM ANY PUBLIC OR PRIVATE ADEROSION CONTROL ME/SURES MAY BE REQUIRED AT THE DISCHARGE POINT TO PflEVENT VENTS BCWRERO3I0N ROADWAY OR . DRAINAGE CHANNEL IF REMAINING FOR MORE THAN SEVEN DAYS. STABILIZE l / _ t0. iN3TALL SEED ER0.5KlN CONTROL BLANKET. MULCH, AND OTHER REVEfAERTIN • - THE STOCKPILES BY MULCHING VEGETATIVE COVER, TARPS, OR OTHER MEANS. CONTROL ACCORDANCE WITH DESIGN DRAWING SHEETS R -0I AND R-02. _ EROSION FROM ALL STOCKPILES BY PLACING SILT BARRIERS MOUND THE PILES. TI BOTH CONTRACTOR AND ENGINEER SHALL KEEP A LOU OF ALL TREES GREATER THAN 6. MAINTAIN ALL TEMPORARY EROSION AND SEDIMENT CONTROL DEVICES IN PLACE UNTIL THE DIAMETER AT BREAST HEIGHT REMOVED DURING CONSTRUCTION. SEE SHEET R-02 FOR TREE CONTRIBUTING DRAINAGE AREA HAS BEEN STABILIZED. INSPECT TEMPORARY EROSION AND REPLACEMENT REQUIREMENTS. / )/ L ROTTEDSEDIMENTEROSION CONTROL DEVICES IMMEDIATELY, AND REPLACE DETERIORATED, DAMAGED, OR ROTTED EROSION CONTROL DEVILESIMMEDIATELY. GPLAN: REMOVALS AND TEMPORARY EROSION CONTROL D m Im sr W ©y W. DESIGN MnT Cn0 PnAICTDITnnnAl AS SHOWN LANDSLIDE REPAIRS BARR ENGINEERING CO. M' 12)1Y201I 23101014.04 —8 aD a3CO MAgKETPowTE DRIVE pen EFF HCRRA CHANHASSEN, MN CLIENT PROJECT Na. Style mO Jill I KATE--MWNEAP.US.MNs m AKH MINNEAPOLIS, MN ® A e G O D t z w.u►IA..r.• P. , �-n„ �� BARB REMOVALS AND TEMPORARY OWG No REv Ra D IMI -Am, EROSION CONTROL PLAN NO. BY RATE REVISION GESCRIPTON wrF� L®a.. liyFOR RATE REIFASEO � �rr�� �W,m„ roaam MH C-03 D MACHINE SLICED SILT FENCE PER MWDOT STD. SPECIFICATION 3696, INSTALL PER MNNOT STO-SPEC. 33]3 MACHINES4-ICEC-17 DEPTH (RUS 6' FUP) 5 FF. MIR LENGTH POST PLASTIC 9P TIES (MIN. W L05 AT FT. MAX. GTH POG TENSILE S%ENGTHIONTOP B' MIN. 3 PER POST GEOTEXTIE FABRIC, 36 MIN. MACHINE SLICE B' TO tY DEPTH (PLUS 6 RMI DOWNSTREAM VIEW NOTES. SECTION VIEW 1. SILTFENCESNALLBE INSTALLED PRIOR TO ANY GRADING WORK IN THE AREA TO BE PROTECTED AND SHALL BE MAINTAINED THROUGHOUTTHE CONSTRUCTION PERIOD .SILT FENCE AND ANY ACCUMULATED SEDIMENT SHALL BE REMOVED IN CONJUNCTION WFM THE FINAL GRADINGAND SITE STABILLMLON. 3. SILT FENCE INSTALLATION AND MATERIALS SHALL MEET THE REQUIREMENTS OF WOODY SPECIFICATIONS 2573 AND 3066. 3. NOHOLESORGAPSSWYLSEMESEMINNNDERSILTFENCE PREPARE AREA AS NEEDED TO SMOOTH SURFACE OR REMOVE DENNIS C WHEN SEDIMENT BUILDUP REACHES 113 OFFENCE HEIGHT. THE SILT FENCE SHOULD BE REMOVED ORA SECOND SILT FENCE INSTALLED UPSTREAM OF THE EXISTING FENCE ATA SUITABLE DISTANCE. 5. WHEN SPLICES ARE NECESSARY MAKE SPLICE AT POST ACCORDING TO SPLICE DETAIL PLACE THE END POST OF THE SECOND FENCE INSIDE THE END EQGT OF THE FIRST FENCE ROTATE BOTH PoSTS TOGETHER AT LE T 1BD DEGREES TO CREATE A HGHT SEAL WRH THE FABRIC WMRML. CUT THE FABRIC NEM THE BOTTOM OF THE POSTS TO ACCOMMODATE THE 01NCH F WP. THEN DRIVE ROTH P03TS MD BURY THE FLM. COMPACT BACKFILL. ODETAIL: SILT FENCE - MACHINE SLICED MOTTO SCALE CURB STAKE ENDS (TYP) SIGNS,GRI SEDIMENT L__ Cil PLAN VIEW STAKE END(TYP) CURB CATCH BLAIN SECTION VIEW NOTES 1 INLET PROTECTION SHALL BE INSTALLED PRIOR TO ANY GRADING WORK IN THE AREA TO BE PROTECTED OR IMMEDIATELY FOLLOWING CATCHBASIN INSTALLATION, AND SHALL BE MAINTAINED THROUGHOUT THE CONSTRUCTION PERIOD. 2 MATERIALS SHALL BE SUFFICIENT TO ALLOW FLOW WHILE BLOCKING SEDIMENT. NO HOLES OR GAPS SHN1 BE PRESENT IWUNDER SEDIMENT LOG. 3. INLET PROTECTION SHALL BE CLEANED M REQUIRED. <. MATERIALS AND MY ACCUMULATED SEDIMENT SHALL BE REMOVED IN CONJUNCTION WRH THE FINAL GRACING AND SITE STABILIZATION. /'2\ DETAIL: INLET PROTECTION - SEDIMENT LOG \-// NOT TO SCALE RELEASED TOIFOR SEDIMENTLOG WAD STAKE SEDIMENT LOG WQGD STAKE TO ONLY - - PENETRATE NETONO WOOD STAKE TO ONLY 1 FLOW PENETRATE E NG ROW 1 m i i V z \ G i SLOPE INSTALLATION I SIDE VIEW ON SLOPE SIDE VIEW FLAT WOODSTAKE SEDIMENT LOG � ._. WOOD STANE TO ONLY PENETRATE NETTNG FRONT VIEW TOP VIEW NOTES. 1. INSTALL SEDIMENT LOG ALONG CONTOURS (CONSTANT ELEVATION). 2. NOGAPS SHALL BE PRESENT UNDER SEDIMENT LOG. PREPARE AREA AS NEEDED TO SMOOTH SURFACE OR REMOVE DEBRIS 3. REMOVE ACCUMULATED SEDIMENT WREN REACHING IMCFLOGHEIGHT C. MAINTAIN SEDIMENT LOG THROUGHOUT THE CONSTRUCTION PERIOD AND REPAIR OR REPLACED AS REQUIRED. OVERLAY ENDS WOOD STAKE NOTES: I '— o 1. RFIER TO MANUFACTURER RECOMMENDATIONS FOR STARE PATTERNS FOR SLOPE INSTALLATIONS 2. PREPARE SOIL BY LOOSENING TOP 12INCHES AND APPLY SEED(AND FERTILIZER WHERE REQUIRED) PRIOR TO INSTALLING BLANKETS. GROUND SHOULD BE SMOOTH AND FREE OF DEBRIS. 3. MGM (A) AT THE TOP OF THE SLOPE AND ROLL THE BIANIIETS DOWN OR LB) AT ONE END OF TIME SOPE AND ROLL THE BLANKETS HOR20MALLY ACROSS THE SLOPE ♦. THE EDGES OF PARALLEL BLANKETS MUST BE STAPLED WTH APPROXWATELY T OVERLAP. WTH THE UPHILL BLANKET ON TCP. 5_ WHIM BLANKETS MUST BE SPLICED DOWN THE SLOPE. PLACE BLANKETS END OVER END (SHINGLE SME)WTH AOPRO%IIATELY 6'OVERLM. STAPLE THROUGH OVE0.V3PE0 AREA APPROXIMPTEL` LH APART 6. B-ANKET MATERIALS SHALLSEAS SPECIFIED OR IS APPROVED BY ENGINEER 5 DETAIL: EROSION CONTROL BLANKET - INSTALLATION NOT To sLALE 3 DETAIL: EROSION LOG - STAKING SEDIMENTLOG NOT TO SLNE 'W L EXPAND FOR TURNING 1' A2� RADIUS AS REWIRED 6' MINIMUM - GEOTEXTIIF FABRIC I-PTNI ' 1 -TW .. ED ROCK BMR ENGINEERING CO. 43 MMKETPOINTE DRIVE $IUM E p MINNEMOLI$. MN 55135 NOTES. I MAINTAIN ENTRANCE THROUGHOUT THE CON3TRUCTK)N PERIOD AND REPAIR OR REPLACE AS REQUIRED TO PREVENT TRACKING OFFSITE. 2. REMOVE ENTRANCE IN CONKMCTION WITH FINAL LADING AND SITE STASRAATION. 4 DETAIL: STABILIZED CONSTRUCTION EXIT OTTOSGLE HCRAA MINNEAPOLIS, MN. TEMPON.RY EROSION CONTROL SEEDING NOTES, 1. CONTRACTOR SHALL PERFORM TEMPORARY SEEDING IN ADDITION TO TEMPORARY MULCHING ON GRADEDIDISTURBEO MEAS WHEN THE SITE IS TO BE LEFT IDLE FOR LONGER THAN 21 DAYS - IN ACCORDANCE W ITH MnMT STANDARD SPECIFICATIONS SECTION 25]53 B1. USE COVER CROP AND MIDTERM STASILQVTION SEED MIXTURES AS SHOWN IN NOS TSEEW TABLE 38Ml FON-EMPORMY SEEDING 2 PERFORM TEMPORARY MULCHING TO PROTECT THE SITE FROM EROSION WREN LEFT IDLE FOR MORE THAN ONE WEEK AND DURING NON -SEEDING PERIODS AND WHEN OUTSIDE THE SEEDING AND SODDING DATES. FOR AREAS LESS THAN TWO ACRES. MULCH IN ACCORDANCE WITH MnD0T STANDARD SPECIFICATIONS SECTION M753 M.'RAPID STABILIZATION' LANDSLIDE REPAIRS CHANHASSEN,MN TEMPORARY EROSION CONTROL DETAILS 90% DESIGN NOT FOR CONSTRUCTION 1.0 GENERALCONSTRUCTIONACTMTY INFORMATION' 3.0 PROJECT PLANS AND SPECIFICATIONS: THIS STORMWATER POLLUTION PREVENTION PLAN(SWPPPI HAS BEEN PREPARED IN COMPLIANCE WITH THE MINNESOTA GENERAL REQUIRED FEATURE SHEETNUMBER STORMWATER PERMIT FOR CONSTRUCTION ACTIVITY NO. MNR100X01(GENERAL PERMIT), AS REQUIRED BY THE MINNESOTA • PROJECT LOCATION AND CONSTRUCTION LIMITS G01 POLLUTION CONTROL AGENCY (MPCA) UNDER THE NATIONAL POLLUTANT DISCHARGE ELIMINATION SYSTEWSTATE DISPOSAL • EXISTING AND FINAL GRADES, INCLUDING DRAINAGE AREA BOUNDARIES, DIRECTIONS C06.G14,C-16 SYSTEM (NPDESISDS) PROGRAM. OF FLOW AND ALL DISCHARGE POINTS WHERE STORMWATER IS LEAVING THE SITE OR TITLE: PROJECT ENGINEER PHONE NUMBER: (612) 3988370 ENTERING A SURFACE WATER THE PROJECT IS LOCATED IN THE CITY OF CHANHASSEN, CARVER COUNTY, MINNESOTA PROPOSED CONSTRUCTION ACTMTIES • SOIL TYPES AT THE SITE COSH WILL TAKE PLACE ALONG AND JUST SOUTH OF THE MINNESOTA BLUFFS REGIONAL TRAIL BETWEEN FLYING CLOUD ROAD AND • LOCATIONS OF IMPERVIOUS SURFACES C04C-14,G16 LMOTA LANE. THE APPROXIMATE CENTROID OF THE PROJECT HAS A LATITUDE OF 44.619992 AND A LONGITUDE OF -93.526089. THIS PROJECT INVOLVES EROSION CONTROL, REPAIR AND REGRADING OF LANDSLIDE DAMAGED SLOPES, REPAIR OF DAMAGED CULVERTS, INSTALLATION OF STORM SEWER AND MANHOLES AND SITE RESTORATION. THE PROJECT AS PROPOSED HAS A TOTAL DISTURBANCE AREA OF 7.22 ACRES. EROSION PREVENTION AND SEDIMENT CONTROL MEASURES ME REQUIRED TO MINIMIZE SEDIMENT FROM BEING TRANSPORTED INTO BLUFF CREEK WHICH IS AN IMPAIRED WATER. REFER TO PROJECT DRAWINGS FOR FURTHER DETAILS. (CSW PERMIT PMT IIIA 11 1.1 PROJECT SIZE AND CUMULATIVE IMPERVIOUS SURFACE' • THE ANTICIPATED AREA OF DISTURBANCE IS APPROXIMATELY 7.22 ACRES. • THE TOTAL MEA OF PRE -CONSTRUCTION IMPERVIOUS AREA IS APPROXIMATELY 0.70 ACRES. • THE TOTAL AREA OF POST -CONSTRUCTION IMPERVIOUS AREA IS APPROXIMATELY 0.70 ACRES. • THE TOTAL NEW IMPERVIOUS AREA IS APPROXIMATELY 0 ACRES. 1 2 DATES OF CONSTRUCTION; • ANTICIPATED STMT DATE: TBD ANTICIPATED END DATE TBD 1.3 CONTACT INFORMATION: NA OWNER: HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY MAILING ADDRESS: 7014TH AVE. S. #400 NA CONTACT PERSON: JESSICA GALATZ TITLE: PROJECT MANAGER PHONE NUMBER: (612) 34&2691 EMAIL ADDRESS: JESSICAGALATZ@HENNEPIN.US ALTERNATE CONTACT PERSON: KRISTINE STEELY TITLE: PROJECT ENGINEER PHONE NUMBER: (612) 3988370 EMAIL ADDRESS: KRISTINE.STEHLY@HENNEPIN.US OPERATOR / GENERAL CONTRACTOR (WILL OVERSEE IMPLEMENTATION OF THE SWPPP): TBD MAILING ADDRESS: CONTACT PERSON: TITLE: PHONE NUMBER: EMAIL ADDRESS: PARTY RESPONSIBLE FOR LONG-TERM OPERATION MD MAINTENANCE OF THE PERMANENT STORMWATER MANAGEMENT SYSTEM: HENNEPIN COUNTY REGIONAL RAILROAD AUTHORITY MAILING ADDRESS: 701 4TH AVE. S. #400 CONTACT PERSON: JESSICA GALATZ TITLE: PROJECT MANAGER PHONE NUMBER: (612) 398-2691 EMAIL ADDRESS: JESSICAGALATZ®HENNEPIS.US ZO RECEIVING WATERS: WATERS WITHIN ONE MILE (NEAREST STRAIGHT LINE DISTANCE) THAT ARE LIKELY TO RECEIVE STORMWATER RUNOFF FROM THE PROJECT SITE (CSW PERMIT ITEM 5.10) INCLUDE: SPECIAL IMPAIRED PUBLIC WATER WITH WORK NAVE OF WATER BODY TYPE O) WATER BODY ID PI WATER70i WATERT PI IN WATER RESTRICTONS9 BLUFF CREEK CREEK 07020012-710 NO YES NO RICE LAID= LAO= 27-0132-00 NO NO NO (1) TYPE EXAMPLES: DITCH, POND, WETLAND, CALCAREOUS FEN, LAKE, STREAM, RIVER (2) WATER BODY IDENTIFICATION (ID) MIGHT NOT BE AVAILABLE FOR ALL WATER BODIES. USE THE SPECIAL MD IMPAIRED WATERS SEARCH TOOL AT: HTTPSJIWWVI.PCA.STATE.MN.USIWATER/STORMWATERSPECML- IMPMRE WATERSSEMCH (3) REFER TO CSW PERMIT SECTION 23. IMPAIRED WATER FOR THE FOLLOWING POLLUTANT(S) OR STRESSOR(S): PHOSPHORUS (NUTRIENT EUTROPHICATION BIOLOGICAL INDICATORS), TURBIDITY, TOTAL SUSPENDED SOLIDS (TSS), DISSOLVED OXYGEN, OR AQUATIC BIOTA (FISH BIOASSESSMENT. AQUATIC PLANT BIGASSESSMENT, AND AQUATIC MACROINVERTEBRATE BIOASSESSMENT 2.1 SPECIAL AND IMPAIRED WATERS: THE MPCAS SPECIAL AND IMPAIRED WATERS SEARCH TOOL WAS USED TO LOCATE SPECIAL AND IMPAIRED WATERS WITHIN ONE MILE (AERIAL RADIUS MEASUREMENT) OF THE PROJECT SITE.BLUFF CREEK HAS AN EPA -APPROVED IMPAIRMENT FOR TURBIDITY AND FISH BIOTA. THESE IMPAIRMENTS ME CONSIDERED CONSTRUCTION RELATED AND REQUIRE ADDITIONAL BEST MANAGEMENT PRACTICES (BMPS) OR PLAN REVIEW FOR COMPLIANCE WITH THE GENERAL PERMIT. (CSW PERMIT ITEM 2.7 AND SECTION 23) ADDITIONAL BMPS OR OTHER SPECIFIC CONSTRUCTION RELATED IMPLEMENTATION ACTIVITIES IDENTIFIED IN AN APPROVED TOTAL MAXIMUM DAILY LOAD (TMDL) INCLUDE IMMEDIATE STABILIZATION OF EXPOSED SOIL MEAS AND CONSTRUCTION OF A TEMPORARY SEDIMENTATION BASIN FOR COMMON DRAINAGE LOCATIONS THAT SERVE AN AREA WITH 5 OR MORE ACRES (CSW PERMIT ITEM 5.19) 2.2 PUBLIC WATERS WITH WORK IN WATER RESTRICTIONSTHIS PROJECT DOES NOT INCLUDE WORK IN PUBLIC WATERS. (CSW PERMIT ITEM 5.11) 2.3 WETLAND IMPACTS THIS PROJECT DOES NOT INCLUDE WETLAND IMPACTS. (CSW PERMIT ITEMS 2 4 AND 210, AND SECTION 22) 2.4 ENVIRONMENTAL RENEW AND OTHER REWIRED REVIEWS. STORMWATER MITIGATION MEASURES ME NOT REWIRED ASA RESULT OF AN ENVIRONMENTAL REVIEW IF EAW OR EIS), ENDANGERED OR THREATENED SPECIES REVIEW, MCHEOLOGICAL SRM REVIEW, OR OTHER LOCAL, STATE, OR FEDERAL REVIEW CONDUCTED FOR THE PROJECT. (CSW PERMIT ITEMS 2.8, 2.9, AND 5.16) 2.5 KARST AREAS OR DRINKING WATER SUPPLY MANAGEMENT AREAS: THIS PROJECT DOES NOT INCLUDE ANY KARST OR DRINKING WATER SUPPLY MANAGEMENT MFRS. (CSW PERMIT ITEMS 16.19, 1620, AND 18.10) LOCATIONS OF AREAS NOT BE BE DISTURBED (E G., BUFFER ZONES, WETLANDS, ETC.) C-0B,C-14,C-16 LOCATIONS OF AREAS OF STEEP SLOPES C06,C-14,C-16 LOCATIONS OF MEAS WHERE CONSTRUCTION WILL BE PHASED TO MINIMIZE DURATION NA OF EXPOSED SOILS PORTIONS OF THE SITE THAT DRAIN TO A PUBLIC WATER WITH DNR WORK IN WATER NA RESTRICTIONS FOR FISH SPAWNING TIMEFRAMES LOCATIONS OF ALL TEMPORARY MD PERMANENT EROSION AND SEDIMENT CONTROL C -03,G-05,0-06 BMPS AS REQUIRED IN PERMIT SECTIONS 8 THROUGH 10 AND 14 THROUGH 19 BUFFER ZONES AS REQUIRED IN PERMIT ITEMS 9.17 AND 23.11 C-N.C-14.0-16 LOCATIONS OF POTENTIAL POLLUTION -GENERATING ACTIVITIES IDENTIFIED IN PERMIT 0-06.014,616 SECTION 12 STANDARD DETAILS FOR EROSION AND SEDIMENT CONTROL BMPS TO BE INSTALLED C4M AT THE SITE 4.0 BEST MANAGEMENTPRACTICES (BMPS): 4.1 EROSION PREVENTION PRACTICES: 1. BEFORE LAND DISTURBING ACTIVITIES BEGIN, THE LIMITS OF THE MEAS TO BE DISTURBED DURING CONSTRUCTION WILL BE DELINEATED WITH FLAGS, STAKES. SIGNS, SILT FENCE, ETC. 2. TEMPORARY STABILIZATION OF SOILS AND SOIL STOCKPILES: (CSW PERMIT ITEMS 8 4.8 5, AND 23.9) a. AREAS OF EXPOSED SOIL WILL BE STABILIZED WITH ERASION CONTROL BLANKET, PRESERVATION OF MATURE VEGETATION, MULCH OR EQUIVALENT MEASURES. b. IF PRESENT, SOIL STOCKPILES WILL BE STABILIZED WITH MULCH (SUCH AS STRAW MULCH, EROSION CONTROL BLANKETS OR EQUIVALENT MEASURES. c. TEMPORARY STOCKPILES WITHOUT SIGNIFICANT SILT,CLAY, OR ORGANIC COMPONENTS (E.G., CLEAN AGGREGATE STOCKPILES. DEMOLITION CONCRETE STOCKPILES, SMD STOCKPILES) AND THE CONSTRUCTED BASE COMPONENTS OF ROADS, PARKING LOTS, AND SIMILAR SURFACES ME EXEMPT FROM THESE STABILIZATION REQUIREMENTS. 2. STABILIZATION OF DITCH AND SWALE WETTED PERIMETERS: (CSW PERMIT ITEMS 86 THROUGH 8.8) a. IF SOILS WITHIN EXISTING STORMWATER DITCHES OR SWALES ME DISTURBED, THEY WILL BE STABILIZED WITH CHANNEL EROSION CONTROL BLMKET, RIPRM, TURF REINFORCEMENT MAT OR EQUIVALENT MEASURES. b. MULCH, HYDROMULCH, TACKIFIER, POLYACRYLAMIDE, OR SIMILAR EROSION PREVENTION PRACTCES WILL NOT BE USED TO STABILIZE MY PART OF AN EXISTING STORMWATER DITCH OR SWALE WITH A CONTINUOUS SLOPE OF GREATER THAN 2 PERCENT. c. THE LAST 200 LINEAL FEET OF LENGTH OF THE NORMAL WETTED PERIMETER OF MY TEMPORARY OR PERMANENT DITCH OR SWALE THAT DRAINS WATER FROM ANY PORTION OF THE CONSTRUCTION SITE, OR DIVERTS WATER MOUND THE SITE. WITHIN 200 LINEAL FEET FROM THE PROPERTY EDGE, OR FROM THE POINT OF DISCHARGE INTO MY SURFACE WATER WILL BE STABILIZED WITHIN 24 HOURS AFTER CONNECTING TO A SURFACE WATER OR PROPERTY EDGE. d. STABILIZATION OF THE REMAINING PORTIONS OF ANY TEMPORARY OR PERMANENT DITCHES OR SWALES WILL BE COMPLETED WITHIN 14 CALENDAR DAYS AFTER CONNECTING TO A SURFACE WATER OR PROPERTY EDGE AND CONSTRUCTION IN THAT PORTION OF THE DITCH HAS TEMPORARILY OR PERMANENTLY CEASED. 3. ENERGY DISSIPATION AT PIPE OUTLETS: ENERGY DISSIPATION AT PIPE OUTLETS WILL BE PROVIDED WITH ONE OR MORE OF THE FOLLOW METHODS: RIP RM, SPLASH PADS, GABIONS, OR EQUIVALENT MEASURES. (GSW PERMIT ITEM 8.9) 4. EROSION PREVENTION IMPLEMENTATION TIMELINES: (CSW PERMIT ITEMS 5.4 8A THROUGH 8.6. AND 23.9) a. STABILIZATION OF EXPOSED SOIL MEAS (INCLUDING STOCKPILES) WILL BE INITIATED IMMEDIATELY TO LIMIT SOIL EROSION WHENEVER ANY CONSTRUCTION ACTIVITY HAS PERMANENTLY OR TEMPORARILY CEASED ON ANY PORTION OF THE SITE MD WILL NOT RESUME FOR A PERIOD EXCEEDING 14 CALENDAR DAYS. b. IF THE EXPOSED SOIL AREAS DRAIN TO A DISCHARGE POINT THAT IS WITHIN ONE MILE (AERIAL RADIUS MEASUREMENT) OF A SPECIAL OR IMPAIRED WATER (SEE SECTION 2.0), STABILIZATION OF EXPOSED SOIL MEAS (INCLUDING STOCKPILES) WILL BE INITIATED IMMEDIATELY TO LIMIT SOIL EROSION WHENEVER MY CONSTRUCTION ACTNDY HAS PERMANENTLY OR TEMPORARILY CEASED ON MY PORTON OF THE SITE AND WILL HOT RESUME FOR A PERIOD EXCEEDING T CALENDAR DAYS. c. THE FOLLOWING ACTIVITIES CAN BE TAKEN TO INITIATE STABILIZATION: PREPPING THE SOIL FOR VEGETATIVE OR NON -VEGETATIVE STABILIZATION, APPLYING MULCH OR OTHER NON -VEGETATIVE PRODUCT TO THE EXPOSED SOIL AREA, OR SEEDING OR PLANTING THE EXPOSED AREA. 5, ADDITIONAL EROSION PREVENTION MEASURES: THE FOLLOWING ADDITIONAL EROSION PREVENTION METHODS WILL BE IMPLEMENTED AT THE SITE DURING CONSTRUCTION: (CSW PERMIT ITEMS 8.2, 8.3, AND 8.10) a. SOIL DISTURBANCE WILL BE MINIMIZED WHEREVER POSSIBLE TO AID IN EROSION PREVENTON. I . EXISTING VEGETATION WILL BE PRESERVED WHEREVER POSSIBLE TO LIMIT EXPOSED SOIL AND THUS WILL SERVE AS NATURAL VEGETATIVE BUFFERS. c. EXPOSED SOIL ON STEEP SLOPES (51HAV) WILL BE STABILIZED USING EROSION CONTROL BLANKETS AND SEEDING. d. HORIZONTAL SLOPE GRADING WILL BE UTILIZED TO MINIMIZE EROSION POTENTIAL. s. TERRACING WILL BE USED TO MINIMIZED EROSION POTENTIAL. 4.2 SEDIMENT CONTROL PRACTICES: 1. DOWNGRADIENT PERIMETER CONTROLS: (CSW PERMIT ITEMS 9.2 THROUGH 98) a. SEDIMENT CONTROL PRACTICES WILL BE ESTABLISHED ON ALL DOWNGRADIENT PERIMETERS AND LOCATED UPGRADIENT OF ANY BUFFER ZONES. PERIMETER SEDIMENT CONTROLS WILL INCLUDE: SILT FENCE, SEDIMENT CONTROL LOGS / BIOROLLS (FILLED WITH COMPOST, WOOD CHIPS, ROCK, ETC.). VEGETATIVE BUFFERS (RETAIN EXISTING VEGETATION WHERE POSSIBLE), OR EQUIVALENT MEASURES. b. PERIMETER SEDIMENT CONTROL PRACTICES MUST BE INSTALLED BEFORE ANY UPMADIENT LAND -DISTURBING ACTIVITIES BEGIN AND REMAIN IN PLACE UNTIL PERMANENT COVER HAS BEEN ESTABLISHED. c. IF SEDIMENT CONTROL PRACTICES HAVE BEEN ADJUSTED OR REMOVED TO ACCOMMODATE SHORT-TERM ACTIVITIES (SUCH AS CLEARING, GRUBBING, OR PASSAGE OF VEHICLES), THE CONTROLS MUST BE REINSTALLED IMMEDIATELY AFTER THE SHORT-TERM ACTIVITY HAS BEEN COMPLETED. SEDIMENT CONTROL PRACTICES MUST BE RE -INSTALLED BEFORE THE NEXT PRECIPITATION EVENT, EVEN IF THE SHORT-TERM ACTIVITY IS NOT COMPLETE. d. IF THE DOWNGRADIENT SEDIMENT CONTROLS ME OVERLOADED (BASED ON FREQUENT FAILURE OR EXCESSIVE MAINTENANCE REQUIREMENT), INSTALL ADDITIONAL UPGRADIENT SEDIMENT CONTROL PRACTICES OR REDUNDANT BMPS TO ELIMINATE THE OVERLOADING MD AMEND THE SWPPP TO IDENTIFY THESE ADDITIONAL PRACTICES. 2. SOIL STOCKPILE PERIMETER CONTROLS: TEMPORARY SOIL STOCKPILES WILL BE SURROUNDED BY: DOUBLE ROWS OF SILT FENCE. SEDIMENT CONTROL LOGS OR EQUIVALENT MEASURES, AND SHALL NOT BE PLACED IN MY NATURAL BUFFERS OR SURFACE WATERS.(GSW PERMIT ITEMS 9.9 AND 9.10) 3. STORM DRAIN INLET PROTECTION: (GSW PERMIT ITEMS 9.7 AND 9.8) a. INLET PROTECTION BMPS WILL BE INSTALLED AROUND ALL STORM DRAIN INLETS DOWNGRADIENT OF CONSTRUCTION ACTIVITIES. b. STORM DRAIN INLETS WILL BE PROTECTED UNTIL ALL SOURCES WITH POTENTIAL FOR DISCHARGING TO THE INLET HAVE BEEN STABILIZED. C. INLET PROTECTION BMPS WILL BE: SEDIMENT CONTROL LOG, FILTER SACKS, OR EQUIVALENT MEASURES. 4. VEHICLE TRACKING BMPS: {CSW PERMIT ITEMS 9.11 AND 9.12) a. VEHICLE TRACKING BMPS WILL BE INSTALLED TO MINIMIZE THE TRACKING OUT Of SEDIMENT FROM WE CONSTRUCTION AREA AND WILL INCLUDE: ROCK PADS AND MUD MATS OR AN EQUIVALENT SYSTEM. b. IF SUCH VEHICLE TRACKING BMPS ME NOT ADEQUATE TO PREVENT SEDIMENT FROM BEING TRACKED ONTO THE PAVED ROAD, STREET SWEEPING WILL ALSO BE EMPLOYED. SEDIMENT WILL BE REMOVED BY SWEEPING WITHIN 24 HOURS. S. PROTECTION OF INFILTRATON MEAS: IF NECESSARY, ADDITIONAL SEDIMENT CONTROLS (E.G.. DIVERSION BERMS) WILL BE INSTALLED TO KEEP RUNOFF AWAY FROM PLANNED INFILTRATION MEAS WHEN EXCAVATED PRIOR TO ESTABLISHING PERMANENT COVER WITHIN THE CONTRIBUTING DRAINAGE AREA. (CSW PERMIT ITEMS 16.4 MID 16.5) 6. MINIMIZATION OF SOIL COMPACTION AND PRESERVATION OF TOPSOIL: SOIL COMPACTION WILL BE MINIMIZED AND TOPSOIL WILL BE PRESERVED WHERE POSSIBLE. (GSW PERMIT ITEMS 5.24, 9.14, AND 9.15) T. PRIORITIZATION OF ONSITE INFILTRATION AND SEDIMENT REMOVAL.{CSW PERMIT ITEM 9.16) a. PRIOR TO OFFSITE DISCHARGE. INFILTRATION AND SEDIMENT REMOVAL WILL BE IMPLEMENTED ONSITE WHERE POSSIBLE. b. DISCHARGES FROM BMPS WILL BE DIRECTED TO VEGETATED MEAS OF THE SITE (INCLUDING ANY NATURAL BUFFERS) IN ORDER TO INCREASE SEDIMENT REMOVAL AND MAXIMIZE STORMWATER INFILTRATION. IF EROSION IS NOTED TO OCCUR AS THE RESULT OF SUCH A DISCHARGE, VELOCITY DISSIPATION BMPS WILL BE CONSIDERED AND INSTALLED AS NECESSARY TO PREVENT EROSION. 8. BUFFER ZONE OR REDUNDANT SEDIMENT CONTROLS TO PROTECT SURFACE WATERS: (CSW PERMIT ITEM 9.17) a. A 50 -FOOT NATURAL BUFFER WILL BE PRESERVED IN CONSTRUCTION MEAS DISCHARGING TO A NONSPECIA-IKON-IMPAIRED SURFACE WATER OR WETLAND, IF A NOWSPECIAUNON-IMPAIRED SURFACE WATER OR WETLAND IS LOCATED WITHIN W FEET OF THE PROJECTS EARTH DISTURBANCES AND STORMWATER FLOWS TO THE SURFACE WATER, OR WHEN A BUFFER IS INFEASIBLE. REDUNDANT SEDIMENT CONTROLS WILL BE PROVIDED. b. A100 00T NATURAL BUFFER WILL BE PRESERVED IN CONSTRUCTION MEAS DISCHARGING TOA SPECIAL OR IMPAIRED SURFACE WATER. IF A SPECIAL OR IMPAIRED SURFACE WATER IS LOCATED WITHIN 100 FEET OF THE PROJECTS EARTH DISTURBANCES AND STORMWATER FLOWS TO THE SURFACE WATER, OR WHEN A BUFFER IS INFEASIBLE. REDUNDANT SEDIMENT CONTROLS WILL BE PROVIDED. c. REDUNDANT PERIME ER CONTROLS WILL BE INSTALLED AT LEAST 5 FEET APART UNLESS LIMITED BY LACK OF AVAILABLE SPACE. 9, USE OF SEDIMENTATION TREATMENT CHEMICALS (E.G., POLYMERS, FLOCCULANTS. ETC.) IS NOT ANTICIPATED AS PART OF THE PROJECT. (CSW PERMIT ITEMS 5.22 AND 9.18) 10. THE PROJECT WILL NOT INCLUDE 10 OR MORE ACRES OF DISTURBED SOIL DRAINING TO A COMMON LOCATION OR 5 OR MORE ACRES DRAINING TO A COMMONLOCATION WITHIN 1 MILE OR A SPECIAL OR IMPAIRED WATER THEREFORE TEMPORARY SEDIMENT BASINS ME NOT REQUIRED. (CSW PERMIT ITEMS SS, 9.13, AND 23.10 AND SECTION 14) 4.3 DEWATERING AND BASIN DRAINING: NO DEWATERING OR BASIN DRAINING WILL OCCUR AS PMT OF THIS PROJECT. (CSW PERMIT SECTION 10 AND ITEM 10 5) 4.4 BMP DESIGN FACTORS: THE FOLLOWING BMP DESIGN FACTORS HAVE BEEN CONSIDERED IN DESIGNING THE TEMPORARY EROSION PREVENTION AND SEDIMENT CONTROL BMPS: 1. EXPECTED AMOUNT, FREQUENCY,INTENSITY, AND DURATION OF PRECIPITATION. 2. NATURE OF STORMWATER RUNOFF MD RUN-ON AT THE SITE, INCLUDING FACTORS SUCH AS EXPECTED FLOW FROM IMPERVIOUS SURFACES, SLOPES, AND SITE DRAINAGE FEATURES. 3. STORMWATER VOLUME, VELOCITY, AND PEAK FLOW RATES TO MINIMIZE DISCHARGE OF POLLUTANTS IN STORMWATER AND TO MINIMIZE CHANNEL MD STREAMSMK EROSION AND SDOUR IN THE IMMEDIATE VICINITY OF DISCHARGE POINTS. 4. RANGE OF SOIL PARTICLE SIZES EXPECTED TO BE PRESENT. (SEE PAGE 2 O 2) 90% DESIGN a ,w LANDSLIDE REPAIRS zatatota.aa �pa�vmi ,rE 9ARR ENGMEFRIN(i W. ,Yla,S MM•3otA �i R:f00MMKElPo1NIE D111YE a'••� Eff HCRRA CHANHASSEN, MN 0.1ENT PRGJECT xo. ,• D/'1Rl'i s�.M zoo _ xua - MNRNEAPOl16. MN 55135 Ala MINNEAPOLIS, MN STORM WATER POLLUTION PREVENTION PLAN RELEASEDA B G ON'3,W REV. No. NO. aY HR APP DATE REVISION DESCRIPTION CDH• TO*OR MIE RELEASED R , �P :«rte'."4m' "N1O1e4 AKH (SWPPP) C-05 D 5.0 PERMANENT STORMWATER MANAGEMENT SYSTEM' A PERMANENT STORMWATER MANAGEMENT SYSTEM IS REQUIRED IF THE PROJECT RESULTS IN ONE ACRE OR MORE OF NEW IMPERVIOUS SURFACES OR RESULTS IN A NET INCREASE OF ONE OR MORE ACRES OF CUMMULATIVE NEW IMPERVIOUS SURFACES IN TOTAL OR IF THE PROJECT IS PART OF A LARGER PLAN OF DEVELOPMENT. (CSW PERMIT ITEM 15.3) 5.1 A PERMANENT STORMWATER TREATMENT SYSTEM IS NOT REQUIRED. (CSW PERMIT ITEMS 5.15,15.0.15.9, AND 23.14) 5.2 THIS IS NOT A LINEAR PROJECT WITH LACK OF RIGHT OR WAY. (CSW PERMIT ITEM 15.9) 5.3 THIS PROJECT GOES NOT DISCHARGE TO A TROUT STREAM (OR A TRIBUTARY TO A TROUT STREAM). (CSW PERMIT ITEM 23.12) 6 0 INSPECTION AND MAINTENANCE ACTIVITIES 6.1 PERSONS WITH REQUIRED TRAINING: TRAINED INDIVIDUALS INCLUDE THOSE PARTES RESPONSIBLE FOR INSTALLING. SUPERVISING, REPAIRING, INSPECTING, AND MAINTAINING EROSION PREVENTION AND SEDIMENT CONTROL BMPS AT THE SITE. TRAINED INDIVIDUALS ME ALSO RESPONSIBLE FOR IMPLEMENTATION OF THE SWPPP AND COMPLIANCE WITH THE GENERAL PERMIT UNTIL THE CONSTRUCTION ACTIVITIES ME COMPLETE, PERMANENT COVER HAS BEEN ESTABLISHED, AND A NOTICE OF TERMINATION (NOT) HAS BEEN SUBMITTED. (CSW PERMIT ITEMS 5.20, 5.21, AND 11.9 AND SECTION 21) THESE INDIVIDUALS WILL BE TRAINED IN ACCORDANCE WITH THE REQUIREMENTS OF THE GENERAL PERMIT, INCLUDING THE REQUIREMENT THAT THE CONTENT AND EXTENT OF TRAINING WILL BE COMMENSURATE WITH THE INDIVIDUAL'S JOB DUTIES AND RESPONSIBILITIES. BELOW IS A LIST OF PEOPLE RESPONSIBLE FOR THIS PROJECT WHO ME KNOWLEDGEABLE AND EXPERIENCED IN THE APPLICATION OF EROSION PREVENTION AND SEDIMENT CONTROL BMPS. TRAINED INDIVIDUAL RESPONSIBILITY TRAINING ENTRY' TRAINING DATE ERIC FITZGERALD PREPARATION OF THE SWPPP UNNERSRYOF MINNESOTA SEPTEMBER2017 TBD OVERSIGHT OF SWPPP IMPLEMENTA- TBD TBD TION, REVISION, AND AMMENDMENT TBD PERFORMANCE OF SWPPP INSPECTIONS TBD TBD TBD PERFORMANCE OR SUPERVISION OF TBD TBD INSTALLATION, MAINTENANCE, AND REPAIR OF BMPS `TRAINING DOCUMENTATION AVAILABLE UPON REQUEST 62 FREQUENCY OF INSPECTIONS: A TRAINED PERSON WILL ROUTINELY INSPECT THE ENTIRE CONSTRUCTION SITE. (CSW PERMIT ITEMS 112, 11.10. MD 23.13) • AT LEAST ONCE EVERY 7 DAYS DURING ACTIVE CONSTRUCTION • WITHIN 24 HOURS AFTER A RAINFALL EVENT GREATER THAN 0.5 INCHES IN 24 HOURS INSPECTION FREQUENCY MAY BE ADJUSTED UNDER THE FOLLOWING CIRCUMSTANCES: • WHERE PARTS OF THE CONSTRUCTION AREAS HAVE PERMANENT COVER, BUT WORK REMAINS ON OTHER PARTS OF THE SITE, INSPECTIONS OF THE AREAS WITH PERMANENT COVER MAY BE REDUCED TO ONCE PER MONTH. • WHERE CONSTRUCTION AREAS HAVE PERMANENT COVER AND NO CONSTRUCTION ACTMTY IS OCCURRING ON THE SITE, INSPECTIONS CM BE REDUCED TO ONCE PER MONTH AND, AFTER 12 MONTHS, MAY BE SUSPENDED COMPLETELY UNTIL CONSTRUCTION ACTIVITY RESUMES. • WHERE CONSTRUCTION ACTIVITY HAS BEEN SUSPENDED DUE TO FROZEN GROUND CONDITIONS, THE INSPECTIONS MAY BE SUSPENDED. THE REQUIRED INSPECTIONS AND MAINTENANCE SCHEDULE MUST BEGIN WITHIN 24 HOURS AFTER RUNOFF OCCURS AT THE SITE OR UPON RESUMING CONSTRUCTION, WHICHEVER COMES FIRST. 6.3 INSPECTION REQUIREMENTS: EACH CONSTRUCTION STORMWATER SITE INSPECTION WILL INCLUDE INSPECTION OF THE FOLLOWING AREAS: (CSW PERMIT ITEMS 11.3 THROUGH 11.8) • ALL EROSION PREVENTION AND SEDIMENT CONTROL BMPS AND POLLUTION PREVENTION MANAGEMENT MEASURES • SURFACE WATERS FOR EVIDENCE OF EROSION AND SEDIMENT DEPOSITION • CONSTRUCTION SITE VEHICLE EXIT LOCATIONS FOR EVIDENCE OF OFFSITE SEDIMENT TRACKING • STREETS AND OTHER AREAS ADJACENT TO THE PROJECT FOR EVIDENCE OF OFF SITE ACCUMULATIONS OF SEDIMENT 6.4 MAINTENANCE REQUIREMENTS: MAINTENANCE OF THE FOLLOWING AREAS AND BMPS WILL BE PERFORMED AS FOLLOWS: (CSW PERMIT ITEMS 11.3 THROUGH 11.8) • NONFUNCTIONAL BMPS WILL BE REPAIRED, REPLACED, OR SUPPLEMENTED WITH FUNCTIONAL BMPS BY THE END OF THE NEXT BUSINESS DAY AFTER DISCOVERY OR AS SOON AS REM CONDITIONS ALLOW ACCESS. • PERIMETER CONTROL DEVICES WILL BE REPAIRED, REPLACED, OR SUPPLEMENTED WHEN THEY BECOME NONFUNCTIONAL OR THE SEDIMENT REACHES 12 OF THE HEIGHT OF THE DEVICE. • TEMPORARY AND PERMANENT SEDIMENTATION BASINS WILL BE DRAINED AND THE SEDIMENT REMOVED WHEN THE DEPTH OF SEDIMENT COLLECTED IN THE BASIN REACHES 12 THE STORAGE VOLUME. • DELTAS AND SEDIMENT DEPOSITED IN SURFACE WATERS WILL BE REMOVED. AND THE AREAS WHERE SEDIMENT REMOVAL RESULTS IN EXPOSED SOIL WILL BE RE-STASIUZEO. THE REMOVAL AND STABILIZATION WILL BE COMPLETED WITHIN ] CALENDAR DAYS OF DISCOVERY UNLESS PRECLUDED BY LEGAL, REGULATORY, OR PHYSICAL ACCESS CONSTRAINTS. IF PRECLUDED DUE TO ACCESS CONSTRAINTS, REASONABLE EFFORTS TO OBTAIN ACCESS WILL BE USED. REMOVAL AND STABILIZATION WILL TAKE PLACE WITHIN ] CALENDAR DAYS OF OBTAININGACCESS. • TRACKED SEDIMENT ON PAVED SURFACES WILL BE REMOVED WITHIN 1 CALENDAR DAY OF DISCOVERY. • AREAS UNDERGOING STABILIZATION WILL BE RESTABILIZED AS NECESSARY TO ACHIEVE REQUIRED COVER. 6.5 RECORDKEEPING REQUIREMENTS: (CSW PERMIT ITEM 11 11 AND 24.5 AND SECTIONS BAND 20) 1. ALL INSPECTIONS AND MAINTENANCE ACTIVITIES WILL BE RECORDED IN WRITING WITHIN 24 HOURS OF BEING CONDUCTED AND THESE RECORDS WILL BE RETAINED WITH THE SWPPP. RECORDS OF EACH INSPECTION AND MAINTENANCE ACTIVITY WILL INCLUDE THE DATE AND TIME; NAME OF INSPECTOR(S); FINDINGS OF INSPECTIONS; CORRECTIVE ACTIONS (INCLUDING DATES. TIMES. AND PARTY COMPLETING MAINTENANCE ACTIVITIES); AND DATE OF ALL RAINFALL EVENTS GREATER THAN 6.5 INCHES IN 24 HOURS AND THE AMOUNT OF RAINFALL FOR EACH EVENT. a. IF ANY DISCHARGE IS OBSERVED DURING THE INSPECTION, THE LOCATION AND APPEARANCE OF THE DISCHARGE (I.E., COLOR, ODOR, SETTLED OR SUSPENDED SOLIDS, OIL SHEEN, AND OTHER OBVIOUS INDICATORS OF POLLUTANTS) WILL BE DOCUMENTED AND A PHOTOGRAPH WILL BE TAKEN - 2. THE SWPPP WILL BE AMENDED TO INCLUDE ADDITIONAL OR MODIFIED BMPS TO CORRECT PROBLEMS OR ADDRESS SITUATIONS WHENEVER THERE IS A CHANGE IN DESIGN, CONSTRUCTION, OPERATION, MAINTENANCE, WEATHER, OR SEASONAL CONDITIONS THAT HAS A SIGNIFICANT EFFECT ON THE DISCHARGE OF POLLUTANTS TO SURFACE WATERS OR GROUNDWATER. a. THE SWPPP WILL BE AMENDED WHEN INSPECTIONS OR INVESTIGATIONS BY THE SITE OWNER, OPERATOR, OR CONTRACTORS OR BY USEPAJMPCA OFFICIALS INDICATE THAT THE SWPPP IS NOT EFFECTIVE IN ELIMINATING OR MINIMIZING THE DISCHARGE OF POLLUTANTS TO SURFACE WATERS OR GROUNDWATER: THE DISCHARGES ME CAUSING WATER QUALITY STANDARD EXCEEDMCES; OR THE SWPPP IS NOT CONSISTENT WITH A USEPA APPROVED TMDL. b. MY AMENDMENTS TO THE SWPPP PROPOSED AS A RESULT OF THE INSPECTION WILL BE DOCUMENTED AS REQUIRED WITHIN ] CALENDAR DAYS. c. AMENDMENTS WILL BE COMPLETED BY M APPROPRIATELY TRAINED INDIVIDUAL. CHANGES INVOLVING THE USE OF A LESS STRINGENT BMP WILL INCLUDE A JUSTIFICATION DESCRIBING HOW THE REPLACEMENT BMP IS EFFECTIVE FOR THE SITE CHARACTERISTICS. 3. RECORDS RETENTION: THE SWPPP, INCLUDING ALL CHANGES TO IT, AND INSPECTION AND MAINTENANCE RECORDS WILL BE KEPT AT THE SITE DURING CONSTRUCTION BY THE PERMITTEE WHO HAS OPERATIONAL CONTROL OF THE SITE. THE SWPPP CM BE KEPT IN EITHER A FIELD OFFICE OR IN M ON SITE VEHICLE DURING NORMAL WORKING HOURS. 4. RECORD AVAILABILITY: THE PERMITTEES WILL MAKE THE SWPPP, INCLUDING INSPECTION REPORTS, MAINTENANCE RECORDS, AND TRAINING RECORDS, AVAILABLE TO FEDERAL, STATE, AND LOCAL OFFICIALS WITHIN THREE DAYS UPON REQUEST FOR THE DURATION OF THE PERMIT COVERAGE AND FOR THREE YEARS FOLLOWING THE NOTICE OF TERMINATION. 1. ANY CONSTRUCTION PRODUCTS AND LANDSCAPE MATERIALS THAT HAVE THE POTENTIAL TO LEACH POLLUTANTS WILL BE STORED UNDER COVER (E.G.. PLASTIC SHEETING OR TEMPORARY ROOFS) TO PREVENT DISCHARGE OF POLLUTANTS THROUGH MINIMIZATION OF CONTACT WITH STORMWATER. STORAGE OF SUCH MATERIALS WITHIN THE PROJECT AREA WILL BE MINIMIZED TO THE EXTENT POSSIBLE. (CSW PERMIT ITEM 12 2) 2. PESTICIDES, FERTILIZERS, AND TREATMENT CHEMICALS WILL BE STORED UNDER COVER (E.G., PLASTIC SHEETING, TEMPORARY ROOFS, WITHIN A BUILDING, OR IN WEATHER-PROOF CONTAINERS) TO PREVENT DISCHARGE OF POLLUTANTS THROUGH MINIMIZATION OF CONTACT WITH STORMWATER. STORAGE OF SUCH MATERIALS WITHIN THE PROJECT AREA WILL BE MINIMIZED THE EXTENT POSSIBLE. (CSW PERM, RE M 12.3) 3HAZARDOUS MATERIALS AND TOXIC WASTE(E.G.,OIL DIESEL FUEL, GASOLINE HYDRAULIC FLUDSPAINT SOLVENTS PETROLEUM E PRODUCTS,PRESERVATIVES, P -BAS D N COM ADDITIVES, CURING COMPOUNDS, AND ACIDS)WILL C STORED MODISPOSED OFIN COMPLIANCE WITH MINNESOTA RULES CHAPTER REDIINCLUDING SECONDARY CONTAINMENT (M APPLICABLE). HAZARDOUS ARTESAN WILL E PROPERLY STORED IN SEALED CONTAINERSNT PREVENT SPILLS LEAKS. OROTHER DISCHARGES PE PREVENT PRECIPITATION FROM FALLING ONTO THE CONTAINERS OR STORED HAZARDOUS MATERIALS. (CSW PERMIT NEMS AND 1 4, SOLID WASTE WILL BE COLLECTED STORED, DISPOSED OF PROPERLY IN COMPLIANCE WITH MINNESOTA RULES CHAPTER ]035. THIS INCLUDES STORAGE WITHIN COVERED TRASH CONTAINERS AND DAILY REMOVAL OF LISTER AND DE8R15. STORAGE SOLID WASTE WITHIN THE PROJECT AREA WILL BE MINIMIZED TO THE EXTENT POSSIBLE. (CSW PERMIT REM 12.2. 5) 5. GROUNDPORTABLESTOILETSWILLBE LOCATED AWAY NOFROM SURFACE WATERS AND POSITIONED AND SECURED TO THE GROUND N THEY WILL NOT BE TIPPED, C KNOCKED OVER. SANITARY WASTE WILL BE DISPOSED OF IN M ACCORDANCE WITH MINNESOTA RULES. CHAPTER HAULER. PR. (CSW TOILETS WILL BE PERIODICALLY EMPTIED AND THE WASTE HAULED OFFSITE BY A LICENSED /DARER. (CSW PERMIT REM 12.6) 6. VEHICLE FUELING WILL ONLY OCCUR IN DESIGNATED AREAS. SPILL KITS SIZEDLE RATELFOR THE AMOUNT OF REFUELING TAKING PLACE WILL LOCATED. SPILL KITS WILL BE CLEARLY LY LABELED AND D CONTAIN MATERIALS TO ASSIST IN SPILL CLEANUP INCLUDING ABSORBENT PADS, BOOMS FOR CONTAINING SPILLS, AND HEAVY-DUTY PROTECTIVE GLOVES. SPILLS WILL BE REPORTED TO THE MINNESOTA DUTY OFFICER AS REQUIRED BY MINNESOTA STATUTES, SECTION 115.061. (CSW PERMIT ITEMS 2.3 12.]ON-SITEa. ANY FUEL TANKS BROUGHT ON-SITE WILL HAVE PROPERLY SIZEDD C CONTAINMENT N D WILL NOT BE TOPPED OFF TO AVOID SPILLS FROM OVERFILLING. FUEL TANKS WILL MEET INDUSTRY STANDARDS (DESIGNED TO HOLD FUEL TYPE. PROPERLY MAINTAINED, NOT ILLEGALLY MODIFIED, NOT MISSING LEAN INDICATOR FLOATS FOR DOUBLE WALLED TANKS, SIGHT GAUGES NOT USED, ETC.) OR BE REMOVED FROM THE WORK AREA. b. GUIDELINES FOR SPILL PREVENTION AND RESPONSE INCLUDE: TAKE REMOVABLE STEPS TO PREVENT THE DISCHARGE OF SPILLED OR LEAKED CHEMICALS, INCLUDING FUEL, FROM MY AREA, WHERE CHEMICALS ORREFUEL WILL BE LOADED OR UNLOADED, INCLUDINGTHE USE OFDRIP PMSOR ASRUNLESS INFEASIBLE; VE PERFORM REGULAR PREVENTATIVE MAINTENANCE ON TANKS AND FUEL LINES; INSPECT PUMPS, CYLINDERS, HOSES, VALVES, AND OTHER MECHANICAL EQUIPMENT ON-SITE FOR DONATE OR DETERIORATION; DO NOT WASH U RINSE FUELING MEAS WITH WATER; APPROPRIATE ADEQUATE SUPPLIES D CLEARUPDISCHARGED MATERIALS S, PROVIDENT REPORT ANDS DISPOSAL METHOD FOR RECOVERED SPILLED MATERIALS; - REPORTMDCLEAN LE SPILLS MEASURES ERREQUIRED BY MINNESOTA STATUTES, SECT" 115.661, USING DRV CLEAN UP MEASURES WHERE POSSIBLE; MD MAINTAIN COPIES OF SAFETY DATA SHEETS (BOSS) FOR HAZARDOUS MATERIALS ONSITE IN LOCATIONS READILY AVAILABLE TO EMERGENCY RESPONDERS. ]. IF VEHICLE A EQUIPMENT WASHING IS NECESSARY, A VEHICLE WASH STATION WILL BE LOCATED N A DESIGNATEDD MEN. RUNOFF FROM THE WASHING MM AREA WILL BE CONTAINED IN A SEDIMENT BASIN D WASTE FROM THE WASHING ACTIVITY WILL N PROPERLY DISPOSED OF. ANY SOARS, DETERGENTS, OR SOLVENTS WILL M BE PROPERLY USED D STORED. ANY DETERGENTS MD OTHER CLEARERS NOT PERMITTED FOR DISCHARGE WILL NOT BE USED. (CSW PERMIT ITEMS 2.3 TE 12.8) 6, OF THE JECT STORAGLLNOT D DISPOSAL NOF CONCRETE AN OTHERHER WASHOHOUT UT WATIES. IF THAT NECESSARY, DESCRIPTION OFTHESTORAGE UNDISPOSALOFEDNCRETEMDOTHER WASHOUTWASTES SO THATWASTESWNOT CONTACT THE GROUND WILL BE ADDED. (CSW PERMIT ITEMS 2 3 AND 12.9) 8.0 PERMANENT COVER AND PERMIT TERMINATION CONDITIONS.- 1. ONDITIONS: 1. THE AREAS DISTURBED DURING CONSTRUCTION WILL BE STABILIZED WITH PERMANENT COVER UPON COMPLETION OF WORK. PERMANENT COVER MAY BE VEGETATIVE OR NON -VEGETATIVE. AS APPROPRIATE. ESTABLISHMENT OF PERMANENT COVER MAY INCLUDE THE FOLLOWING ACTIVITIES: SEEDING, MULCHING, AND EROSION CONTROL BLANKETS. (CSW PERMIT ITEM 5.1]) 2. FOR A CONSTRUCTION -SITS TO ACHIEVE 'PERMANENT COVER', THE FOLLOWING REQUIREMENTS MUST BE COMPLETED PRIOR TO TERMINATION OF PERMIT COVERAGE: (CSW PERMIT SECTIONS 4 AND 13) a. ALL SOIL DISTURBING CONSTRUCTION ACTIVITIES HAVE BEEN COMPLETED AND PERMANENT COVER HAS BEEN INSTALLED OVER ALL AREAS. VEGETATIVE COVER CONSISTS OF A UNIFORM PERENNIAL VEGETATION WITH A DENSITY OF 70% OF ITS EXPECTED FINAL GROWTH. VEGETATION IS NOT REQUIRED WHERE THE FUNCTION OF A SPECIFIC AREA DICTATES NO VEGETATION (SUCH AS IMPERVIOUS SURFACES OR THE BASE OF A SAND FILTER). b. ALL SEDIMENT HAS BEEN REMOVED FROM CONVEYANCE SYSTEMS, INCLUDING CULVERTS. c. ALL TEMPORARY SYNTHETIC EROSION PREVENTION AND SEDIMENT CONTROL BMPS HAVE BEEN REMOVED. BMPS DESIGNED TO DECOMPOSE ON-SITE MAY BE LEFT IN PLACE. WITHIN 30 DAYS AFTER THE TERMINATION CONDITIONS ME COMPLETE. A NOTICE OF TERMINATION (NOT) FORM WILL BE SUBMITTED TO THE MPCA. � ` n KF Ko m n w re. u1¢� \ Y A Ktz X0 Km Kc M t>sF Z Im Fm x• NL} MG �� 17 Kr xc IIw TB w w a e B 1tFl NM Nlwl KE} l Kc u Kn Km, Kc Kc Lw r w u I u 1°' xm �K xs K• uu ueC: l uLm Kaz n w c e Am WI 'Km Ka KIP 16i L1 un UN ,w Ib Ka xe r n K. Mt FBI LARK' LIR, n a •E• rs n Km tw TARE. �; �: Kc w KO I Lw iM l,l0f tJ r w Kl - Ko Km Km L«A, a L111 L•W OL Ko LIAR s .:� Km //La1L,o cnc un 4 Ka KIN KO• n Ke LpA LEK � �!. Ko UA] [e ts! i' K Km b' KF Im KU 1 _ s " u 1�t K,oA _ I K4 uv Q Errs 551YICn m OGugb•r•N - w+twrLKv+sr�h, Alit MebrMNMpr lair• KC} •! r MK' KL w M w LOA M LlY O Fg R IDNOGRAPI6C MAP WITH 0 10.000 ., T0.000 1 SIMMQ WMF15 AN0 fi0l TYPES SCAV: NFLkT 9vmeNSPCN6tPINwMbnYlEr f�w/CAMAF NieIINI• SOPIEW-, STATE ONE ,��CALL GOPHER STATE ONE CALL: CALL BEFORE YOU DIG. 1-00-252-1186 907', DESIGN NOT FOR CONSTRUCTION Mwm Wsw®wEoerlE umlurvac _- ^w•aono ASNWWN ar ENGINEERINGOO v,vmn LANDSLIDE REPAIRS zaToloTa.oa rKNo.. _ _ _ _ _ _ _ p D� wmo MnRNeTPOINIE GRrve HCRRA CHANHASSEN, MN GUEMrI�oiEGT No. - MINNE , MN SSxY' AM1 MINNEAPOLIS, MN STORM WATER POLLUTION PREVENTION PLAN 11 GWG. Ib. REV. No. A B c D o 1 2'•• a:.l�� (SWPPP) C-06 D No. BY GATE REVISION DESCRIPTION �� �• TOledt PATE REIEgRED en laEsaarr .•. ,yW n $1 els --- �� _ ___ i ' , � � �i � J .r'�' --,--•fry —_ , h � ` , �'� 1 - `_ --_--_ �PROPEIRY NORTH REPAIR AREA - —d4, `_ _-/� NEW FENCE, It S I NEW_ N1 _ 1 2 _ s t�GOT pin ___ T� IN \'W EXISTING YT—�y- 1• \ - _ -a _ - - �`WM — IaNT — _C_ _ — — — .� _ t1•WT-S— r������EXISTIN •� • + �,.. __ am S" AREA CULVERT OUTLET I' / ANDS ER C-14Nrc REPN0.. SEE SHEET GIJ �— �� -- � • •—ate• EXISTING NORMPIPE s & s sr.t o• e1\ va�5ea-- x ���— YZ\ —_ NEWDRAINGHPNIEL CGE CWRNIRM _ __.. L -] n•a _ SEE HEET_ L _ 1 19 NEW STORM SEWER. - ]BO SEE SNEETGm _ ------- ____ _ _ ---__ _ ST3 ' II CONSERVATONN EMENT i CONSTRUCTION D.i-c �11 PLAN: TRAIL MODIFICATIONS 4 o w too SCALE IN FEET -_ m w > EXISTING GRGUNO - _ - _ - ____- 020;1n -- - -\ -' Bft FlNISHED TRNL GRADE - - mvvc \,,� +Dave 0'00 1W0 2 W JMO C� 5+W 7+00 0. g+W PROFILE: TRAIL MODIFICATIONS o w IN o 6 o Hgt2 e W FEET VERT SCNE IN FEET VP ss xacf m s.artcs wrxEm,. rrtn wu[ m Gexsmvnrt,rr RELEASED A To1F012 e c I D 1 0 1 DATE RELEASEDH.�aooca�a' -- z p B ARR Iarm. BAHWRENGINEERING CO. 430 W'MARrcFTPOINTE DRIVE MILAN o MINNEAPOLIS, MN 55935 .„„.,mn Sy° As sMOWN iL1y2019 EPF �Fs1 M12 By NR APP. DATE I REVISION DESCRIPTION . "�Pe° MTP2 loK I1rC0 12H 13� LANDSLIDE REPAIRS HCRRA CHANHASSEN, MN MINNEAPOLIS, MN TRAIL MODIFICATIONS PLAN AND PROFILE ta•W 15W0 15-M 90% DESIGN NOT FOR CONSTRUCTION EFG OFFSET 2+00 IN �__���— 830 BA an 9+o e+o Boo 800 1850 4O .l0 -MI :10 0 10 ]0 3U eo 5dm FG OFFSET 2 Bao— ' = — RptlOe 4% —i-. LANDSLIDE REPAIRS e3o w MN _ _ _ _ _ _ — e3a w/ HCRRA MINNEAPOLIS, MN ex 23101014.04 830 - 830 - -- 820 330 i \ TRAIL MODIFICATIONS CROSS SECTIONS \x °�`^ BAPoi p REV. NP. D ax ax x 330FT�♦%_. I� 1>wTE 1 x —Bp em io-- - --– T ata 310 000 190 B10 810 p BID 190 1B0 `100 B3D. M .L -20 -t0 0 10 tll b IS b A BO .SW 0 11a9pD BW "So 1W fro SO 40 -30 -A -10 D +0 20 b JD FG OFFSET 3+00 ax ax 930 - 830 9ro BA 81o\ BA 900 A0 o IS am sl �o sd80 FG OFFSET 3+50 a0 .830 I BIC —. _ - - I - .810 900;�� I 40 JO -b -10 0 10 20 SO b W NOTE SEE G10 C2 FOR FURTHER DETAILS ON TML SECTIONS. INCLUDING 2% CROW SLOPE ON TRAIL SURFACE. FG OFFSET x+00 Baa - rIEI - Bao 030 �A I `\ ON 4% an B2o \\ BA 010 810 000 000 'm50 d0 30 -30 -10 0 10 N w b 5db FG OFFSET 0+60 Bao q.—T w 830 Bb EASTING GROUND (TTP.I ia% A%` BID L EINISHEOGMOEMP) ` 810 - - - 810 BU3 - Boo I� \- 30 40 -00 .A -10 0 10 20 SO b SO SO A b Co losb FG OFFSET 5+00 810 I - - -810 11gB�o '�50 AO -So -A -10 0 10 m 311 b SO w A BO 93 loo FG OFFSET 5150 ' = — RptlOe 4% � LANDSLIDE REPAIRS e3o 0 MN _ _ _ _ _ _ — e3a w/ HCRRA MINNEAPOLIS, MN ex 23101014.04 830 - 830 - -- 820 810 I - - -810 11gB�o '�50 AO -So -A -10 0 10 m 311 b SO w A BO 93 loo FG OFFSET 5150 FG OFFSET 6+00 Bao M. 830 Azo ' = — RptlOe 4% LANDSLIDE REPAIRS 0 MN _ _ _ _ _ _ — BARRENGINEERINGCA. R a MARNETPGINIE DRIVE D/'1r!brlb suave zoo BA MINNEAPOLIS. AN 55435 v1""e n�am�->m @alb -I�I—� 12/132019 HCRRA MINNEAPOLIS, MN CHANRAS$EN, MN 23101014.04 830 o..� EK CLIENT PROJECT NO. _ 330 i \ TRAIL MODIFICATIONS CROSS SECTIONS \x °�`^ BAPoi p REV. NP. D ax ax x 330FT�♦%_. I� 1>wTE 1 x —Bp em io-- - --– T ata 310 000 190 B10 p 190 1B0 `100 GI M .L -20 -t0 0 10 tll b IS b A BO .SW 0 11a9pD FG OFFSET 6+00 Bao M. 830 Azo ' = — RptlOe 4% LANDSLIDE REPAIRS —M�EA=l c�Txe yrtT[cr 1wL MN _ _ _ _ _ _ — BARRENGINEERINGCA. R a MARNETPGINIE DRIVE D/'1r!brlb suave zoo BA MINNEAPOLIS. AN 55435 v1""e n�am�->m @alb -I�I—� 12/132019 HCRRA MINNEAPOLIS, MN CHANRAS$EN, MN 23101014.04 _ _ _ _ TRE1dFO�R A S C D 0 1 2 o..� EK CLIENT PROJECT NO. _ 330 i IH. TRAIL MODIFICATIONS CROSS SECTIONS \x °�`^ BAPoi OWG HO. REV. NP. D N0. BY LXK APP GATE REV*" DE 330FT�♦%_. 1>wTE 1 —Bp em ISO 310 000 190 B10 190 1B0 _ .SW 3W 1W fro 190 rsD. no 100 _ 1W 75050 d0 W -1(I -10 a 10 30 30 40 50 50 10 SO 90 103 110 In 130 +JO 150 +fi6A FG OFFSET 6+50 890 530 In 810 8[O 193 FG OFFSET T+00 90% DESIGN ' = — RptlOe ASSHOI00 LANDSLIDE REPAIRS —M�EA=l c�Txe yrtT[cr 1wL MN _ _ _ _ _ _ — BARRENGINEERINGCA. R a MARNETPGINIE DRIVE D/'1r!brlb suave zoo BA MINNEAPOLIS. AN 55435 v1""e n�am�->m @alb -I�I—� 12/132019 HCRRA MINNEAPOLIS, MN CHANRAS$EN, MN 23101014.04 _ _ _ _ TRE1dFO�R A S C D 0 1 2 o..� EK CLIENT PROJECT NO. _ 330 i LaPz TRAIL MODIFICATIONS CROSS SECTIONS \x °�`^ BAPoi OWG HO. REV. NP. D N0. BY LXK APP GATE REV*" DE 330FT�♦%_. 1>wTE 1 —Bp 310 B10 .SW 3W 190 rsD. Tm. it - `nu m IbdO �0 40 -10 0 10 20 SO b SO b A 90 SO 100 110 120 120 tb 15dA 90% DESIGN ' = — RptlOe ASSHOI00 LANDSLIDE REPAIRS —M�EA=l c�Txe yrtT[cr 1wL MN _ _ _ _ _ _ — BARRENGINEERINGCA. R a MARNETPGINIE DRIVE D/'1r!brlb suave zoo BA MINNEAPOLIS. AN 55435 v1""e n�am�->m @alb -I�I—� 12/132019 HCRRA MINNEAPOLIS, MN CHANRAS$EN, MN 23101014.04 _ _ _ _ TRE1dFO�R A S C D 0 1 2 o..� EK CLIENT PROJECT NO. _ LaPz TRAIL MODIFICATIONS CROSS SECTIONS °�`^ BAPoi OWG HO. REV. NP. D N0. BY LXK APP GATE REV*" DE 1>wTE 1 FG OFFSET 1450 gam,----� SO B30 820 810 am ro 110 12310 FG OFFSET 8400 030 — -- I - am x 4% an an 810 _ -. — _-. -_ - —. 810 800 -. - -. _ BN Tso -. — _ __ .. - - - - - - .Iso Im50 JO -30 -m .10 0 10 A m 60 50 00 m BO 96 IWIN IFG OFFSET 8450 aw —Q aw Bm 8 0 x�41. ani 1 030 810- BID NOT c' SEE Gp G1O Fp FURTHER DETNLS ON TRAIL SECIpNg. M MNNHS 2%CROSE SLOPE ON T adL SIIRFFCE. FG OFFSET 9400 am 030 4% - - e% \ - 830 am 830 810 810 W(I 800 190w A0 40 -m -10 o 10 m 30 m sa Bo m m 1n w�0 FG OFFSET 8450 B50 B40 I 860 EXISTING GROUND I FI 'r .830 em- - FINISHEDG�E�(1T'P.) \ \ ezo 810 - - 1 810 800w eo -30 .m .to o to m 30 bo Sow FG GFFSET 10600 4%—___ 4% �. Bao ago 8mr.',,an 810— 810 1r W%0 40 -b -20 -10 0 10 m b 40 5p P,,.eRlb R RENGMEERING LO. 43W MMKETFOIM DRN Su. MD MINNEAPOLIS. MN 55435 HCRRA MINNEAPOLIS, MN FG OFFSET 0450 850 B0 IBM X81100 000Ii- D .30 -m -10 0 10 m 30 40 50 FG OFFSET 1 00 8401, - BOa� I - -21 goo 190 i -Bm �.I90 IBU40 40 .1 4W -HI 0 t0 . . . . m m n an 100 NOT c' SEE Gp G1O Fp FURTHER DETNLS ON TRAIL SECIpNg. M MNNHS 2%CROSE SLOPE ON T adL SIIRFFCE. FG OFFSET 9400 am 030 4% - - e% \ - 830 am 830 810 810 W(I 800 190w A0 40 -m -10 o 10 m 30 m sa Bo m m 1n w�0 FG OFFSET 8450 B50 B40 I 860 EXISTING GROUND I FI 'r .830 em- - FINISHEDG�E�(1T'P.) \ \ ezo 810 - - 1 810 800w eo -30 .m .to o to m 30 bo Sow FG GFFSET 10600 4%—___ 4% �. Bao ago 8mr.',,an 810— 810 1r W%0 40 -b -20 -10 0 10 m b 40 5p P,,.eRlb R RENGMEERING LO. 43W MMKETFOIM DRN Su. MD MINNEAPOLIS. MN 55435 HCRRA MINNEAPOLIS, MN FG OFFSET 0450 850 B0 IBM X81100 000Ii- D .30 -m -10 0 10 m 30 40 50 FG OFFSET 1 00 FG OFFSET 1450 i 030 am em am _�� 81050 d0 JO -m -1a a 10 A m tl 10 FG OFFSET 12400 810 ?1 � 040 I Bm 820 810/ _m -10 0 10 m 30 ba w810 LANDSLIDE REPAIRS CHANHASSEN,MN TRAIL MODIFICATIONS CROSS SECTIONS 90% DESIGN A CONSTRUCTION 07 PROTECT M 23101014.04 CMENT PROJECT W. owc NP REM. " C-09 D 8401, - - - -21 -Bm -10 o 10 m 3B 4B �10 FG OFFSET 1450 i 030 am em am _�� 81050 d0 JO -m -1a a 10 A m tl 10 FG OFFSET 12400 810 ?1 � 040 I Bm 820 810/ _m -10 0 10 m 30 ba w810 LANDSLIDE REPAIRS CHANHASSEN,MN TRAIL MODIFICATIONS CROSS SECTIONS 90% DESIGN A CONSTRUCTION 07 PROTECT M 23101014.04 CMENT PROJECT W. owc NP REM. " C-09 D NORTH SIDE 5MIN. SHOULDER, I 10'TRAIL 5MIN. SHOUWER �SSOIITH SIE f L5 15' � o% 0% ExlsnNc cRouNO ° 1 — A% i 610PSOIL AID SEED (iVP.I 3"MICKYH'MINUS AGGREGATE SURFACING SPECIAL \ \ PR EPARE TOP tY OF SUBGRAOE IN ACCORDANCE (SEE TABLE 1 FOR GRADATION) (WET \ WITH MnOOTSTANOARO 2112 G THICK �T CLASS SAGGREWE BASE, 1 W%CRUSHED \ NOEB'. EST ROLL SUBGRAOE PRIOR TO AGGREGATE flD STANARDSnDN INCONFORMANCE WIM TypE SC£OTEI(IIIE FABRIC \ MnpOT STANDARD SPECIFICATION 2111. T IAT ENGINEERS DISCRETION) \ �11 SECTION: TRAIL MODIFICATION (TYPICAL) -STA. 5+00 T07+75 NOT To seNE \ TABLE I 315' MINUS GRADATION FOR ' AGGREGATE SURFACING / (CLASS SPECIAL) BEVESE PE/&'ENF PA6SWG SW. 10'TRAIL ''``yy VMIES-S MM. Sm''R&Vcn NORM SDE SOUTH SIDE M -IN 19 \ 15 � \ INS 2050 / 2.0% 20% \\ 12N 1p.10 A_ K� EXISTING GROUND ____ __.________ \ ;_. \ NOTES: \ 1. US AGGREGATE SUR.FACNGLLBE 10M CRUSHED LIMESTONE 2 W MINUS AGGREGATE RFACING MUST 5' TOPSOIL MO SEED ( P WTHICK ECUS AGGREGATE SURFACING L\ COME FROM KRAE ERMNING 6MA MATERIALS. IAI INC. OF SURNSWIF E, MN., IN ORDER TO ETCH PREPARE TOP 12 -OF SUBGRADE IN ACCORDANCE (SEE TABLE I FOR GRAWTION) \ COLOR OF EXISTING TRAIL WITHE STANDARD 2112 \ NOES T THIG( FOOT CLASS 5 AGGREGATE BASE, 10M CRUSHED TEST ROLL SUBGRME PRIOR TO AGGREGATE BASE INSTALLATION IN CONFORMANCE WRN TYPE 5 GEOTEXTILE FMRIC WDOT STANDARD SPECIFICATION 2111. (AT ENGINEERS DISCRETION) %2\ SECTION: TRAIL MODIFICATION (TYPICAL) - STA 1+75 TO 5+00 AND STA 7+75 TO 12+00 xoriD. RARR ENGINEERING CO. 62W MARKETPOINTE DRIVE SAA 2N MINNEAPOLIS, MN S 35 HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIR CHANHASSEN,MN TRAIL MODIFICATIONS TYPICAL SECTIONS 90% DESIGN NOT FOR CONSTRUCTION ----------------- A �� REAUGNEDTRAIL _ �. CONHDRUCfXIN LM18 _ _ ------------- -`\- — ___-- –- – a\ - — ----- – –__— TURF REINFMCEMENT MAT UTEWRY i) — SEE -------------- IN EXISTING COIVEoT _ ANOSLIPLMEIN EXISTING CULVERT -$EE SXEET Lll � .. CONCRETE GEOGRIO, SEE 9HEEf G19 1 I Cl' / `.q CULVERT ET MODIFICATIONS. SEESHEETG13 I / �ffl: SOUTH AREA SLOPE REPAIR 4 . m w acus w FgT fl RRENGINEERINGCO. 0.'IW MARNETFOINTE DRNE Suite M MINNEAPOLIS. MN 5 M HCRRA MINNEAPOLIS, MN LEGEND RIPRAP TURF REINFORCEMENT MAT FLEXIBLE CONCRETE GEOGRID LANDSLIDE REPAIRS CHANHASSEN,MN SOUTH AREA SLOPE REPAIR PLAN 90% DESIGN Y REVISION DESCRIPTION JEASTNG TRAIL No _ _ __ _ _. _ ___ 610 W5 B15 810 650 1 _- _ _ FINISHEDGRADE _ BTs LNEWTRAIL \\EZISnxG 620 - -. - US 615 - - - - -- -- - FINISHED GRADE 615 s10 i i 610 555_ i- I - - �� 605 600 i BOD ]85 i i 7M \♦ NIS 760 __ _ ___ - __ )BO 775 77 785 _ __ _ _ _ _ -- EXISTING WMAGEO HEADWALL 785 ``•--�- 765 780 155 — _.. NIS 1W - E%ISiNG CULVER]- 155 ]5S __- — - - 4 _- _ _. _ _ _ 750 750 RELEASED T0. OR �11 SECTION: SOUTH AREA SLOPE REPAIR o z0 a0 S EIN FEET LE%ISnNGTRAIL (NEW TRAIL INS m IDS B75 � EXISTING GROUND BE 815 --1 \_ _ _ _ -_ B15 810 -- - - 1 _- _ _ FINISHEDGRADE _ B10 805 185 4lqk 7M T]5 - _ _ TTS 785 _ __ _ _ _ _ -- - 785 ``•--�- 780 755 _. __—_ _ _ _ _ _ __ - _ - 755 750 %21 SECTION: SOUTH AREA SLOPE REPAIR 0 20 10 .a...BOMf I IN FEET Fgeu Ortre 54RR ENGINEERING LO, 13W IMFO ETMINTE ORNE SNe TW MINNEAP%IS, MN SSCIS rinrM�T� HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN, MN SOUTH AREA SLOPE REPAIR SECTIONS 90% DESIGN )R CONSTRUCTION NFR- '- 23101014.04 CLIENT PROJECT No DWG. No REV - C-12 D MINNESOTA BLUFFS LRT REGIONALTRALL - -- -- - _ _ f _ - INSTALL SALVAGED MnD TCLASS IV I RIPRAP AT SLOPE TOE I2P MIN. DEPTH)- _ SEE __ - - - ODSTMG ONS-IP9raSr RAam Bn SEGTo1l __ -- ON SLIPiINF➢ARGN PPE 7 -- - ,r Ts T,s `♦� �� PRDP6ifV LIE w 1 - -_ �ARTRPRAP �% 1/ _ - E: %191186 �\ ENOAIXNAP ♦ _ _ __ -T- - _ \ _ rl- 1 _ / FXISIN(a CHANATHIIWEG l \ N: ESWIM _ '. F619GSY ' 1 E%ISING STREAM E%IEHTS � _ BOULDER CR093 VANE RPLNEEXISIBI6GULVERf ------------------ ----------- ---------- MIN, - MIN. LENGTH INSIBE EXISTING - 1� CULVERT AND 2MIN. LENGTH- ,, OUTSIDE EXISTING CMMRRT _ - SEE AGE //�`6EEIBLEL NCRETEGEOGRNDD. WITH 1 INSTALL SALVAGEDMhDST CLASS N RIPRP AP STARTRMP 1 /^ /. SBWIfIER GROW VANEIN 1 AT SL6512553 -0OPE TOE MIN. DEPTH) E..6®80.m a NOTES I STARTANDENDCOOLiDINATESFOR VA DRIPRAPATSLOPE TOE DELINEATE EXTENTS ALONG LENGTH OF CNANNEL VERIR µ1 REMOVE DEBRIS IFAS SNECEERPRpOR NOR A DEBRIS. 3. LE TI DEBRIS IN CHANNEL ENECE55MYF TOIb DEBRIS REMOVAL INCIDENTAL TO SALVAGED RIPRAP INSTALLATION. 2. MINOR GRACING MAY BE NECESSARY ON SLOPE ABOVE PLACED I N♦ SALVAGEDRIPRM. INCIDENTAL TO RIPRAP PLACEMENT./'� REVISION annNV lw xo nu.I w A ounmem rloP>oPAm�vmnlwvT� vAaoFl.twBmA CONSTRUCTION LIMITS I� I� I' STILLING BASIN �1 PLAN: SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR ©y o m a SCALE IN FEET WTERELEA4® PRI. BARR ENGINEERING CO. AS MARKETPOINTE DRIVE MINMIN NEAEA POLIS. MN YMSS Apt HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN SOUTH AREA CULVERT OUTLET AND STREAMBANK REPAIR PLAN 90411 DESIGN NOT FORCONSTRUCTION 23101014.04 \ EXISTING GROUND 5 FINISHED GRADE B'I `..� - S1 FMISHED W%AOE FILL ANNULUS CORN GLSM HIGH DENST REM0%E OUSTING CONCRETE HIDUI GROUT PERM Tm19.3A] INSTALL NP00.STM F1550, GR36, OR A35 THREADED ROD (GN -V.). IF MINIMUM EPO%v GROUT EMBED, (6) EA ROW, Epl YSPACED )y4.. ORIGINALCWLRETE AROUND CIRCUMFERENCE. CUT RW FLUSH WITH NUT. CULVERT FURINISH AND INSTALL III a 6r CMP FOR SLIP LINING - - EXISTING CULVERT. CONLRACTOR TO VERIFY WE ANO FR IN THE FIELD AND NOTIFY ENGINEER OF ANY DSCRE➢ANCIES PRIM TO ORDERING. FURNISH AND INSTAL or w(STRENA WNITN=30') .YI (STREAM WpTH=YY) 9S T 6r GS PIPE APRON 1'd Zd Zd EXISTING GHp1TE0 I ANNULUS (ASSUMED' ]W' - 740 S MN, ZM61 DUSTMG C SPAN CAPA GROUND Br APPRD)L S EXISTING GROUT VERIFICATION POflT EXBTMG SAM PApI EXISTING A' ROTTED PJC EXt$TING GROUT ORIGINAL CONCRETE EXISTING RIPRAP UNOEflDflAIN INIEC]ION PgtT CULVERT \�IXISTING � n ZZ-:I EL ]5396 / TYPEIGEOTEfORF FABRK / INSTALL 3/' OF COARSE FILTER EXISTING GROUT AGGREGATE, W WT 31K2H RACED IN mo IXISTMIG TYBEH PAFS E%16TMG GEOTEXTILE (FEB., m16) 0 10 20 PLACE SALVAGED. GLASS IN. M QASS W RIPWV BENEATH F ED END SECTION AS NEEDED TO FACILITATE COARSE APPRO%. S FILTER AGGREGATE RACEMEM. THIS flIRNP MATERILL AND RACEMENT IS INCIDENTAL TO FLARED ENO SECTION. i SECTION: CMPA CULVERT SLIP LINE 5 B'I `..� - S1 FMISHED W%AOE I 750 or w(STRENA WNITN=30') .YI (STREAM WpTH=YY) W- R470 flIPRM E)Q6TNG GROUND I ]W' - 740 GROUND I B3 GRPNUIM BEDpNG 4D d0 -m -10 U 10 m m .215 \�IXISTING ]� EL ]5396 \ C1 SECTION: STREAM CHANNEL (30' BOTTOM WIDTH) OU I � BLDER CR053 VANE 0 10 20 ...a....e..a.I 750_- rFINISHED GMDE]ND SLALEMFEET }}}}}} 760-_ - T� 760 `FLARED END SECTION 1 �` __- Y.S1Z 26IT - \` 7EXFENSION _ _ _ _ EL. ](SBS EL. 7<395 8' iA5 `` >as • T1 7. I _ 1 83 GRANULAR EDGING B FINISHEDGRAOE _ ml 711 -HU 30'RPO RIPMP ���\ 1 7A0 J ]b IYB3GRANULARBEDOING _ -El. ]e095 7`10 W WD RIPRAP i EXISTING GROUND \ BOIAOER CROSS VANE) \ 1Z B]OR/J1U1AR BEDDING J ��0 I O.Wc I=DOL 2M C 2.31L 30 -m Ip 0 10 m 30 PROFILE: CULVERT OUTLET AND STREAM CHANNEL D SECTION: STREAM CHANNEL (20' BOTTOM WIDTH) (D o m w 0 +o m p 10 m .•...I 90% DESIGN L,.w NM�NTAL SGYEMF(£T VERNAL SG4EMFEET SCN.E IN FEET NOT FOR coNsn:ucn RawFwMPIa3i�T avlEmxcvu+w.w Mt9MQXM MYIwT,WA1LL 1'l ➢ � mu®wea�MPaIT�w.saE+�a SMR:ff AM939(A DIEM NP rosFmlCnoN — 'n vsn xx — — — — — ggacrtm- BARa ENGMEERING LO. .3W MARRtFPOINTE MNE AS SHDWN HCRRA LANDSLIDE REPAIRS MN CHAN . BARR EN GI Na. 231o1D14.04 +2/1312019 CLIEHF PRQIEcr 111. _ EXF JI'I"I AI01 SOUTH AREA CULVERT OUTLET REPAIR wn®wuE - MINNFAPOLI6, MN 53535 MINNEAPOLIS, MN P..e� _ owc 1214 REv D 1 2 A SOATE Fg1'�j613""01 PROFILE AND SECTIONS NO. By %APP. DATE REVISION DESCRIPTION .oaw.. wTE TOffOR RELFARO tmoea�mi AIM TOP OF SANK 44F FIELDSTONE E' FIELDSTONE SOUMETE TOE OF BANK ` RIPRAP AND GRANULAR FILTER TOE OF BANK n A 11 -NEL ITNLWEG) � TOP OF BANK 1 DETAIL: BOULDER CROSS VANE NOTTD scAIF TP tl TOP OF BANK 4 AT AVERAGE DIAMETER FIELDSTONE BOULDERS BOULDER ELEVATION POIN15 OFV_El CFV. E2 REV. E3 U5 VANE I 75430 750.30 ]54.30 MVAIR I 34790 I 3/390 34380 REVISION DESCRIPTION 28' ELSTNGGRWND J J �t i� .. BOTT]M BE ]N.85 lP RY]0 RIF2lP SECTION VIEW D +T w GR.v9LAR eEDDINc r MISTING....R04V� 1 ____________ L EL ]U.BS 1% EZ ]q 85 4'{ AVERAGE OIAMETER FLOW FIELDSTONE BOULDERS BOULDER ELEVATION OVERFLOW ELEVATION POINT tY APPRO%. E2 RIPRAP I (35'aa]o us vAHE. 30' R2]O OJ VANE/ 53 GRANULAR REDOING L VARIES -<'MIN %1 SECTION: BOULDER CROSS VANE NOT TO SCAIf NOTES: L. CROSS VANE LOCATIONS AND ELEVATIONS ARE APPROXIMATE AND BAY BE WDIF1ED IN THE FIELD BY THE ENGINEER. 2 FINAL BOULDER PLACEMENT TO BE APPROVED BY THE ENGINEER IN TME FIELD. CONTRACTORL BE REWIRED TO AOIUST BOULDER EL EVATIONSANOROTATION. L. I THERE SU- BE NOG S SETWEEN BOULDERS. RIPRAP BEDDING SHALL BE PIACEO ON TME UPSTREAM SIDE OF ME BOULDERS TO PLUG SMALL GAPS (MAY REQUIRE HAND PLACEMEN,, 4. BOULDERS OF AN UNSUrtABLE SHAPE MAY BE RE LOCATED OR REJECTED 5. INSTALL EROSION CONTROL BLANKET ON DISTURBED RANKS JB us VANE. NDS VANE TOE OF BANK BOULDER ELEVATION POINT y 1 E2 (q SECTION: BOULDER CROSS VANE NOT TO SCNE wT®rwE R® A B C TOIFOR MATE ` iT 53 GRANULAR BEDDING EXISTNGSUBGRPDE - How 6WR ENGINEERING CO. 0300 MARKETPoTNTE DRIVE BARR SINN 2Po - NNINEAPOLIS, MN 55135 NYRiF�mAu@ PA emaz-mr 317 R2]0 RlP l 1T B3 GRANU Wt BEDDING SECTION VIEW C L PLAN VIEW 0 DETAIL: STILLING BASIN Np TD scALE W. DESIGN NOT FOR CONSTRUCTION LANDSLIDE REPAIRS ROJECT No P2310 2ROJE.06 HCRRA CHANHASSEN, MN T PROJE p MINNEAPOLIS. MN SOUTH AREA CULVERT OUTLET REPAIR SECTIONS AND DETAILS Na. C -15!D REV. IN. gY 3 DOSiRIGSLOPE —III— 10P LANDSEED Z V/ � N FX9TMIG SIRFAM BED .f,M NLLWUH VAT _ $ RE BEDMI.TERML R I E%CAVPTEDSIPFAM BED ANiERILL fG00FA0T1 H - M'TNCK SALVAGED flIPRAP - -- - T*HCK rArmrDawAAn m3�R onsTixB roE w eArac 1 DETAIL: RIPRAP TOE PROTECTION Dg ro scuE ga if F 5R i3 e 90% DESIGN q NOT FOR CONSTRUCTION LANDSLIDE REPAIRS BAfl"P"°'EGr N°. a^*°°"'- m-s®ow p �► 7Dp D!1-R!'S �""f"°N'^" �R a4Bt UlCIIm4NC W. �EraarrfE� DRrvE MINNEAIgL15, MN 55035 - n a�n"..��"',. 3°" ftlf3/l0f9 HCRRA MINNEAPOLIS, MN CHANHASSEN, MN AeA>.�u�r�vvev,� — — — — — — _ _ � wErrr �r No23101014.04. STREAMBANK REPAIR DETAIL MLI B C D 0 1 2 DATEflaeA,sED ay.f BARB PVG. No. C-16 flEv. w. D ruo. BY HK. APP oArE REVISION DESCRIPTION +w°'°4 f AIa 11 � I -. -- � E%ISTING,YERAND � 1 CONSTRUCTION LIMITS E%IENTS E _ �1 1\ _ --------------------- "PC - PROPERTY LINE PROTECT EMITING FENCE y, CRUSHED VWGIN CIASS IN RIPRPP - 31. —� _--_ > - --_- - - - -_ _ - _--- \\ PRC 13 STDRM \ SEE ,� i \ G19 e16�� efi nlo— PoTEHMLACCEBBRWTE 15�33T • MINNESOTA BLUFFS LRT IYEGIONAL TRNL / I / I � I � I / I CCNSERVATpN EASEMEN! I. BWNDARY I 1 I 1 PLAN: NORTH AREA SLOPE REPAIR B '10 W I I srwLe IN FEET eARRENGBEERNIG CO. .]W MAIeQTPOINTE oNNE �zm MIIIEAPOLIB. MN 55135 Wffl FILL EXISTING 1B' DV WRH GNOIR - AND ABANDON IN PUCE, - - RIOTECTE1l81W3 NIENmK - FlCWMCN EMSANKE (COMMON EMBANIPIENTj `EX45 IE.6109 U (VERIFY M FlEID PRIOR TO OOMMSTREPM GMDING) W] HCRRA MINNEAPOLIS, MN LANDSLIDE REPAIRS CHANHASSEN,MN NORTH AREA SLOPE REPAIR PLAN NOT 90% DESIGN �5 B,4 RTs HER 023 BIG Bf5 810 Hm BW M R0 TBS 7m n5 M 0 EXISTING PROPERTY LINE .FINISHED GRADE -r RIIGNED D VU&CTME TOR USED ANTH 7YLLY DESIGNED ANO) MING C NUOTOBEUSEDN'RHTYPE OF PIPE(18'OIPI BEING PBANOONED OR BUWIEAO ENO ' CEMENT GRWTPRIOR TO PBVICONING PIPE WRH � 1 PROFILE: NORTH AREA SLOPE REPAIR 0 10 m SCALE IN FEET Us B,B 835 HBO 825 M 8,5 BW am 800 785 788 185 7m 775 772 ON IOW dxe: BWRENGIXEERING CO. Li A LiL1 A300 MARKEfP01N1E ORNE D�1I�rSr� sMe mo EXISTING GROUND HCRRA 'IB' -0'L a•••••••••�•• ••• z37Di 14.04 Oen FpF ryIEM PRoctr xo. AKH � .uK PROTECT IXLRnNG // CEMERI— T. GEN'PER NEAGwALL NOTES: Ila --. _. / e,o FWLLNED GRADE — - - - EL 810.8 < ,. ,ame BONDED4mcGATEn-TUAcic. O4lvaazeDa FILL MEA (COMMON EMBNINMEN,I IXISnNG 18'DIP _ABANUTINGIB'DIP IN GAGE WDDH R- PLALE WITH PLOWABLE FILL GRRgIT GIN CLASS III RIPRAP 1 PROFILE: NORTH AREA SLOPE REPAIR 0 10 m SCALE IN FEET Us B,B 835 HBO 825 M 8,5 BW am 800 785 788 185 7m 775 772 ON 90% DESIGN NOTFORCONSTRUCTION '� MiwAi "nRJ.wm ery waw u®®OKL MImmI�RE81�uwnoPnM -_ -_ -_ - -_ -_ _ •1EOfMxA�4 IOW dxe: BWRENGIXEERING CO. Li A LiL1 A300 MARKEfP01N1E ORNE D�1I�rSr� sMe mo EXISTING GROUND HCRRA 'IB' -0'L a•••••••••�•• ••• z37Di 14.04 Oen FpF ryIEM PRoctr xo. AKH NORTH AREA SLOPE REPAIR PROFILE. SECTION, AND DETAIL .uK MWNEAPOLIs. MN sass ,„an uan `°'���IB1'-'6p1 „„.5„m„ MINNEAPOLIS, MN CEMERI— T. GEN'PER llBff P65T C uTEroarEUNE NOTES: Ila --. _. — _. -- - - e,o END Posrm,A1 POM Om POSTMO1tlWaE raPRaL 1�� ,. ,ame BONDED4mcGATEn-TUAcic. O4lvaazeDa FWIBIHO GRwE ''� GAGE 2. TERMINAL POSTS 4 END. CORNER Of POLL POST -TOO. CRON LIN: FMRIC (1J§ BLACK PIPE 4 a0 b S. LNE Pp3754xb12.55IO. \ % FWALGRAOE 4. TOP RAL SWLLLBE 1d:B'S38D. ��_... -_ Y 5. KL GRTING. TITS LOOPGPS,MOCOMPOIENT PART3 sNALL eE vim conreO �IACIP 758 - --_ —.7m CRUSNEDVWH3N U IIIRIPMP § ti 6. CANW YNK FIBPoCSWLLL BEY MESH WDH KNUQ(LED 9 SELVAGE TOP ANp80T'IOM- IY 'I 7 FABNC 51411 BE 11ED BELOW TCP RNLEVERV IY. 180 .m -,o 0 10 m - 7gp 30 8. FENCE SHALLBEGROUNCEO. CONCNETEFOODNG(TYP) b a. FENCE ALIGNMENT SRALL BE OFFSET FROM EDGE OF �, SECTION: NORTH AREA SLOPE REPAIR (STA. 0431 TRAIL. /3\ DELA -,WIRE FENCE DESIGN VINYL COATED - a ,a m 10 REVIEw FENce ncNMENr,ExrEurs wlm ENwNEm PR[MTOI STALLAIDON ENGHEER ANV ALTFA FE11fE SUIS W FEET AIINGMEMrF]OEMS 90% DESIGN NOTFORCONSTRUCTION '� MiwAi "nRJ.wm ery waw u®®OKL MImmI�RE81�uwnoPnM -_ -_ -_ - -_ -_ _ •1EOfMxA�4 IOW dxe: BWRENGIXEERING CO. Li A LiL1 A300 MARKEfP01N1E ORNE D�1I�rSr� sMe mo ® AS SHOWN ^^- ,2/,YA,4 HCRRA LANDSLIDE REPAIRS CHANHASSEN, MN a•••••••••�•• ••• z37Di 14.04 Oen FpF ryIEM PRoctr xo. AKH NORTH AREA SLOPE REPAIR PROFILE. SECTION, AND DETAIL .uK MWNEAPOLIs. MN sass ,„an uan `°'���IB1'-'6p1 „„.5„m„ MINNEAPOLIS, MN RELEASED A R c o o , 2N�^'^^e^ xO By HK. APP DATE REVISION DESCRIPTION INeEA TpFOR MTE R9FASFD Ow•I BARB owc G18 REv D roP� AKH i0 TRAX MODIFICATIONS -BEE BNEET GB] 42� ST -1 FASTNG RIBERO --CNE vim- •_I - _ __ `_-�v� _ -- - -•--• • —• —• : —• —.•-_ T TRAIL a • • •—p OCL MINI ESOTABLUFFS LR RE - \ __ _ __. •__ - _ _._._._._.� -. Aa -• -CAS PPEAPRON AREAr BB.S 6 - - N -_ \L1�Sf$ 818014 1 PRAP STLLND BABW _ -- _ = SEE 1 0' - _ - - -- - A _ 7�---- �$4e]g tBa 5T$ _ V _ _ __ _ _ `810 &ST] OPOSED DRAINAGE CHANNEL WITH_ - ��s 1 -_-_ IL IBLE CONCRETE GEOGRIO / �PoTENTIAL ACCESS ROUTE 2<'CAB PIPE APRON STORM HOPESEWER- - ER- t{l SOUTH SLOPE REPAIR - - DIRECTIONLL GRILLED _ SFESTIHT LIt 01D�i / p_ - --- ------ 1 PZ -1 / ROCK CHECK ITYP.1 �j j�CONSTRUCTION LIMITS RDCK CHECK (TTP.) - BPACEDAPPRO% EVERT SB STA_- ,_-- aas% ml� A. 1 BEATRICE I. 2WIERSON IRREV. TRUST CONSERVATION EASEMENT PARCEL LINE ' \ GPLAN: STORM SEWER AND DRAINAGE CHANNEL 1 1 e1 . SCAE1NFEET y qH EXISTING GROUND FINISHED GRADE -� --- _ - PROPOSED DRAINAGE CHANNEL SEEe NOTES. I MSTALL 24- HDPE AND NEW CHANNEL PRIOR TO PLUGGING EXISTING NORTH HE UNDER TRAIL EMBANKMENT. 2. ENSURE VEGETATION IS AT LEAST 10% ESTABLISHED IN NEW CHANNEL PRIOR TO ALLOWING FLOW 3. INIIALL SEED. BLANKET, ARE MULCH ONCE PROTECT DISTURBANCE IS COMPLETE AND IN ACCORDANCE WITH RESTORATION DESIG WSPECIFICATIONS. i 5 . 24 -CAS PIPE APRON (IE, 8()&7S) - ST -7-- - RIPRAP STILLING BASIN O.NS 1.CBs 2. S 3 s E A s s s PROFILE: STORM SEWER AND DRAINAGE CHANNEL B m m D ,s m HORQONTAL SGLLENFEEf VEfliICK SCALE IN FEET 90% DESIGN a — — A S C D B 1 __ _ 2 — �MAR�TPOH�o11NE - 1 PI.1+mman K�a.salN.- BMi ENCA1�RNOCO. WNI6APoL5. MN 55136 `k,1�i nMOTr, n•. �, ewl. As sHDMN BARN, PROJECT No, 23101014.04 4.04 HCRRA CHANHASSEN, MN 1v EPF SEE MINNEAPOLIS, MN STORM SEWER AND DRAINAGE CHANNEL A� NHPN BARB a IKgW2 TpFOR GATE RHFASFD "'^a"' AKN PROPOSED DRAINAGE CHANNEL SEEe NOTES. I MSTALL 24- HDPE AND NEW CHANNEL PRIOR TO PLUGGING EXISTING NORTH HE UNDER TRAIL EMBANKMENT. 2. ENSURE VEGETATION IS AT LEAST 10% ESTABLISHED IN NEW CHANNEL PRIOR TO ALLOWING FLOW 3. INIIALL SEED. BLANKET, ARE MULCH ONCE PROTECT DISTURBANCE IS COMPLETE AND IN ACCORDANCE WITH RESTORATION DESIG WSPECIFICATIONS. i 5 . 24 -CAS PIPE APRON (IE, 8()&7S) - ST -7-- - RIPRAP STILLING BASIN O.NS 1.CBs 2. S 3 s E A s s s PROFILE: STORM SEWER AND DRAINAGE CHANNEL B m m D ,s m HORQONTAL SGLLENFEEf VEfliICK SCALE IN FEET 90% DESIGN NA11' ILIA ac6omL4w mR W fYN91184FO m1(MIMO911npfYf B�a�u®ITE VmORTE wn®TWE - RELEASEp — — A S C D B 1 __ _ 2 — �MAR�TPOH�o11NE - 1 PI.1+mman K�a.salN.- BMi ENCA1�RNOCO. WNI6APoL5. MN 55136 `k,1�i nMOTr, n•. �, ewl. As sHDMN BARN, PROJECT No, 23101014.04 4.04 HCRRA CHANHASSEN, MN 1v EPF SEE MINNEAPOLIS, MN STORM SEWER AND DRAINAGE CHANNEL A� NHPN BARB BY DATE REVISION DESCRIPTION IKgW2 TpFOR GATE RHFASFD "'^a"' AKN 302 LF -2V HOPE 0157% (INSTALL USING OIRECTptNL _ _.. DRILLING METHODS) 24-GBPPEAPRd1 - (IE 818501 EL 0100 FILL AREA' s.ODs 7.a8s B.wS BamS B.,ss 90% DESIGN NOT FOR CONSTRUCTION LANDSLIDE REPAIRS BARN, PROJECT No, 23101014.04 4.04 HCRRA CHANHASSEN, MN Cl1EHT Fl101ECT M. MINNEAPOLIS, MN STORM SEWER AND DRAINAGE CHANNEL DWG. NP. REV. NP. PLAN AND PROFILE G-19 D TABLE OF DUANTOREs RIPRAP AT PIPE Olmns 1 \ DETAIL: RIPRAP OUTFALL xor roerALE LIQ PoPRA➢ J1 __ .TGRANUWI ',ER MATERIA SECTION: RIPRAP OUTFALL RKIr T09fµE NOTES PIPE SIZES LARGER THAN THOSE SHOWN! REQUIRE A SPECIAL DESIGN. Q FORPWES pRFATFIR TNYI IXtEWATll3]', USE 15. ® GIMENSIUNEIS GIVEN GN 3TANDARG PLATE331W AN0 nfa. `� RPRAP 11 Ah'AOT CJUHULM FlLI9R INTERNE SECTION: RIPRAP OUTFALL XDTTD9CNE CLASS Iv RVRAP - CULVERT WVERT A SECTION: ROCK CHECK NOTTOBGLS NOTES: 1—CUT 1L 131E CONCRETE GEOGRN) AT EACH RCCK LFECK AS NECESSARY TO IMPROVE GEOGRIO FLE%IB0.Nv AND GCNM TRENCH FOR ROCK CHECK 2 PROVIDE MINIMUM OF 3T OVERLRPOPMODROAT BREAK BELOW ROCK CHECK WITH UPSTREAM GEOGPoD LAYER PLACED ON TOP OF DONNSFREAM GEIX D, 3. VERIFYNSTAWTPOANO fiEOUR�DSTA�OHO WITX MANUFACTURER PRIOR TO WSTAUATION. PF BLECONWETEOEOGRO (FLEXANAT ORAP•nWED EDILRL) B• ry PROVIDE MIN }Ft WERLA� FIE]UBLE coNCIK-IE GEOGRo ATBRFAX SELOA ROCK CHECK (FUXhNIAT OR APPROVED Epj SECTION: ROCK CHECK NprrosruE 90% DESIGN NOT FOR CONSTRUCTION ^ � � _" cuss II dw. B' I CURss I I - d50= B° oniv dW= 12• LANDSLIDE REPAIRS —'Z3G014.o4 6' DEPM „R„�„„E 9' DEPTH eARR ENfi11EF.RW[im D A DlsMT�+RE'E D/L11'S R B'r°2°° mNNEArous. MN Ssa m^""'M""^'af'". m.Raooarz-Wn �+r�aR �,s�..��' 12' DEPTH OIA. OF CHANHASSEN, MN 12'DEPTH CAIANULAR > DEPTH GRANUTAR 26•DEPTH GRANUUR ROUND L RIPW FILTER RIPFUP FILTER RIPMP RLTER RIK(IN.) (FT.) (CU.VO.) (CU. VD.) (CU. vo.) ICU. VD.) (CU.YD.) (W. YO) 24 :2 i5 28 9.3 6.2 110 5s 1 \ DETAIL: RIPRAP OUTFALL xor roerALE LIQ PoPRA➢ J1 __ .TGRANUWI ',ER MATERIA SECTION: RIPRAP OUTFALL RKIr T09fµE NOTES PIPE SIZES LARGER THAN THOSE SHOWN! REQUIRE A SPECIAL DESIGN. Q FORPWES pRFATFIR TNYI IXtEWATll3]', USE 15. ® GIMENSIUNEIS GIVEN GN 3TANDARG PLATE331W AN0 nfa. `� RPRAP 11 Ah'AOT CJUHULM FlLI9R INTERNE SECTION: RIPRAP OUTFALL XDTTD9CNE CLASS Iv RVRAP - CULVERT WVERT A SECTION: ROCK CHECK NOTTOBGLS NOTES: 1—CUT 1L 131E CONCRETE GEOGRN) AT EACH RCCK LFECK AS NECESSARY TO IMPROVE GEOGRIO FLE%IB0.Nv AND GCNM TRENCH FOR ROCK CHECK 2 PROVIDE MINIMUM OF 3T OVERLRPOPMODROAT BREAK BELOW ROCK CHECK WITH UPSTREAM GEOGPoD LAYER PLACED ON TOP OF DONNSFREAM GEIX D, 3. VERIFYNSTAWTPOANO fiEOUR�DSTA�OHO WITX MANUFACTURER PRIOR TO WSTAUATION. PF BLECONWETEOEOGRO (FLEXANAT ORAP•nWED EDILRL) B• ry PROVIDE MIN }Ft WERLA� FIE]UBLE coNCIK-IE GEOGRo ATBRFAX SELOA ROCK CHECK (FUXhNIAT OR APPROVED Epj SECTION: ROCK CHECK NprrosruE 90% DESIGN NOT FOR CONSTRUCTION ^ � � _" _ _ _ — "°•"°"' �S1ONT LANDSLIDE REPAIRS —'Z3G014.o4 „R„�„„E — _ _ _ r�arRFcmx — — — — — — _ eARR ENfi11EF.RW[im D A DlsMT�+RE'E D/L11'S R B'r°2°° mNNEArous. MN Ssa m^""'M""^'af'". m.Raooarz-Wn �+r�aR �,s�..��' fv13rA1e HCRRA MINNEAPOLIS, MN CHANHASSEN, MN EPF alEin PRGIECT NP. AKH STORM SEWERAND DRAINAGE CHANNEL SECTIONS AND DETAILS srA.RwF RELEASED A R C D 0 1 2 TOTER ^�^ SPRR OwG.Io G20 REv. NR. D No. ByIC—IA-. DATE REVISION DESCRIFFFION wP^^ DATERET.FJSED AKH e' MIN. TOPSOIL WITH SEED AND -r FLEXISLE CONCRETE GEOGND—\ CATEGORY 3 EROSION CONTROL. �, SLOPE PND WIDTH VARY BLANNJET EXTENDEROSION CONTROL BLANKET IO MIN. FROM \ — 6 ANN, tOFSOL ANO SEED liElOw EDGE Ol' FLEOUBIE CONCRETE FLEXNRE CONCRETE f£OGRID I �J SEE OETAL2FOR KEY — Y R to 4 2 NOTES 1 ALL FLEXIBLE CONCRETE C£G TO BE FLEXAATOR APPROVED EOUA. 2. FLEXIBLE CONCRETE GEOGRO IS TO SHE UND N A 61fPGLED MANNER SO THE UPSTREAM NOW IS LAND OVER THE TOP OF 71E DOA NSTREAM FORWARD INSTALLED IN ACCORDANCE WITH MANUFACTURERS GUIDELINES. 3. FOR GENERAL INSTALLATION INFORMATION SEE DUAL 2. 4. PLACE TOPSOIL PRIOR TO INSTALLATION OF FLEXIBLECONCRETE GEOGRO AND GRADE TO BE SMOOTH PER MANUFACTURER GUIDELINES. REVIBION DESCRIPTION i SECTION: DRAINAGE CHANNEL aTros E RELFASEO TgFOR DATE RELEASED F TIE ®OBMTNE FLQNIAT s elwWaeDTD NleerFlow, RBeeu THE DIITaoB a Nauta o mala OUTEIOE EOOEB ARE HIGHER FILM THE CENTER OF THE CHANNEL ANO THE FLOW IE CONTAINED W ITHN THE MAT. ------------ ROLL WIDTH LONGER THAN SP OVERLAP (3 BLOCKS) tB' LENGTH. 25' DEEP. 0VERLANO FLOW NFILL OVERLAPPED MAT WITH TOP SOIL. 1 B', a3 REBAR OR APPROVED ZIP TIE. PLEXAMAT ARMOR IS D:S CONSTRUCTION NOTES: 1. AN ENGINEER OR MANUFACTURES REPRESENTATIVE SHALL BE ONSITE FOR THE START OF THE INSTALLATION. Z. GRADE THE SITES SO THAT WATER WILL NOT FLOW MOVE. BELOW, OR AROUND THE OUTSIDE Of THE AREA PROTECTED WITH FLERAMAT. ALL SUBGRADE SURFACES PREPARED FOR PLACEMENT OF MATS SHAI BE SMOOTH AND FREE OF ALL ROCKS, STICKS, ROOTS, OTHER PROTRUSIONS, OR DEBRA OF ANY RIND. 3. APPLY SITE SPECIFIC SEED, INCLUDING NATIVE GRASSES DIRECTLY TO THE PREPARED SOIL PRIOR TO FLEXAMAT INSTALLATioN. C FLEXAMAT ROLLS ARE AVAILABLE IN W IDTHS OF 4.$5'.8',10,12',816'. IT I5INE MAN UFACTURERS RECOMM ENOATION TO UTILIZE THE WIDEST MATS POSSIBLE TO REDUCE AN ABUN DANCE Of SEAM S OR OVERLAPS. a. TO ACHIEVE WIDER WIDTHS, INSTALL MATS ADJACENT TO ONE ANOTHER, INSTALL ADDITIONAL UNDERIAYMENT UNDER ALL ADJOINING MATS. A MINIMUM OF 12' OF UNDERIAYMNET SHALL EXTEND UNDER EACH SIDE OF THE MAT AND DIRECTLY AGAINST THE SUBGRADE. Is. INSTALL 115' 43 REBAR U ANCHORS OR STAINLESS STEEL ZIP TIES IN 3- INCREMENTS THE LENGTH Of THE LONGITUDINAL SEAM. 5, AT THE BEGINNING OF THE FLEXAMAT. TRANSITION THE INITIAL EADING EDGE PROPERLY WITH EROSION MATTING OR X50 If EXPOSED TO CONCENTRATED FLOWS EMBED IB' VERTICALLY INTO THE SUB GRADE TO SERVE MAN ANCHOR TRENCH. THE TRENCH SHALL BE FILLED AND COMPACTED WITH SUITABLE FILL OR OTHER (A55PECIFIED BY EORI. 6, FOR ADDITIONAL SECTIONS OF MAT, OVERLAP THE DOWNSTREAM SECTION U' WITH UPSTREAM SECTION OF MAT. PRIOR TO INSTALLING OVERLAP, FLIP UPSTREAM MAT BACK 26'. EXCAVATE 215. OF SOIL FROM END OF UPSTREAM MAT. DOW NSTREAM SECTION IS LAID IN THE SHALLOW TRENCH. LIGHTLY SPREAD TOPSOIL, SEED AND FERTILIZER OVER INITIAL EDGE, FILM ENO OF UPSTREAM MAT OVER THE Sl i', COVERED INITIAL LEADING EDGE OF DOWNSTREAM MAT. T. INSTALL 10' U -ANCHORS IN 2' INCREMENTS ACROSS THE OVERLAP. INSTALL ANCHORS DIRECTLY BEHIND BLOCKS. 'U' ANCHORS CONSIST OF 13 REBAR'U' ANCHOR WITH 18' LEGS. S. AT THE END OF THE ARMORED CHANNEL, EMBED THE MAT Ill- IN A TERMINATION TRENCH. FILL AND COMPACT TERMINATION TRENCH WITH SOIL(DETERMINED BY EORI. FLEXAMAT INFORMATION Manufacturer. Mote Enterprises, Inc. Product Name: Fleaamat Address 3153 Madison Road Cincinnab, ON 45209 Telephone: 513-272-6689 Email: info®Fleaama4com Website'. wwW.Fleaamatcom RR =WNA BARK ENGINEEWNG GO .iT YAM((POINTE DRIVE Si 200 wFEArolls AN ssazs FLEXAMAT STANDARD CHANNEL DETAIL NTS HCRRA MINNEAPOLIS, MN ,lexamat ', 0 -ft NMILaDIfa(iIILL I 030 90% DESIGN NOT FOR CONSTRUCTION LANDSLIDE REPAIRS CHANHASSEN,MN STORM SEWER AND DRAINAGE CHANNEL SECTIONS AND DETAILS -----------I -- ' Q4 REALIGNED GRAVEL TRAIL _ _ — _ I NNESOTARIUFF LRT REGIONALTw` Tf �—j`r- — -- _ ___--__L--`` + SYMBOL AND PATTERN LEGEND EXISTING IT CONTOUR METING Z CONTOUR -------- CONSTRUCTION LIMITS CONSTRUCTION IAIf($ �`` — ' ' IMn00T M- EIDGE 5011TH SEED MIX CLEARING LIMITS \ NATryE GONE TRUGFI NSEEDMIX (WENOTM2A11 STORMWATERSOUTH SEED MIX (..DOT 11261) %11 PLAN: SEEDING - 0 fiB 1X1 4 WETPRAI EOMI% (MnDOT 50.262)262) SCALE IN FEET [_ RPPFP RESTORATION NOTES. L ALL GROUND DISTURBANCE GENERATED FROM GRADING ACTIVITIES SHALLBE DECOMPACTED TO A MINIMUM DEPTH OF IY. STA41LVED AND PROPOSED TRAIL RESTORED WITH A MINIMUM OF 6INCHES OF TOPSOIL SEEC WITH COVER CROP..0 NT EROSION COROL BLANKET OR STRAW MULCH THE TOPSOIL USED FOR RESTORATION MAY BE STOCKPILED FROM GRADING AREAS. 2 SEED ANY DISTURBED AREAS OUTSIDE THE CONSTRUCTION LIMITS WITH THE SPECIFIED SEED MI%. J. ANY EXOTICiNVASNE PLANTS AND WEEDS WITHIN THE SEEDING AREAS SHALL BE SP='D WITH HERBICIDE 14 DAYS PRIOR TO SEEDING SIGNAGE INDICATING THE USE OF HERBICIDES MUST BE POSTED ON SITE. 4. ALL HERBICIDE APPLICATION SHALL BE APPLIED BY A LICENSED APPLICATOR WITHIN THE STATE OF MINNESOTA. 5. SEEDIN ACCOROANCEWRHTHESPECIFICAPONS.6EEDINGISTOTAKE PLACE IMMEDIATELY FOLLOWING FINAL GRADING AND SOIL PLACEMENT TO PREVENT EROSION AND COMPACTION 6. REFER TO SPECIFICATIONS FOR AODMONAL INFORMATION. IN THE CASE OF ANY DISCREPANCIES BETWEEN THIS DETAIL. PUNB. OR MM SPECIFICATIONS. THE SPECIFICATFONS SHALL GOVERN. 90% DESIGN NOT FOR CONSTRUCTION -- RENG AS SHOWN LANDSLIDE REPAIRS BAaa P23101ROJECT N°. _ _ BMw ENGwEERING w. +v+1aB+B 23101014.04 AN]4N6(ETPOINTE DRAT p°^ EPF HCRRA CHANHASSEN, MN MEW PROJECT No. BARRsmN o0 MINNEAPOLIS, MN 55416 A. MINNEAPOLIS, MN SEEDING PLAN NO BY HK APP. DATE REVISION DESCRIPTION w RELEASED A B C D 0 1 2 °1"°^'•I^• -mr °^9'^° EARN DwG. No. REV. Na rviµe'Ia .ry a�195ZIM3-ifYt DATE RELEABEO m. Ewe'v-sn Armee pKH R-01 D — aEAucNED GRAVE TruIL - _ __ -- - - -- - � _ - _r.� ------------ - ----- i ------------1 1 I 1 1 % — =II----�N1INNESOTABLUFF LRT REGIOW'E s 1 CONSiRUC➢IXI UMR$ CLEARING LIMITS 18 PLAN: EROSION CONTROL BLANKET MULCH PLAN o w 1 10 scuE IN FEET 2 90%B DESIGN "UWN I LANDSLIDE REPAIRS 1o4. .04y 2310 EPF CHANHASSEN,MN CLIENT PR0.1ECT No DxXR E ------- MINNEAP ' MNSM35 AKN MINNEAPOLIS, MN EROSION CONTROL BLANKET AND INC. 51 NK APP. DATE REVISION DESCRIPTION RTES A B C G 1 2 3 P^^°'"L`°K""' F tm ..' °�� BARR DING No. aEv. w. DATE RELEASED ,tea;, ����� .,,oa, AKN MULCH PLAN R-02 A EXISTING 1DCp1TDUR EXISTING S CONTOUR -------- CONSTRUCTION LIMITS — — — — CLEARING UMTS L RIPRAP FLEXIBLE CONCRETE GEOGRID (FL EXAIMT qY APPR W ED E4UKI J EROSCN CONTROL BLANKET 3N) __ ,M�TCAT. DISK ANCHORED MULCH 90%B DESIGN "UWN I LANDSLIDE REPAIRS 1o4. .04y 2310 EPF CHANHASSEN,MN CLIENT PR0.1ECT No DxXR E ------- MINNEAP ' MNSM35 AKN MINNEAPOLIS, MN EROSION CONTROL BLANKET AND INC. 51 NK APP. DATE REVISION DESCRIPTION RTES A B C G 1 2 3 P^^°'"L`°K""' F tm ..' °�� BARR DING No. aEv. w. DATE RELEASED ,tea;, ����� .,,oa, AKN MULCH PLAN R-02 A i REALIGNED GRAVEL TRAIL, ------- -------------- - \ z —1 CONSTRUCTION LIMITS CLEARING LIMITS SYMBOL AND PATTERN LEGEND - -. EXISTING 1O CONTOUR -- 5'B --- EJUSTNG Y CONTOUR --- CONSTRUCTION LIMITS MManoti—moren CIEMS G OMITS IOO.G RIPRM TW PUGuBLE CONCRETE MCGRID Mower—no (flFXAMAT OR APPgOV Ep EOUKI IS OL TREE PIa%nNC AREa � 1 i^3 3 i — \�INNESOTPBWFF LRi 0.EGIONALTRN +- —M _ I 1 /JIVI /// / �A1AIII IIIIL I� qt n�/'l•/i/( q// `u }Ivv/-/ ' J•, /`�iil'� III I"uI tNI // � i II 1 uI l n III�I I I le �. �l \ I\ I \ II; TREE PLANTING NOTES:uIv�y� .v.vvxv �� '� '�• J y Ills\I� .�` ` \ ` I �- �- %'/ —_ _ ;��� ���•�'JTIJ i1///r r, J/ '%SwX /� /���ii /� / .•.�\��1�i�l, III PLAN: EROSION CONTROL BLANKET AND TREE PLANTING PLAN G D 8I ID 4 5[NE N FEET NOTES: 1, ALLTREES GREATER THAN SDIAMETERAT BREAST HEIGHTREMOVED DURING CONSTRUCTION SWILL BE REPLACED AT A Lf MTO. 2. ESTIMATED TREE REPLACEMENT QUANTITIES ARE PROVIDED N THE TREE PLANTING SCHEDULE FOR BIDDING PURPOSES. 3. ACTUAL TREE REPLACEMENT QUANTITY WILL VARY FROM THE RANTING SCHEDULE BASED ON NUMBER AND SPECIES OF TREEG REMOVED WRING CONSTRUCTION. {. BOTHCONTRACTMMDENGINEERSHALLIEEPALOGOF MEESGRFATER THAN W DMLffTER AT BREAST HEIGHT REMOVED WRONG CONSTRUCTION TO DETERMINE TREES TO BE RANTED. 5, APPROJLIFMTEAREASFORTREEPIANlWN SHOSV MO EPLANVIEW. FIELD STAGE LOCJVMN$ OF PROPOSED TREES IN THE FIELD FOR REVIEW AND MPROVAL BY ENGINEER PRIOR TO PLWTING. CmaII'll Ironwood Bolonic Name Os"."ioiona Sue NOCanI, Spacing (ft) ID D.C. Replacement % Taal BRa110111d {% DUanlity IEa Ra atw) : TOO DPwry SeralleEenY MManoti—moren NOOmt IOO.G W TW A -main, linden Mower—no NB me. IS OL B% TBD Nortlem No Oak OaNms ell PSwift gM Cont. Is O.c 3% TOO Sugar Maple A MoixoPrvm NO Com. IS D.C. 3Wk FID Red Oak Godminno. NO Cao IS O.0 W TOD HaAMrr, CHRM PaidenNlis NOCNPL IOO.0 l0% TIO Northi,m Strain RedLud One, Ton.densls NOCont IS O.c M TOD Swamp Vmae Oak Goad., annmr MCdaf IS D.C. M Tw Mad ORma Prunus serotina =CPIL IDOL {% TOD rNPn om PapulN acmiae, NO Good, IS O.c IO% TOO Tad TW 2 TABLE: ESTIMATED TREE PLANTING SCHEDULE • 1 ' uvurc ` L EXIsnNG SUBGFADE BACNFILL$OIL DETAIL: TREE PLANTING Nv xOTTO SCA E MD TO A DEPTH OF T AROUND TREE (SOL PREPARED PS PER P.) 9. NO MULCH TO BE IN CONTACT WITH BASE OF PLANT. 10. CUNTPN.TOR IS RESPONSIBLE FOR kWMNNIND TREES IN A MUM POSITION OWWE GU THRNT TREE PERIOD. 11. CONTRACTOR TO WATER M NECESSARY THROUGHOUT GUARANTEE PERIOD To MWNTNN IN A HEALTHY CONDITION. AT THE END OF THE GUARANTEE PERIOD ALL TREES THAT ARE DEAD OR DETERMINED UNHEALTHY OR UNSIGHTLY SHALL BE REPLACED AT CONTRACTOR'S EXPENSE 901 DESIGN NOT FOR CONSTRUCTION ::b:I�:;;-----------laH,w — — _ — N..PaIN,:"J�SH� .......,.__..__ — _LANDSLIDE REPAIRSBFRR ENGINEERING CO23i (]i0'14.04 p� rvE HCRRA CHANHASSEN. MNIARIR w.N.IM,rePawd — — — — — MINNNE LIIS MNS5{ss MINNEAPOLIS, MNTREE PLANTING PLANNO BY WTE REVISION DESCRIPTION TbFOR DATE RSEA$ED �Dll "„u,I aR-No' R-03 A 1. REMOVE DEAD OR DAMAGED BRANGHES, RET H TLE NATURAL FORM OF PLANT. DO NDr CUT TTHE LEADER 2, IFROOT FLAREIBHOT IDIPMED SOILiTHIN SOIL TO BASE OF ROOTCONTAINERFLARE,EXCAVATESURFACE OF ROOT HOLE. N 3. DIG KMT MIN, LARGER THARWT TREE PER SCHEDULE MASS. al SIDES. BIDES. {. BIDES OF HOLE PRIOR ROOT FLME.TOBEAT GRPDE TOSCARIFY PLANTINGBOTTOMANS ANDNOT COVERED WTM MACX 5. SET TREE ONLIGHTLY SOIL SET MEEON ORSWL REISINFIRMED FINISH GRACE SOgCOT FLNBACKFILL PRUNE REMOVE NGSOILAIN FIRMSOIL 5. WITH!PANTINWON ANDFIRM. ADVANTAGEOUS FIBROUS MOUNDNOOT MASS AND ENSURE ROOT MASS TO ROT$M]iAND ROOTS ABOVE ROOT FLARE SS AROUND ROOT MAS ENSURENO UCTY GAERING BASIN THOROUGHLY ROUG T. CONSTRUCT 3'3 ,' SHREDDED OF INSN.THOROUGHLV HOURSN. WATER WITHISHRED WJiDNVOD MULCH ED HARDWOOD D MULCH (MWDST U 8. PLACESHREDDEDWEEOSE BNCIDEMAL TO TREE DFRE SHREDDED BISTAL1ATpN1 SHREDDED XAROWWO. TOARpOWS OF N' HARDWOOD • 1 ' uvurc ` L EXIsnNG SUBGFADE BACNFILL$OIL DETAIL: TREE PLANTING Nv xOTTO SCA E MD TO A DEPTH OF T AROUND TREE (SOL PREPARED PS PER P.) 9. NO MULCH TO BE IN CONTACT WITH BASE OF PLANT. 10. CUNTPN.TOR IS RESPONSIBLE FOR kWMNNIND TREES IN A MUM POSITION OWWE GU THRNT TREE PERIOD. 11. CONTRACTOR TO WATER M NECESSARY THROUGHOUT GUARANTEE PERIOD To MWNTNN IN A HEALTHY CONDITION. AT THE END OF THE GUARANTEE PERIOD ALL TREES THAT ARE DEAD OR DETERMINED UNHEALTHY OR UNSIGHTLY SHALL BE REPLACED AT CONTRACTOR'S EXPENSE 901 DESIGN NOT FOR CONSTRUCTION ::b:I�:;;-----------laH,w — — _ — N..PaIN,:"J�SH� .......,.__..__ — _LANDSLIDE REPAIRSBFRR ENGINEERING CO23i (]i0'14.04 p� rvE HCRRA CHANHASSEN. MNIARIR w.N.IM,rePawd — — — — — MINNNE LIIS MNS5{ss MINNEAPOLIS, MNTREE PLANTING PLANNO BY WTE REVISION DESCRIPTION TbFOR DATE RSEA$ED �Dll "„u,I aR-No' R-03 A CHECK SLOT NOTES: 1. SECURE AT 121N, INTERNA -S. BACIffBL AND CCYPACT MI_ z. CIELI(SLOT3m BE PLACE EVERY2s ALOM ROV/LNE. INTERMITTENT CHECK SLOT REVISION DESCRIPTION :PKORCEMFM ANT RELEASED TOFOR z FT. 1 ANOJOR NOTES: 1. RACE ANCHORS ACCORDING TO THE ABOVE PATTERN. 2, OVERLAP BETWEEN ROLLS IS 6 W. MWIMUM. 3. SPLICE BETWEEN IS 18 IN. MINIMUM 4. ALWAYSMSTAL- DOUBLE ROWOF PWSSPA: ITAPART AT ALLROL SPLICER. 5. INSTALL PINS DOWN THE CENTER OF EACH MAT STAGGERING THE OUTSIDE PINS. B. ANCHORS SHALL BE AT MINIMUM 121N. STEEL NAILS WITH 1-U2 IN WASHERS OR 121X. USHAPED WIRE STAPLES. LONGER ANCI DAS NAY BE REQUIRED FOR LOOSE BOILS, ANOIORS MST PROVIDE SUFFICIENT GROUND PFNETMTgN TO RESIST PULLOUT TRM ANCHOR PATTERN TRU INSTALLATION NOTES: 1. PLACE A MI OF 11N. Of TOPSOIL ON SLOPE, 2. PLACE APPROXIFMTELY50% OF THE SPECIFIED SEED. WO RAI(E SEED INTO SOIL PRIOR TO PLAOFIAENT OF TRI_ 3. INSTALL AND ANCIpR TRM AS SHOWN AND AS SPECIFIED. 4. PLACE ADDITIONAL TOPSOIL (PULVERIZED, MY, LOOSE) OVER TRM ROUGHLY I IN. THICK OR UNTIL TIE TRM IS RARELY VISIBLE. 5. APPLY REMAINING W% OF SEEDING ON TOP OF SOIL FILLED TRM AND LIGHTLY RAKE INTO SOIL USING THE FLAT S10E OF A RAKE. S. M ROMULCH WY BE SUBSTITUTED FOR THE APPROACH IN STEP 5. /`NRF REINFORCEMENT IMT WAS / RRL) ANCHOR TRENCH NOTES: 1. SEWREAT121N.INTERVKS.BALKFILLAMCOMPACTSOIL. 2. FOi SLOPES, CONSTRUCTTOP ANCIgR TRENLH2 FT. BEYOID CREST OF SLOPE. 1 DETAIL. TURF REINFORCEMENT MAT - NOT To sruE R�}�(}��( 4X0=ONEEWNGCO ED — — BA ll 1 43[0 MARKETPOINTE DRIVE 9tlY 200 -- MIWFAPOLIS. NN 55135 C D 0 1 2 M..N.N.1u.r F��1N¢Imao� DATE RELE/SED IR,+MIAf-E)! TOP ANCHOR TRENCH HCRRA MINNEAPOLIS, MN TURF REINFORCEMENT FIAT ITSUI WAS NOW 1. SECURE AT 121X. INTERVALS. B4CKFILLAND COMPACT SOIL EDGE TERMINATION ANCHOR TRENCH LANDSLIDE REPAIRS CHANHASSEN,MN RESTORATION DETAILS W. DESIGN NOT FOR CONSTRUCTION wRR PRaECT No. 23101014.04 Attachment 4 Draft Specifications for Horizontal Directional Drilling S -XX (2503) 24" HDPE PIPE SEWER -DIRECTIONAL DRILLED (2503.603) PART 1: GENERAL 1.01 SUMMARY A. Section includes providing all materials, equipment, and labor to complete Horizontal Directional Drilling (HDD). B. Various methods will be considered, provided they can generally follow the design profile in constructing the pipeline from the starting access point to the ending access point. 1.02 REFERENCES A. The following are complete titles of references cited in this Section. The date of the standard is that in effect as of the certification date, unless noted otherwise. American Petroleum Institute (API) a. API Bulletin D20: Directional Drilling Survey Calculation Methods and Terminology b. API RP 136-1: Recommended Practice for Field Testing Water-based Drilling Fluids. 2. American Society for Testing Materials (ASTM) a. ASTM A240: Standard Specification for Chromium and Chromium -Nickel Stainless Steel Plate, Sheet, and Strip for Pressure Vessels and for General Applications 1.03 SUBMITTALS A. Installation Plan including: Experience and qualifications information including the following: a. A list of at least 10 similar projects completed by the company, including the name of owner, location, project environment (i.e. urban work, waterbody crossing), pipeline and/or casing diameter(s), length of installation, and contact names and phone numbers. b. A list of key personnel assigned to the project including title, experience, and personal references. 1) The field supervisor shall have at least 3 years of experience and shall be at the site at all times during the boring/drilling installation. 2. Site access requirements. 3. Major Equipment including the following: a. Type and capacity of drilling rig to be used for the project, including thrust and rotary torque. b. Type and capacity of the mud mixing system. C. A list of any specialized support equipment required. 4. A detailed plan and profile of the bores indicating the location and footprints of all equipment, staging areas, pipe storage areas, location of entry and exit pits, and location of drilling fluids containment pits (as applicable) to be plotted at a scale no smaller than inch equals 20 feet horizontal and vertical. 5. A detailed installation plan including the following: a. Depiction of Contractor's proposed plan and profile of pipeline to be installed including denoted entry and exit points, entry and exit angles, bend radiuses, and points of intersection (PIs). b. Construction methods, including diameter of pilot holes, number and size of pre - reams, use of rollers, baskets, and side booms to suspend and direct pipelines during pullback, and number and sections in which the pipelines are to be installed. C. Description of installation sequencing, including pilot hole, reaming, and pullback for pipeline. d. Type, operating range, and degree of accuracy of tracking equipment. e. Drilling fluid mix design. f. Pipelinejoining methods. g. Measures to be employed and monitoring to be performed to prevent overstressing of pipeline during installation. 6. A Quality Control Plan detailing personnel and associated responsibilities, inspections, and organization for ensuring the quality of construction required by these Specifications. The plan shall include a table listing methods, frequencies, and acceptable conditions and tolerances. The plan shall explain the methods and locations for obtaining samples for testing and reporting schedules. Copies of quality control forms shall be submitted for review and approval. A plan describing drilling fluid and cuttings management methods including: a. Details of drilling fluid types, cleaning and recycling equipment, estimated flow rates, and procedures for minimizing drilling fluid escape b. Method(s) of drilling fluid and slurry containment C. Method(s) of recycling drilling fluids and spoils d. Method(s) of transporting drilling fluids and spoils off the site e. Disposal plan for drilling mud and spoils A spill plan in the event of a spill of drilling fluids, hydraulic fluids, and/or any other fluids or substances other than potable water. The plan shall include measures to communicate the spill to Engineer and a plan to contain and clean the affected area. 8. A description of measures to be employed to prevent hydraulic fracturing of overburden soils and drilling fluid migration. A plan of action in the event of hydraulic fracturing and/or drilling fluid migration from the drill alignment shall also be included. 9. A plan for leak testing installed pipeline. 10. A plan of action to be followed in the event of a failed pipeline installation and/or failed post -installation leak test. 11. Submit Installation Plan to Engineer at least 21 days prior to mobilizing equipment. B. Manufacturer's product data including: Technical product data and installation instructions for all water system materials and products. C. Shop drawings including: Piping materials, size, locations, and elevations. Include details of underground structures, valves, connections, restrained joints, and anchors. Show interface and spatial relationship between piping and proximate structures. D. Test results and certificates including: 1. For each fusion joint provide all process information, time, temperature and pressure in the form of a written log 2. Leakage Test and Hydrostatic Pressure Test. Submit for approval 1 copy of results of leakage and hydrostatic pressure test upon completion of backfilling operations. 3. Conductivity Test. Submit for approval 1 copy of results of conductivity test upon completion of backfilling operations. 4. Bacteriological Tests. Submit for approval 1 copy of results of bacteriological tests upon completion. E. Record Drawings: At Project closeout, submit for information Record Drawings of installed piping and products including locations and elevations. 1.04 QUALITY ASSURANCE A. Manufacturer's Qualifications. Firms regularly engaged in manufacture of water systems materials and products, of types and sizes required, whose products have been in satisfactory use in similar service for not less than 5 years. B. Installer's Qualifications. Installer shall have at least five years experience in horizontal directional drilling and have installed horizontal directional drilled pipe at least as large as 12 inches in diameter for a minimum of 10 projects within the last 5 years. Installers shall have equipment capable of installing pipeline in segments of up to 500 LF. It is the intent of the pipeline layout that access pits will be located only at the inlet and outlet locations shown on the Drawings (e.g., no intermediate access pits in between inlet and outlet). 1.05 DELVIERY AND STORAGE A. Materials delivered and placed in storage shall be protected from weather, contamination, degradation, and damage. 1.06 MEASUREMENT AND PAYMENT A. Measurement shall be made of the number of lineal feet of satisfactorily installed 24 -inch HDPE pipe, including inlet and outlet, as shown on the Drawings and approved by the Engineer. B. Payment shall be made under 2503.603 (24" HDPE Pipe Sewer -Directional Drilled) at the Contract price per lineal foot, which shall be compensation in full for all work included in this specification. PART 2: PRODUCTS 2.01 HIGH DENSITY POLYETHYLENE PIPE (HDPE) A. ASTM D3350 with a cell classification of 445474C, and a PPE rating of PE4710. The pipe produced from this material shall have the dimensions and wall thickness as set forth in ASTM F714 for the size and Dimension Ratio (DR) 17. B. Each HDPE pipe length shall be marked with the manufacturer's name or trademark, nominal size and DR, cell classification, and extrusion date, period of manufacture or lot number. C. All HDPE pipe and fittings shall be from a single manufacturer, who is fully experienced, reputable and qualified in the manufacture of the HDPE pipe to be furnished. The pipe shall be designed, constructed, and installed in accordance with the best practices and methods and shall comply with these Specifications. D. Contractor is responsible for compatibility between pipe materials, fittings, and appurtenances. 2.02 TRACER WIRE FOR HDPE A. Solid copper No. 10 or stainless steel No 10 tracer wire. B. Splicing tracer wire for horizontal directional drilling will not be allowed. 2.03 DRILLING FLUID (SLURRY) A. Stable colloidal suspension of bentonite in water and shall be controlled in accordance with API RP 1313-1. B. Admixtures may be incorporated into the drilling fluid if approved by Engineer. PART 3: EXECUTION 3.01 LOCATION OF WORK A. The Work shall be located as shown on the Drawings. In general, boring pits may be located within the project construction limits and as accepted by Engineer. B. It may be necessary for the Engineer to shift lines a reasonable amount to avoid an obstruction to the construction work or to reduce right of way difficulties. The Contractor will not be allowed any additional compensation due to minor shift of lines. Additional compensation will be allowed only for lengthening of lines greater than 2% of the overall length, or for providing additional fittings. 3.02 EXAMINATION A. Examine the area and conditions for performing pipeline installation via HDD methods. If unsatisfactory conditions occur during Work, notify Engineer and do not proceed with Work until unsatisfactory conditions have been corrected. B. It shall be Contractor's responsibility to determine to its own satisfaction the location and nature of all surface and subsurface obstacles and the soil and water conditions that will be encountered during construction. C. Provide Engineer with access to Contractors work areas at all time, and provide Engineer with the location and profile of all drilled alignments. 3.03 PREPARATION A. Contractor shall make arrangements to locate all existing utilities and underground facilities in the areas of Work. If any are to remain in place, Contractor shall provide adequate means of protection during HDD installation operations. B. Contractor shall protect existing streams, structures, utilities, roads, and other facilities from damage caused by settlement, lateral movement, undermining, washout, and other hazards created by HDD pipeline installation. C. Surface water shall be controlled sufficiently to permit HDD pipeline installation. 3.04 GENERAL A. All polyethylene pipe shall be cut, fabricated, and installed in strict conformance with the pipe manufacturer's recommendations. Joining, laying, and pulling of polyethylene pipe shall be accomplished by personnel experienced in working with polyethylene pipe. The pipe supplier shall certify in writing that the Contractor is qualified to join, lay, and pull the pipe or representative of the pipe manufacturer shall be on site to oversee the pipe joining. Expense for the representative shall be paid for by the Contractor. B. Storage Pipes shall be stored on level ground, preferably turf or sand, free of sharp objects which could damage the pipe. Stacking of the polyethylene pipe shall be limited to a height that will not cause excessive deformation of the bottom layers of pipes under anticipated temperature condition. Where necessary due to ground conditions, the pipe shall be stored on wooden sleepers, spaced suitably and of such widths as not to allow deformation of the pipe at the point of contact with the sleeper or between supports. C. Handling Pipe 1. ^g_ The handling of thejoined pipeline shall be in such a manner that the pipe is not damaged by dragging it over sharp and cutting objects. Ropes, fabric, or rubber - protected slings and straps shall be used when handling pipes. Chains, cables, or hooks inserted into the pipe ends shall not be used. Two slings spread apart shall be used for lifting each length of pipe. Pipe or fittings shall not be dropped onto rocky or unprepared ground. Slings for handling the pipeline shall not be positioned at butt -fused joints. Sections of the pipes with cuts and gouges exceeding 10 percent of the pipe wall thickness or kinked sections shall be removed and the ends rejoined. 2. The open ends of all sections of joined and/or installed pipe (not in service) shall be plugged at night to prevent animals or foreign material from entering the pipeline or pipe section. 3. Waterproof nightcaps of approved design may be used but they shall also be so constructed that they will prevent the entrance of any type of natural precipitation/ into the pipe and will be fastened to the pipe in such a manner that the wind cannot blow them loose. 4. The practice of stuffing cloth or paper in the open ends of the pipe is not allowed. 5. Where possible, the pipe shall be raised and supported at a suitable distance back from the open end such that the open end will be below the level of the pipe at the point of support. 3.05 EXCAVATIONS A. Entry and exit pits shall be excavated to a depth allowing installation of the pipeline as shown on the Drawings. B. All excavations shall be in accordance with applicable OSHA requirements. 3.06 INSTALLATION A. Install pipelines by means of horizontal directional drilling. Assemble, support, and pretest the pipeline prior to installation in the directional drill tunnel. B. Horizontal directional drilling shall consist of the drilling of a small diameter pilot hole from one end of the alignment to the other, followed by enlarging the hole diameter for the pipeline insertion. The exact method and techniques for completing the directionally drilled installation will be determined by the Contractor, subject to the requirements of these Specifications. C. Monitor the route taken by the drilling unit utilizing the downhole survey calculation methods discussed in API Bulletin D20. A surface monitoring system may be allowed in lieu of the downhole calculation method. Approval of surface monitoring shall be at the discretion of the Engineer based on the Engineer's evaluation of the particular system that is proposed. D. Drilling fluid consisting of a bentonite slurry shall be using during drilling and back -reaming operations. Drilling fluid consisting solely of water will not be permitted. E. Drilling fluid shall remain in the annular space between the pipeline and the borehole upon completion of the installation. F. Joining Pipe Sections Each length of pipe shall be inspected and cleaned as necessary to be free of debris immediately prior to joining. 2. Pipes shall bejoined to one another by means of thermal butt -fusion. Polyethylene pipe lengths to bejoined by thermal butt -fusion shall be of the same type, grade, and class of polyethylene compound and supplied from the same raw material supplier. 3. Mechanical connections of the polyethylene pipe to auxiliary equipment shall be through flanged connections which shall consist of the following: a. A polyethylene "stub end" shall be thermally butt -fused to the ends of the pipe. b. Provide ASTM A240, Type 304 stainless steel backing flange, 125 -pound, ANSI 816.1 standard, and gaskets as required by the manufacturer. Stainless Steel bolts and nuts of sufficient length to show a minimum of three complete threads when thejoint is made and tightened to the manufacturer's standard. Retorque the nuts after hours. d. Butt -Fusion Joining: Butt -fusion of pipes shall be performed in accordance with the manufacturer's recommendations as to equipment and technique. Butt -fusion joining shall be 100% efficient offering a joint weld strength equal to or greater than the tensile strength of the pipe. G. Allow a minimum 8 to 24 hour relaxation period as specified by the manufacturer or industry standards prior to connecting or attaching any appurtenances to or restraining the inserted HDPE pipe. H. Tolerances Pipe installed by the directional drilled method must be located in plan as shown on the Drawings, must be no shallower than shown on the Drawings, and must be no closer than minimum offsets shown on the Drawings, unless otherwise approved. Plot the actual horizontal and vertical alignment of the pilot bore at intervals not exceeding 30 feet. This ..as built' plan and profile shall be updated as the pilot bore is advanced. At all times, provide and maintain instrumentation that will accurately locate the pilot hole and measure drilling fluid flow and pressure. Grant Engineer access to all data and readout pertaining to the position of the bore head and the fluid pressures and flows. 2. Employ experienced personnel to operate the directional drilling equipment and, in particular, the position monitoring and steering equipment. No information pertaining to the position or inclination of the pilot bores shall be withheld from Engineer. 3. Each exit point shall be indicated with an over -length tolerance of 5 feet for directional drills of 1,000 linear feet or less and 20 feet for directional drills of greater than 1,000 linear feet and an alignment tolerance of 5 feet left/right with due consideration of the position of the other exit points and the required permanent easement. The alignment of each pilot bore must be approved by Engineer before pipe can be pulled. If the pilot bore fails to conform to the above tolerances, Engineer may exercise option to require a new pilot boring to be made. 4. After the pipe is in place, cleaning pigs shall be used to remove residual water and debris. After the cleaning operation, provide and run a sizing pig to check for anomalies in the form of buckles, dents, excessive out -of -roundness, and any other deformations. The sizing pig run shall be considered acceptable if the survey results indicate that there are no sharp anomalies (e.g. dens, buckles, gouges, and internal obstructions) greater than 2 percent of the nominal pipe diameter, or excessive ovality greater than 5 percent of the nominal pipe diameter. For gauging purposes, dent locations are those defined above which occur within a span of five feet or less. Pipe ovality shall be measured as the percent difference between the maximum and minimum pipe diameters. For gauging purposes, ovality locations are those defined above which exceed a span of five feet. Ream and Pullback Reaming: Reaming operations shall be conducted to enlarge the pilot after acceptance of the pilot bore. The number and size of such reaming operations shall be conducted at the discretion of Contractor. 2. Pulling Loads: The maximum allowable pull exerted on the HDPE pipelines shall be measured continuously and limited to the maximum allowed by the pipe manufacturer so that the pipe orjoints are not over stressed. 3. Torsion and Stresses: A swivel shall be used to connect the pipeline to the drill pipe to prevent torsional stresses from occurring in the pipe. 4. The lead end of the pipe shall be closed during the pullback operation. 5. At all times, handle the HDPE pipe in a manner that does not over stress the pipe. Vertical and horizontal curves shall be limited so that wall stresses do not exceed 50% of yield stress for flexural bending of the HDPE pipe. If the pipe is buckled or otherwise damaged, the damaged section shall be removed and replaced by Contractor at Contractor's expense. Take appropriate steps during pullback to ensure that the HDPE pipe will be installed without damage. 6. Tracer wire shall be pulled along with the HDPE pipe in order to locate it in the future. Conductivity between HDPE sections shall be continuous. Handling Drilling Fluids and Cuttings During the drilling, reaming, or pullback operations, the Contractor shall make adequate provisions for handling the drilling fluids, or cuttings at the entry and exit pits. To the greatest extent practical, these fluids must not be discharged into a waterway. When Contractor's provisions for storage of the fluids or cuttings on site are exceeded, these materials shall be hauled away to a suitable legal disposal site. After completion of the directional drilling work, the entry and exit pit locations shall be restored to original conditions. Comply with all permit provisions. 2. Pits constructed at the entry or exit point area shall be so constructed to completely contain the drill fluid and prevent its escape. Excess drilling fluid shall be contained in a lined pit, a containment pond, or via another Engineer approved containment method at exit and entry points until recycled or removed from the site. 3. Utilize drilling tools and procedures which minimize the discharge of any drill fluids. Comply with all mitigation measures listed in the required permits and elsewhere in these Specifications. 4. To the extent practical, maintain a closed loop drilling fluid system. 5. Minimize drilling fluid disposal quantities by utilizing a drilling fluid cleaning system which allows the returned fluids to be reused. 6. Make all diligent efforts to minimize the amount of drilling fluids and cuttings spilled during the drilling operation and provide complete clean-up of all drilling fluid overflows or spills. 3.07 ENVIRONMENTAL PROVISIONS A. The Horizontal Directional Drilling operation shall be operated in a manner to eliminate the discharge of water, drilling mud and cuttings to adjacent waters or land areas during construction. Provide equipment and procedures to maximize the recirculation or reuse of drilling mud to minimize waste. All excavated pits used in the drilling operation shall be lined by Contractor with heavy duty plastic sheeting with sealed joints to prevent the migration of drilling fluids and/or ground water. B. Visit the site and become aware of all structures and site limitations at the directional drill locations. Contractor is responsible for providing a drilling plan outlining procedures to prevent drilling fluid from adversely affecting the surrounding area. C. The general work areas at the entry and exit shall be enclosed by a berm to contain unplanned spills or discharge. D. Waste cuttings and drilling mud shall be processed through a solids control plan, comprised as a minimum of sumps, pumps, tanks, centrifuges, material handlers, and haulers all in a quantity sufficient to perform the cleaning/separating operation without interference with the drilling program. The cuttings and excess drilling fluids shall be disposed offsite and shall be dewatered and dried by Contractor to the extent necessary for offsite disposal. Water from the dewatering process shall be treated by Contractor to meet permit requirements and disposed of locally. The cuttings and water for disposal are subject to being sampled and tested. The construction site and adjacent areas will be checked frequently for signs of unplanned leaks or seeps. E. Equipment (graders, shovels, etc.) and materials (such as groundsheets, hay bales, booms, and absorbent pads) for cleanup and contingencies shall be provided in sufficient quantities by Contractor and maintained at all sites for use in the event of inadvertent leaks, seeps or spills. Waste drilling mud and cuttings shall be dewatered, dried, and stock piled such that it can be loaded by a front end loader, transferred to a truck and hauled offsite to a suitable legal disposal site. The maximum allowed water content of these solids is 50% of weight. G. Treatment of water shall satisfy regulatory agencies before it is discharged. 3.08 POST -INSTALLATION TELEVISING A. Televise pipeline after completion of installation. The pipe shall be cleaned prior to any televising. The Contractor shall be responsible for cleaning the pipe, and keeping it free of debris until final project acceptance by Engineer. The televising camera shall be mounted on a skid so that it is centered laterally in the pipe. The camera shall be equipped with sufficient lights to completely illuminate the interior of the pipe within the range of the camera. A monitor shall be provided with seating facilities to allow three or more persons to view the picture continuously. The television camera, transmitting equipment, and monitoring equipment shall combine to provide a picture on the monitor screen which is free from distortion and clean enough to distinguish between hairline cracks, "pipe marks', etc. A digital recording shall be made of the entire footage of pipe televised. The linear footage of pipe televised shall be integrated into the recording for ease of identification of pipe being viewed. B. Provide a written report identifying pertinent data as shown on the videotape. A diagram of the project with all televising indexed on it shall be included. If televising is interrupted for more than five days, an interim index diagram shall be furnished. Recording(s) shall be digitally provided to the Engineer in conjunction with the report. 3.09 FIELD QUALITY CONTROL A. Allow pipeline to be inspected by Engineer upon installation completion. 3.10 SITE RESTORATION A. Restore all areas disturbed by construction in kind to existing grade. B. The ground surface along each drill path will be observed by Engineer for signs of settlement, heave, hydraulic fracturing, or other indication of impact that appears to have occurred due to the HDD installation process. Contractor shall be responsible for the cost of measures required to quantify the affected area(s) and restore the site due to settlement, heave, hydraulic fracturing, or other impact that appears to have occurred due to the HDD process. Attachment 5 Joint Application Form for Activities Affecting Water Resources in Minnesota Joint Application Form for Activities Affecting Water Resources in Minnesota This joint application form is the accepted means for initiating review of proposals that may affect a water resource (wetland, tributary, lake, etc.) in the State of Minnesota under state and federal regulatory programs. Applicants for Minnesota Department of Natural Resources (DNR) Public Waters permits MUST use the MPARS online permitting system for submitting applications to the DNR. Applicants can use the information entered into MPARS to substitute for completing parts of this joint application form (see the paragraph on MPARS at the end of the joint application form instructions for additional information). This form is only applicable to the water resource aspects of proposed projects under state and federal regulatory programs; other local applications and approvals may be required. Depending on the nature of the project and the location and type of water resources impacted, multiple authorizations may be required as different regulatory programs have different types of jurisdiction over different types of resources. Regulatory Review Structure Federal The St. Paul District of the U.S. Army Corps of Engineers (Corps) is the federal agency that regulates discharges of dredged or fill material into waters of the United States (wetlands, tributaries, lakes, etc.) under Section 404 of the Clean Water Act (CWA) and regulates work in navigable waters under Section 10 of the Rivers and Harbors Act. Applications are assigned to Corps project managers who are responsible for implementing the Corps regulatory program within a particular geographic area. State There are three state regulatory programs that regulate activities affecting water resources. The Wetland Conservation Act (WCA) regulates most activities affecting wetlands. It is administered by local government units (LGUs) which can be counties, townships, cities, watershed districts, watershed management organizations or state agencies (on state-owned land). The Minnesota DNR Division of Ecological and Water Resources issues permits for work in specially -designated public waters via the Public Waters Work Permit Program (DNR Public Waters Permits). The Minnesota Pollution Control Agency (MPGA) under Section 401 of the Clean Water Act certifies that discharges of dredged or fill material authorized by a federal permit or license comply with state water quality standards. One or more of these regulatory programs may be applicable to any one project. Required Information Prior to submitting an application, applicants are strongly encouraged to seek input from the Corps Project Manager and LGU staff to identify regulatory issues and required application materials for their proposed project. Project proponents can request a pre - application consultation with the Corps and LGU to discuss their proposed project by providing the information required in Sections 1 through 5 of this joint application form to facilitate a meaningful discussion about their project. Many LGUs provide a venue (such as regularly scheduled technical evaluation panel meetings) for potential applicants to discuss their projects with multiple agencies prior to submitting an application. Contact information is provided below. The following bullets outline the information generally required for several common types of determinations/authorizations. • For delineation approvals and/or jurisdictional determinations, submit Parts 1, 2 and 5, and Attachment A. • For activities involving CWA/WCA exemptions, WCA no -loss determinations, and activities not requiring mitigation, submit Parts 1 through 5, and Attachment B. • For activities requiring compensatory mitigation/replacement plan, submit Parts 1 thru 5, and Attachments C and D. • For local road authority activities that qualify for the state's local road wetland replacement program, submit Parts 1 through 5, and Attachments C, D (if applicable), and E to both the Corps and the LGU. Minnesota Interagency Water Resource Application Form February 2014 Page 1 of 15 Submission Instructions Send the completed joint application form and all required attachments to: U.S Army Corps of Engineers. Applications may be sent directly to the appropriate Corps Office. For a current listing of areas of responsibilities and contact information, visit the St. Paul District's website at: http://www.mvp.usace.army.mil/Missions/Regulatory.aspx and select "Minnesota" from the contact Information box. Alternatively, applications may be sent directly to the St. Paul District Headquarters and the Corps will forward them to the appropriate field office. Section 401 Water Quality Certification: Applicants do not need to submit the joint application form to the MPCA unless specifically requested. The MPCA will request a copy of the completed joint application form directly from an applicant when they determine an individual 401 water quality certification is required for a proposed project. Wetland Conservation Act Local Government Unit: Send to the appropriate Local Government Unit. If necessary, contact your county Soil and Water Conservation District (SWCD) office or visit the Board of Water and Soil Resources (BWSR) web site (www.bwsr.state.mn.us) to determine the appropriate LGU. DNR Public Waters Permitting: In 2014 the DNR will begin using the Minnesota DNR Permitting and Reporting System (MPARS) for submission of Public Waters permit applications (httos://webappsll.dnr.state.mn.us/mpars/public/authentication/login). Applicants for Public Waters permits MUST use the MPARS online permitting system for submitting applications to the DNR. To avoid duplication and to streamline the application process among the various resource agencies, applicants can use the information entered into MPARS to substitute for completing parts of this joint application form. The MPARS print/save function will provide the applicant with a copy of the Public Waters permit application which, at a minimum, will satisfy Parts one and two of this joint application. For certain types of activities, the MPARS application may also provide all of the necessary information required under Parts three and four of the joint application. However, it is the responsibility of the Applicant to make sure that the joint application contains all of the required information, including identification of all aquatic resources impacted by the project (see Part four of the joint application). After confirming that the MPARS application contains all of the required information in Parts one and two the Applicant may attach a copy to the joint application and fill in any missing information in the remainder of the joint application. Minnesota Interagency Water Resource Application Form February 2014 Page 2 of 15 Project Name and/or Number: PART ONE: Applicant Information If applicant is an entity (company, government entity, partnership, etc.), an authorized contact person must be identified. If the applicant is using an agent (consultant, lawyer, or other third party) and has authorized them to act on their behalf, the agent's contact information must also be provided. Applicant/Landowner Name: Hennepin County Regional Railroad Authority (HCCRA), Jessica Galatz Mailing Address: 7014" Avenue S, Suite 400, Minneapolis MN 55415 Phone: 612-348-2691 E-mail Address: Jessica.galatz@hennepin.us Authorized Contact (do not complete if same as above): Sarah Johnson Mailing Address: 325 5 lake Avenue, Suite 700, Duluth MN, 55802 Phone: 218-529-7159 E-mail Address: sjohnson@barr.com Agent Name: Tyler Conley Mailing Address: 4300 MarketPointe Dr, Suite 200, Minneapolis, MN 55435 Phone: 952-832-2600 E-mail Address: tconley@barr.com PART TWO: Site Location Information County: Carver County City/Township: Chanhassen Parcel ID and/or Address: 25990600,252640080, 257560510, 250360200, and 250360700 Legal Description (Section, Township, Range): Sections 25, 36, Township 116 West, Range 23 N and Section 30, Township 116 West, Range 22 North Lat/Long(decimal degrees): 44.821518/-93.525386 Attach a map showing the location of the site in relation to local streets, roads, highways. Refer to Figure 1. Approximate size of site (acres) or if a linear project, length (feet): 9.3 acres If you know that your proposal will require an individual Permit from the U.S. Army Corps of Engineers, you must provide the names and addresses of all property owners adjacent to the project site. This information may be provided by attaching a list to your application or by using block 25 of the Application for Department of the Army permit which can be obtained at: http://www.mvp.usacearmy. mil/Portals/57/docs/regulatory/RegulatoryDocs/engform 4345 2012oct.pdf PART THREE: General Project/Site Information If this application is related to a delineation approval, exemption determination, jurisdictional determination, or other correspondence submitted prior to this application then describe that here and provide the Corps of Engineers project number. This application is related to the Chanhassen Slope Failure project number 2015 -04215 -MMI. A wetland delineation was previously conducted in August 2015. This wetland delineation report was approved on December 18, 2015 (Appendix A). A second wetland delineation was completed on September 2019, for the expanded project area. This wetland delineation has been reviewed by the technical evaluation panel and the approval letter is attached. Minnesota Interagency Water Resource Application Form February 2014 Page 3 of 15 Describe the project that is being proposed, the project purpose and need, and schedule for implementation and completion. The project description must fully describe the nature and scope of the proposed activity including a description of all project elements that effect aquatic resources (wetland, lake, tributary, etc.) and must also include plans and cross section or profile drawings showing the location, character, and dimensions of all proposed activities and aquatic resource impacts. Project Description: The scope of the project includes landslide repairs on a portion of the Minnesota Bluffs LRT Regional Trail (trail) in Chanhassen, MN owned by the Hennepin County Regional Railroad Authority (HCRRA). Two areas will be repaired as part of this project —the north repair area and the south repair area. Project access will be from Highview Drive in Eden Prairie, proceeding southwest along the trail to the site, and also from Flying Cloud Drive through the Moon Valley Aggregate operated property (final access route through Moon Valley Aggregate operated property pending property owner authorization). Landslide repairs in the south repair area will include stabilizing the south slope, repairing the south culvert outlet area and constructing a new storm sewer and drainage ditch to direct water into the repaired area. Existing trail profile grades will be reduced with the embankment slopes regraded to less steep grades and finished with turf reinforcement mats. The existing damaged concrete headwall will be removed and existing riprap will be salvaged for reuse. The south culvert outlet area will be repaired with riprap, boulder cross vanes, and a stilling basin. Work in the north area will include removal of existing pipe debris, placement of riprap fill on north slope, and abandonment of the existing pipe crossing beneath the trail. Drainage will be rerouted from north pipe area via new buried storm sewer and lined drainage channel, which will discharge to the south culvert outlet area.Please refer to Appendix B for the complete set of design plans and layout of the aforementioned project featrues. Project Purpose and need In 2014, a large rain event (presidential declared disaster 41823) caused the slopes supporting the trail to fail. The trail has since been closed due to slope instability and public safety concerns. The purpose of the proposed project is to stabilize the trail slopes, reopen the trail, and thereby reconnect a six-year closure of a Tier 1 Alignment of the Regional Bicycle Transportation Network. Aquatic Resources Two wetland delineations were conducted within the project area. The first delineation was completed in August 2015. The Second wetland delineation was completed in September 2019 to accommodate the proposed construction limits in their entirety. The wetland delineations identified two wetland areas (0.49 acres) and one unnamed stream channel within the project area (Figure 2). The two wetland areas (Wetland 1, wetland 2) are incidental wetlands located within the ditch of the trail. Both wetlands contained of three communities; shallow marsh, shrub -carr, and wet meadow. The shallow marsh segment of the wetland is located on the northern end of the proposed access route. As the wetland extends southwest, the slopes gradually increase causing the plant community to change from a shallow marsh to shrub - carr and wet meadow. Using the Cowardin classification method the wetland areas were classified as palustrine emergent wetlands that are partially seasonally flooded and temporarily flooded and ditched (PEMAd/PEMCd). The unnamed stream was originally delineated as part of the 2015 wetland delineation report. The stream channel was classified as a type 1 (RUBA) seasonally flooded sparsely vegetated stream channel. Work conducted in Aquatic Resources The proposed repairs will require work to be conducted within the two delineated wetlands and unnamed stream. A constructed 10 -foot wide access road is required along the existing trail to provide access for construction materials and equipment. Portions of the trail corridor are too narrow and require placement of temporary fill in the existing ditches (wetlands 1 and 2) to create the required 10 -foot wide access route. Approximately 0.06 acres of temporary fill will be placed within wetlands 1 and 2 (Appendix B, Pg G-05). Once construction is completed, the fill will be removed and the ditches will be returned to as close to the pre -project existing conditions as possible. Minnesota Interagency Water Resource Application Form February 2014 Page 4 of 15 The proposed repair work requires 0.025 acres (86 cubic yards) of riprap be placed within approximately 79 linear feet of the existing stream channel. This portion of stream has been previously impacted due to installing riprap for an emergency repair in 2016. An additonal, 0.092 acres (64 cubic yards) of riprap will be placed below the ordinary high water level downstream from the emergency repair area. The placement of this riprap will impact approximately 294 linear feet of stream channel and help further protect the stream banks and prevent further bank erosion and sedimentation downstream (Appendix B, pg C-13). Schedule Tree clearing would be completed in the spring of 2020. Construction is anticipated to begin in the summer/fall of 2020 and commence by the end of 2020. Special considerations Threatened and Endangered Species A threatened and endangered species assessment was completed for the proposed project. The review identified two federally listed species and five state listed species occurring within one -mile of the project area (Appendix C). Rare natural Communities No records of rare natural communities are shown in the NHIS database within the project area. Special Fish and Wildlife Resources The project is expected to improve fish and wildlife habitat along the unnamed stream channel. The stream is an intermittent stream and does not support fish populations. Stabilization of the adjacent slope and stream bank will help improve downstream water quality by reducing the amount of sediment loading into the stream channel. The project will not block or impede potential fish passage. Cultural Resources In 2015, a review of records at the Minnesota State Historic Preservation Office (MSHPO) was requested to identify any previously recorded archaeological, historical, or architectural resources within the project area. Per the Minnesota Archaeological Inventory and Historic Structures Inventory for the project area, no archaeological sites were identified and one historic feature was identified within Section 25, T116N, R23W (Appendix D). This property will not be affected by the proposed project. In November 2019, a second record search was submitted to MSHPO for the expanded project area. No additional cultural resources were identified. Groundwater sensitivity The project will not directly impact groundwater since excavations will occur up to 10 feet below the ground surface. Sensitive Surface Waters The MDNR Pubilc Waters Inventory (PWI) did not identify any basins or watercourses within the Project area. No sensitive surface waters such as impaired waterbodies or trout waters were identified within the project area. Tree Removal It is anticipated the proposed project will require tree removal around the north and south repair area. Large trees will be avoided to the degree practical. Tree clearing will be conducted between November 1 and March 31 to limit impacts to sensitive wildlife species. All trees removed with >6" dbh will be replaced in accordance with the City of Chanhassen's permit requirements (Appendix B, R-02). Status of Other Approvals Table 1 below includes the status of other approvals required by the project. Minnesota Interagency Water Resource Application Form February 2014 Page 5 of 15 Table 1, Status of Other Regulatory Agency Submittals Unit of Government Permit or Approval Status City of Chanhassen Interim Use Permit To be Submitted in December, 2019 Wetland Delineation boundary and Approved, see attached letter type confirmation submitted 11/6/2019 City of Eden Prairie Application for Utility Right of Way To be submitted in spring 2020 permit Minnesota Interagency Water Resource Application Form February 2014 Page 6 of 15 Project Name and/or Number: PART FOUR: Aquatic Resource Impact' Summary If your proposed project involves a direct or indirect impact to an aquatic resource (wetland, lake, tributary, etc.) identify each impact in the table below. Include all anticipated impacts, including those expected to be temporary. Attach an overhead view map, aerial photo, and/or drawing showing all of the aquatic resources in the project area and the location(s) of the proposed impacts. Label each aquatic resource on the map with a reference number or letter and identify the impacts in the following table. 'If impacts are temporary; enter the duration of the impacts in days next to the "T". For example, a project with a temporary access fill that would be removed after 220 days would be entered "T (220)". 21mpacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the flowline of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 ft (300 square feet). ?This is generally only applicable if you are applying for a de minimis exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A". °Use Wetland Plants and plant Community Types of Minnesota and Wisconsin 3'd Ed. as modified in MN Rules 8420.0405 Subp. 2. sRefer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: ' The term "impact" as used in this joint application form is a generic term used for disclosure purposes to identify activities that may require approval from one or more regulatory agencies. For purposes of this form it is not meant to indicate whether or not those activities may require mitigation/replacement. Minnesota Interagency Water Resource Application Form February 2014 Page 7 of 15 Type of Impact Duration of County, Major Aquatic Existing Plant Aquatic Resource (fill, excavate, Impact Overall Size of Watershed #, ID (as noted on Resource Type drain, or Permanent (P) Size of Impact' Aquatic Community and Bank (wetland, lake, Type(s) overhead view) tributary etc.) remove or Temporary Resource a Impact Area° Service Area # vegetation) (T)2 of Impact Areas Stream 1 Tributary Fill P 77ft (0.025 N/A None Carver County (Maintenance) acres) Watershed #33 BSA #7 Stream 1 Tributary Fill (bank P 296ft (0.092 N/A None Carver County stabilization) acres) Watershed #33 BSA #7 1,2 Wetland Fill T (90) 0.06 acres N/A None Carver County Watershed #33 BSA #7 'If impacts are temporary; enter the duration of the impacts in days next to the "T". For example, a project with a temporary access fill that would be removed after 220 days would be entered "T (220)". 21mpacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the flowline of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 ft (300 square feet). ?This is generally only applicable if you are applying for a de minimis exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A". °Use Wetland Plants and plant Community Types of Minnesota and Wisconsin 3'd Ed. as modified in MN Rules 8420.0405 Subp. 2. sRefer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: ' The term "impact" as used in this joint application form is a generic term used for disclosure purposes to identify activities that may require approval from one or more regulatory agencies. For purposes of this form it is not meant to indicate whether or not those activities may require mitigation/replacement. Minnesota Interagency Water Resource Application Form February 2014 Page 7 of 15 PART FIVE: Applicant Signature ❑ Check here if you are requesting a pre -application consultation with the Corps and LGU based on the information you have provided. Regulatory entities will not initiate a formal application review if this box is checked. By signature below, I attest that the information in this application is complete and accurate. I further attest that I possess the authority to undertake the work described herein. Signature: !%irk U _ Date: 2 /13 /1 9 I hereby authorize to act on my behalf as my agent in the processing of this application and to furnish, upon request, supplemental information in support of this application. Minnesota Interagency Water Resource Application Form February 2014 Page 8 of 15 Project Name and/or Number: Attachment A Request for Delineation Review, Wetland Type Determination, or Jurisdictional Determination By submission of the enclosed wetland delineation report, I am requesting that the U.S. Army Corps of Engineers, St. Paul District (Corps) and/or the Wetland Conservation Act Local Government Unit (LGU) provide me with the following (check all that apply): ❑ Wetland Type Confirmation ❑ Delineation Concurrence. Concurrence with a delineation is a written notification from the Corps and a decision from the LGU concurring, not concurring, or commenting on the boundaries of the aquatic resources delineated on the property. Delineation concurrences are generally valid for five years unless site conditions change. Under this request alone, the Corps will not address the jurisdictional status of the aquatic resources on the property, only the boundaries of the resources within the review area (including wetlands, tributaries, lakes, etc.). ❑ Preliminary Jurisdictional Determination. A preliminary jurisdictional determination (PJD) is a non-binding written indication from the Corps that waters, including wetlands, identified on a parcel may be waters of the United States. For purposes of computation of impacts and compensatory mitigation requirements, a permit decision made on the basis of a PJD will treat all waters and wetlands in the review area as if they are jurisdictional waters of the U.S. PJDs are advisory in nature and may not be appealed. ❑ Approved Jurisdictional Determination. An approved jurisdictional determination (AJD) is an official Corps determination that jurisdictional waters of the United States are either present or absent on the property. AJDs can generally be relied upon by the affected party for five years. An AJD may be appealed through the Corps administrative appeal process. In order for the Corps and LGU to process your request, the wetland delineation must be prepared in accordance with the 1987 Corps of Engineers Wetland Delineation Manual, any approved Regional Supplements to the 1987 Manual, and the Guidelines for Submitting Wetland Delineations in Minnesota (2013). http://www.mvp.usace.army.mil/Missions/Regulatory/DelineationJDGuidance.aspx Minnesota Interagency Water Resource Application Form February 2014 Page 9 of 15 Project Name and/or Number: Attachment B Supporting Information for Applications Involving Exemptions, No Loss Determinations, and Activities Not Requiring Mitigation Complete this part if you maintain that the identified aquatic resource impacts in Part Four do not require wetland replacement/compensatory mitigation OR if you are seeking verification that the proposed water resource impacts are either exempt from replacement or are not under CWA/WCA jurisdiction. Identify the specific exemption or no -loss provision for which you believe your project or site qualifies: WCA: 8420.0105 Subp. 2. D. USACE: Nationwide Permit 13: Bank stabilization and Nationwide Permit 3: Maintenance Provide a detailed explanation of how your project or site qualifies for the above. Be specific and provide and refer to attachments and exhibits that support your contention. Applicants should refer to rules (e.g. WCA rules), guidance documents (e.g. BWSR guidance, Corps guidance letters/public notices), and permit conditions (e.g. Corps General Permit conditions) to determine the necessary information to support the application. Applicants are strongly encouraged to contact the WCA LGU and Corps Project Manager prior to submitting an application if they are unsure of what type of information to provide: WCA Under 8420.0105 Subp. 2. D WCA does not regulate impacts to incidental wetlands. The two delineated wetlands that would be temporarily impacted by the proposed project are manmade ditched wetlands. These ditches are meant to convey water away from the trail. However, due to the lack of slope, water has ponded in the trail area creating a narrow wetland within an upland area. The project will place approximately 0.06 acres of fill within the incidental wetland area. This fill will be temporary and removed upon completion of the project. The ditches will then be restored to as close to the pre -project existing conditions as possible. USACE: It is anticipated that work within Waters of the U.S. can be completed under Nationwide Permit 3 and/or Nationwide Permit 13. Maintenance Activities: The proposed project would need to repair 0.025 acres (86 cubic yards) of riprap within approximately 79 linear feet of the existing stream channel. Some riprap was originally placed in this segment of the stream channel as part of a previous emergency repair needed to stabilize the south culvert outlet. Since then the riprap has been displaced during subsequent flood and runoff events. The proposed project would salvage existing riprap and also install additional riprap to further protect the area from future erosion. Bank Stabilization Activities: Bank stabilization activities necessary for erosion control or prevention, such as vegetative stabilization, bioengineering, spills, riprap, revetment, gabion baskets, stream barbs, and bulkheads, or combination of bank stabilization techniques. In order to stabilize the bank of the unnamed stream, 0.092 acres (64 cubic yards) of riprap will be placed below the ordinary high water level. The placement of riprap will impact approximately 294 linear feet of stream channel. Minnesota Interagency Water Resource Application Form February 2014 Page 10 of 15 Project Name and/or Number: Attachment C Avoidance and Minimization Project Purpose, Need, and Requirements. Clearly state the purpose of your project and need for your project. Also include a description of any specific requirements of the project as they relate to project location, project footprint, water management, and any other applicable requirements. Attach an overhead plan sheet showing all relevant features of the project (buildings, roads, etc.), aquatic resource features (impact areas noted) and construction details (grading plans, storm water management plans, etc.), referencing these as necessary: Avoidance. Both the CWA and the WCA require that impacts to aquatic resources be avoided if practicable alternatives exist. Clearly describe all on-site measures considered to avoid impacts to aquatic resources and discuss at least two project alternatives that avoid all impacts to aquatic resources on the site. These alternatives may include alternative site plans, alternate sites, and/or not doing the project. Alternatives should be feasible and prudent (see MN Rules 8420.0520 Subp. 2 Q. Applicants are encouraged to attach drawings and plans to support their analysis: Minimization. Both the CWA and the WCA require that all unavoidable impacts to aquatic resources be minimized to the greatest extent practicable. Discuss all features of the proposed project that have been modified to minimize the impacts to water resources (see MN Rules 8420.0520 Subp. 4): Off -Site Alternatives. An off-site alternatives analysis is not required for all permit applications. If you know that your proposal will require an individual permit (standard permit or letter of permission) from the U.S. Army Corps of Engineers, you may be required to provide an off-site alternatives analysis. The alternatives analysis is not required for a complete application but must be provided during the review process in order for the Corps to complete the evaluation of your application and reach a final decision. Applicants with questions about when an off-site alternatives analysis is required should contact their Corps Project Manager. Minnesota Interagency Water Resource Application Form February 2014 Page 11 of 15 Project Name and/or Number: Attachment D Replacement/Compensatory Mitigation Complete this part if your application involves wetland replacement/compensatory mitigation not associated with the local road wetland replacement program. Applicants should consult Corps mitigation guidelines and WCA rules for requirements. Replacement/Compensatory Mitigation via Wetland Banking. Complete this section if you are proposing to use credits from an existing wetland bank (with an account number in the State wetland banking system) for all or part of your replacement/compensatory mitigation requirements. Bank Wetland Bank Service Major Credit Type Number of Credits Area # Account # County Watershed # (if applicable) Applicants should attach documentation indicating that they have contacted the wetland bank account owner and reached at least a tentative agreement to utilize the identified credits for the project. This documentation could be a signed purchase agreement, signed application for withdrawal of credits or some other correspondence indicating an agreement between the applicant and the bank owner. However, applicants are advised not to enter into a binding agreement to purchase credits until the mitigation plan is approved by the Corps and LGU. Project -Specific Replacement/Permittee Responsible Mitigation. Complete this section if you are proposing to pursue actions (restoration, creation, preservation, etc.) to generate wetland replacement/compensatory mitigation credits for this proposed project. Corps Mitigation WCA Action Eligible Compensation Acres for Credit' Technique' Credit % Credits County Requested Anticipated' Bank Major Service Watershed # Area # 'Refer to the name and subpart number in MN Rule 8420.0526. 'Refer to the technique listed in St. Paul District Policy for Wetland Compensatory Mitigation in Minnesota. 31f WCA and Corps crediting differs, then enter both numbers and distinguish which is Corps and which is WCA. Explain how each proposed action or technique will be completed (e.g. wetland hydrology will be restored by breaking the tile......) and how the proposal meets the crediting criteria associated with it. Applicants should refer to the Corps mitigation polity language, WCA rule language, and all associated Corps and WCA guidance related to the action or technique: Attach a site location map, soils map, recent aerial photograph, and any other maps to show the location and other relevant features of each wetland replacement/mitigation site. Discuss in detail existing vegetation, existing landscape features, land use (on and surrounding the site), existing soils, drainage systems (if present), and water sources and movement. Include a topographic map showing key features related to hydrology and water flow (inlets, outlets, ditches, pumps, etc.): Minnesota Interagency Water Resource Application Form February 2014 Page 12 of 15 Project Name and/or Number: Attach a map of the existing aquatic resources, associated delineation report, and any documentation of regulatory review or approval. Discuss as necessary: For actions involving construction activities, attach construction plans and specifications with all relevant details. Discuss and provide documentation of a hydrologic and hydraulic analysis of the site to define existing conditions, predict project outcomes, identify specific project performance standards and avoid adverse offsite impacts. Plans and specifications should be prepared by a licensed engineer following standard engineering practices. Discuss anticipated construction sequence and timing: For projects involving vegetation restoration, provide a vegetation establishment plan that includes information on site preparation, seed mixes and plant materials, seeding/planting plan (attach seeding/planting zone map), planting/seeding methods, vegetation maintenance, and an anticipated schedule of activities: For projects involving construction or vegetation restoration, identify and discuss goals and specific outcomes that can be determined for credit allocation. Provide a proposed credit allocation table tied to outcomes: Provide a five-year monitoring plan to address project outcomes and credit allocation: Discuss and provide evidence of ownership or rights to conduct wetland replacement/mitigation on each site: Quantify all proposed wetland credits and compare to wetland impacts to identify a proposed wetland replacement ratio. Discuss how this replacement ratio is consistent with Corps and WCA requirements: By signature below, the applicant attests to the following (only required if application involves project-specific/permittee responsible replacement): • All proposed replacement wetlands were not: • Previously restored or created under a prior approved replacement plan or permit • Drained or filled under an exemption during the previous 10 years • Restored with financial assistance from public conservation programs • Restored using private funds, other than landowner funds, unless the funds are paid back with interest to the individual or organization that funded the restoration and the individual or organization notifies the local government unit in writing that the restored wetland may be considered for replacement. • The wetland will be replaced before or concurrent with the actual draining or filling of a wetland. • An irrevocable bank letter of credit, performance bond, or other acceptable security will be provided to guarantee successful completion of the wetland replacement. • Within 30 days of either receiving approval of this application or beginning work on the project, I will record the Declaration of Restrictions and Covenants on the deed for the property on which the replacement wetland(s) will be located and submit proof of such recording to the LGU and the Corps. Applicant or Representative: Signature: Minnesota Interagency Water Resource Application Form February 2014 Title: Date: Page 13 of 15 Project Name and/or Number: Attachment E Local Road Replacement Program Qualification Complete this part if you are a local road authority (county highway department, city transportation department, etc.) seeking verification that your project (or a portion of your project) qualifies for the MN Local Government Road Wetland Replacement Program (LGRWRP). If portions of your project are not eligible for the LGRWRP, then Attachment D should be completed and attached to your application. Discuss how your project is a repair, rehabilitation, reconstruction, or replacement of a currently serviceable road to meet state/federal design or safety standards/requirements. Applicants should identify the specific road deficiencies and how the project will rectify them. Attach supporting documents and information as applicable: Provide a map, plan, and/or aerial photograph accurately depicting wetland boundaries within the project area. Attach associated delineation/determination report or otherwise explain the method(s) used to identify and delineate wetlands. Also attach and discuss any type of review or approval of wetland boundaries or other aspects of the project by a member or members of the local Technical Evaluation Panel (TEP) or Corps of Engineers: In the table below, identify only the wetland impacts from Part 4 that the road authority has determined should qualify for the LGRWRP. Wetland Impact ID Type of Impact Size of Impact County, Major Watershed tf, as noted on Existing Plant Community ( (fill, excavate, (square feet or and Bank Service Area N of overhead view) drain) acres to 0.01) Type(s)inlmpattArea2 Impact2 'Use Wetland Plants and Plant Community Types of Minnesota and Wisconsin V Ed. as modified in MN Rules 8420.0405 Subp. 2. 211efer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. Discuss the feasibility of providing onsite compensatory mitigation/replacement for important site-specific wetland functions: Please note that under the MN Wetland Conservation Act, projects with less than 10,000 square feet of wetland impact are allowed to commence prior to submission of this notification so long as the notification is submitted within 30 days of the impact. The Clean Water Act has no such provision and requires that permits be obtained prior to any regulated discharges into water of the United States. To avoid potential unauthorized activities, road authorities must, at a minimum, provide a complete application to the Corps and receive a permit prior to commencing work. By signature below, the road authority attests that they have followed the process in MN Rules 8420.0544 and have determined that the wetland impacts identified in Part 4 are eligible for the MN Local Government Road Wetland Replacement Program. Road Authority Representative: Signature: Minnesota Interagency Water Resource Application Form February 2014 Title: Date: Page 14 of 15 Technical Evaluation Panel Concurrence: Project Name and/or Number: TEP member: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: Date TEP member: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: _ Date: TEP member: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: Date: TEP member: Representing: Concur with road authority's determination of qualification for the local road wetland replacement program? ❑ Yes ❑ No Signature: Date: Upon approval and signature by the TEP, application must be sent to: Wetland Bank Administration Minnesota Board of Water & Soil Resources 520 Lafayette Road North Saint Paul, MN 55155 Minnesota Interagency Water Resource Application Form February 2014 Page 15 of 15 Figures - - % 4 c a� EastjoodCt X L •, / od Ter LL .-IL 6 3 � j S % 3 3 m _V i c �Q c ® y il=E.P'o`eV 5 ' Q" c� now m �- Far¢`�¢d • _ .; .. �, .. }rte• - Y_...• .•�^pathhnde\D� \ook�\ r .� Y I �. 1`� •. T � ae 'I• 40L� S iY • ' / - r 0kota La - 0 /' WIJ.JCSLJ � ��"io* i r � • Y�M,yV�Y V:AN Minnesota Bluff Rivers LRT Regional Trail N SITE LOCATION - BluffsMinnesota River Construction Limits 0 700 Re 1 • .. - .. a BARR —'—"t County BoundaEmomME::= Chanhassen, Minnesota -`, t___tY ry Feet QPublic Land Survey Section ImagerySource; NearMaO. Mri72079 F- *.'Y.,� " i ® Wetland Sample Location Wetland Classifications WETLAND DELINEATION KN OConstruction Limits W Type 3 OMinnesota 110- Approximate Stream Channel Type 6 0 too .. .. K Delineated Wetlands Feet 1=gwy Soume,; NearMap, Apri72079 FIGURE 2 ® Wetland Sample Location OConstruction Limits Approximate Stream Channel K Delineated Wetlands F r F s Wetland Classifications O Type 6 0 100 Feet Imagery Source, NearMap, April 2019 t V sr. i AR ca .Y• i O Construction Limits Wetland Classifications N , kTlC)r% MAP - — 2015 Delineated Wetlands W Type 1 OMinnesota River ?., .. BARR Approximate Stream Channel Type 6 0 100 ..Tial Trail .- Minnesotail Delineated Wetlands feet Imogery Source, NmrMop, April 2019 FIGURE 2 Construction Limits 6h�,. Delineated Wetlands O 2015 Delineated Wetlands MWetland Classifications —11 Approximate Stream Channel W Type 1 0 100 Culvert Pipe Feet Imagery Source; NearMap, April 2079 IN 4-4 Construction Limits AAAA 0 & M 2015 Delineated Wetlands 0 100 BARR --- 0- Approximate Stream Channel Efup;T Chanhassen, Minnesota Culvert Pipe Feet I Imagery Source, NearMap, April 2079 FIGURE 2 Appod— APPENDIX A MN Wetland Conservation Act Notice of Decision Project Name and/or Number: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization PART ONE: Applicant Information If applicant is an entity (company, government entity, partnership, etc.), an authorized contact person must be identified. If the applicant is using an agent (consultant, lawyer, or other third party) and has authorized them to act on their behalf, the agent's contact information must also be provided. Applicant/Landowner Name: Jessica Galatz, Hennepin County Regional Railroad Authority Mailing Address: 701 Fourth Avenue South, Suite 400 Phone: 612-348-2691 E-mail Address: jessica.galatz@hennepin.us Authorized Contact (do not complete if same as above): Mailing Address: Phone: E-mail Address: Agent Name: Joel Swenson, Barr Engineering Mailing Address: 4700 West 77t'St, Minneapolis, MN 55435 Phone: 952-832-2799 E-mail Address: jswenson@barr.com PART TWO: Site Location Information County: Carver Parcel ID and/or Address: Legal Description (Section, Township, Range): Lat/Long (decimal degrees): -93.527 44.819 City/Township: Chanhassen 536, T116N, R23W Attach a map showing the location of the site in relation to local streets, roads, highways. Approximate size of site (acres) or if a linear project, length (feet): 8.13 acres If you know that your proposal will require an individual Permit from the U.S. Army Corps of Engineers, you must provide the names and addresses of all property owners adjacent to the project site. This information may be provided by attaching a list to your application or by using block 25 of the Application for Department of the Army permit which can be obtained at: htto://www.mvp.usace.army.mil/Portals/57/docs/regulatory/RegulatoryDocs/engform 4345 2012oct.odf PART THREE: General Project/Site Information If this application is related to a delineation approval, exemption determination, jurisdictional determination, or other correspondence submitted prior to this application then describe that here and provide the Corps of Engineers project number. Describe the project that is being proposed, the project purpose and need, and schedule for implementation and completion. The project description must fully describe the nature and scope of the proposed activity including a description of all project elements that effect aquatic resources (wetland, lake, tributary, etc.) and must also include plans and cross section or profile drawings showing the location, character, and dimensions of all proposed activities and aquatic resource impacts. Minnesota Interagency Water Resource Application Form February 2014 Page 3 of 11 Project Name and/or Number: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization PART FOUR: Aquatic Resource Impact' Summary If your proposed project involves a direct or indirect impact to an aquatic resource (wetland, lake, tributary, etc.) identify each impact in the table below. Include all anticipated impacts, including those expected to be temporary. Attach an overhead view map, aerial photo, and/or drawing showing all of the aquatic resources in the project area and the location(s) of the proposed impacts. Label each aquatic resource on the map with a reference number or letter and identify the impacts in the following table. Aquatic Aquatic Resource Resource Type ID (as noted on (wetland, lake, overhead view) tributary etc.) Type of Impact (fill, excavate, drain, or remove vegetation) Duration of Impact Permanent (P) Size of Impact' or Temporary (T) Overall Size of Aquatic Resource' Existing Plant Community Type(s) in Impact Area' County, Major Watershed It, and Bank Service Area p of Impact Area 'If impacts are temporary, enter the duration of the impacts in days next to the "7". For example, a project with a temporary access fill that would be removed after 220 days would be entered "T (220)". 'Impacts less than 0.01 acre should be reported in square feet. Impacts 0.01 acre or greater should be reported as acres and rounded to the nearest 0.01 acre. Tributary impacts must be reported in linear feet of impact and an area of impact by indicating first the linear feet of impact along the flowlme of the stream followed by the area impact in parentheses). For example, a project that impacts 50 feet of a stream that is 6 feet wide would be reported as 50 It (300 square feet). 'This is generally only applicable if you are applying for a de minimis exemption under MN Rules 8420.0420 Subp. 8, otherwise enter "N/A`. 'Use Welland Plants and Plant Community Types of Minnesota and Wisconsin 3'6 Ed. as modified in MN Rules 8420.0405 Subp. 2. 'Refer to Major Watershed and Bank Service Area maps in MN Rules 8420.0522 Subp. 7. If any of the above identified impacts have already occurred, identify which impacts they are and the circumstances associated with each: PART FIVE: Applicant Signature ® Check here if you are requesting a pre -application consultation with the Corps and LGU based on the information you have provided. Regulatory entities will not initiate a formal application review if this box is checked. By signature below, I attest that the information in this application is complete and accurate. I further attest that I possess the authority to undertake the work described herein. Signature: ( Date: W (P / 15 I hereby authorize to act on my behalf as my agent in the processing of this application and to furnish, upon request, ,brZ, 5WCI\SOY1 r �E supplemental information in support of this application. $Q(( V-^Jt1)24Iin ' The term "impact" as used in this joint application form is a generic term used for disclosure purposes to identify activities that may require approval from one or more regulatory agencies. For purposes of this form it is not meant to indicate whether or not those activities may require mitigationfreplacement. Minnesota Interagency Water Resource Application Form February 2014 Page 4 of 11 Project Name and/or Number: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization Attachment A Request for Delineation Review, Wetland Type Determination, or Jurisdictional Determination By submission of the enclosed wetland delineation report, I am requesting that the U.S. Army Corps of Engineers, St. Paul District (Corps) and/or the Wetland Conservation Act Local Government Unit (LGU) provide me with the following (check all that apply): ® Wetland Type Confirmation ® Delineation Concurrence. Concurrence with a delineation is a written notification from the Corps and a decision from the LGU concurring, not concurring, or commenting on the boundaries of the aquatic resources delineated on the property. Delineation concurrences are generally valid for five years unless site conditions change. Under this iequest alone, the Corps will not address the jurisdictional status of the aquatic resources on the property, only the boundaries of the resources within the review area (including wetlands, tributaries, lakes, etc.). ® Preliminary Jurisdictional Determination. A preliminary jurisdictional determination (PID) is a non-binding written indication from the Corps that waters, including wetlands, identified on a parcel may be waters of the United States. For purposes of computation of impacts and compensatory mitigation requirements, a permit decision made on the basis of a PJD will treat all waters and wetlands in the review area as if they are jurisdictional waters of the U.S. PJDs are advisory in nature and may not be appealed. ❑ Approved Jurisdictional Determination. An approved jurisdictional determination (AJD) is an official Corps determination that jurisdictional waters of the United States are either present or absent on the property. AJDs can generally be relied upon by the affected party for five years. An AJD may be appealed through the Corps administrative appeal process. In order for the Corps and LGU to process your request, the wetland delineation must be prepared in accordance with the 1987 Corps of Engineers Wetland Delineation Manual, any approved Regional Supplements to the 1987 Manual, and the Guidelines for Submitting Wetland Delineations in Minnesota (2013). htto://www.mvp.usace.army.mi I/Missions/Regulatory/DelineationJ DGu idance.asox Minnesota Interagency Water Resource Application Form February 2014 Page 5 of 11 Minnesota Wetland Conservation Act Notice of Decision Local Government unit "U) Address City of Chanhassen 7700 Market Boulevard, Po Boz 147 Chanhassen, MN 55317 1. PROJECT INFORMATION Applicant Name Project Name Date of Application Hennepin County Regional Raft MN River Bluffs LRT Regional Application Number Authority Trail Slope Stabilization 11/10/2015 2015-10 Attach site locator map. Cype of Decision: ® Wetland Boundary or Type ❑ No -Loss ❑ Exemption ❑ Sequencing ❑ Replacement Plan ❑ Banking Plan Technical Evaluation Panel Findings and Recommendation (if any): ❑ Approve ❑ Approve with conditions ❑ Deny Summary (or attach): 2. LOCAL GOVERNMENT UNIT DECISION Date of Decision: December 15, 2015 ❑ Approved ® Approved with conditions (include below) ❑ Denied BWSR Forms 11-25-09 Page 1 of 3 LGU Findings and Conclusions (attach additional sheets as necessary): Barr Engineering, on behalf of the Hennepin County Regional Rail Authority (HCRRA), has performed a wetland determination and boundary delineation for the site located along the LRT Regional Trail, between Pioneer Trail and TH 101 in Chanhassen, MN, and within the SE'/, of Section 25, TI 16N, R23W. This delineation identified two wetland basins on-site. Wetland Area 1 is located at the NE portion of the site, upslope from a stream channel. This has been identified as a Type 2 (PEMB) wet meadow seepage wetland. Wetland Area 2 is an intermittent stream channel located at the southern portion of the site. This wetland was identified as a Type 1, seasonally flooded stream in the delineation report, however this basin fails to meet Ore hydrophytic vegetation criterion and therefore is not considered jurisdictional under the MN Wdland Conservation Act. None of the wetland areas identified in the delineation are identified on the National Wetland Inventory Map, or the DNR Public Waters Map. Based upon our review, the City of Chanhassen, as the LGU responsible for administration of Minnesota R. 8420, concurs with the delineated boundary and types as identified in the wetland determination and delineation report prepared by Barr Engineering, dated August 2015, and the wetland boundaries shown within the report. The Application for Wetland Boundary and Type was noticed on November 101, 2015. No additional comments were received from the Technical Evaluation Panel members or from the public. This concludes our review. Upon the provision of the electronic representation of the delineated boundaries (*.shp or t.d tthis delineation will be considered approved. For Replacement Plans using credits from the State Wetland Bank: f Bank Account # Bank Service Area County Credits Approved for If Withdrawal (sq. ft. or nearest .01 acre) Replacement Plan Approval Conditions. In addition to any conditions specified by the LGU, the approval of a Weiland Replacement Plan is conditional upon the following: ❑ Financial Assurance: For project -specific replacement that is not in -advance, a financial assurance specified by the LGU must be submitted to the LGU in accordance with MN Rule 8420.0522, Subp. 9 (List amount and type in LGU Findings). ❑ Deed Recording: For project -specific replacement, evidence must be provided to the LGU that the BWSR "Declaration of Restrictions and Covenants" and "Consent to Replacement Wetland" forms have been filed with the county recorder's office in which the replacement wetland is located. ❑ Credit Withdrawal: For replacement consisting of wetland bank credits, confirmation that BW SR has withdrawn the credits from the state wetland bank as specified in the approved replacement plan. Wetlands may not be impacted until all applicable conditions have been met! BWSR Forms 11-25-09 Page 2 of 3 LGU Authorized Signature: Signing and mailing of this completed form to the appropriate recipients in accordance with 8420.0255, Subp. 5 provides notice that a decision was made by the LGU under the Wetland Conservation Act as specified above. If additional details on the decision exist, they have been provided to the landowner and are available from the LGU upon request. Name Title Terrance Jeffery, WDC Water Resources Coordinator Signature Date Phone Number and E-mail 952.227.1168 C" effe ci.chanhassen.mn.us Addition—d-agpngYals ar permits from local, state, and federal agencies may be required. Check with all appropriate authorities before commencing work in or near wetlands. Applicants proceed at their own risk if work authorized by this decision is started before the time period for appeal (30 days) has expired. If this decision is reversed or revised under appeal, the applicant may be responsible for restoring or replacing all wetland impacts. This decision is valid for three years from the date of decision unless a longer period is advised by the TEP and specified in this notice of decision. 3. APPEAL OF THIS DECISION Pursuant to MN Rule 8420.0905, any appeal of this decision can only be commenced by mailing a petition for appeal, including applicable fee, within thirty (30) calendar days of the date of the mailing of this Notice to the following as indicated: Check one: Z Appeal of an LGU staff decision. Send ❑ Appeal of LGU governing body decision. petition and $50_00 fee (if applicable) to: Send petition and $500 filing fee to: Chanhassen City Council Executive Director do Todd Gerhardt, City Manager Minnesota Board of Water and Soil Resources 7700 Market Blvd, PO Boz 147 520 Lafayette Road North Chanahssen, MN 55317 St. Paul, MN 55155 4. LIST OF ADDRESSEES ® SWCD TEP member: Chip Hentges, Aaron Finke SSI BWSR TEP member: Ben Meyer ❑ LGU TEP member (if different than LGU Contact): ® DNR TEP member (notice only): ® DNR Regional Office (if different than DNR TEP member): ® WD or WMO (if applicable): Linda Loomis, Lower MN River Watershed District ® Applicant (notice only) and Landowner (if different): Jessica Galatz, HCRRA ® Members of the public who requested notice (notice only): Joel Swenson, Barr Engineering ® Corps of Engineers Project Manager (notice only) Melissa Jenny ❑ BWSR Wetland Bank Coordinator (wetland bank plan applications only): BWSR Forms 11-25-09 Page 3 of 3 5. MAILING INFORMATION >For a list of B WSR TEP representatives, see: www.bwsr.state.mn.us/aboutbwsr/workareas(WCA areas udf ➢For a list of DNR TEP representatives, see: www.bwsr.state.mn.us/wetlands/wca/DNR TEP contacts.odf NW Reid : NE Reaion: I Central Reeion Southern Resion Reg. Env. Assess. EcoL Reg. Env. Assess. Ecol. Reg. Env. Assess. Reg. Env. Assess. Ecol. Div. Ecol. Resources Div. Ecol. Resources Ecol. Div. Ecol. Resources 2115 Bircbmont Beach Rd 1201 E. Hwy. 2 Div, Eool. Resources 261 Hwy. 15 South NE Grand Rapids, MN 1200 Wamer Road New Ulm, MN 56073 Bemidji, MN 56601 55744 St. Paul. MN 55106 For a man of DNR Administmtive Repinns_ sec: httn-//filet.dnr.state.mn.us/ahoutdnr/dnr maions_ndf ➢For a list of Corps of Project Managers, see: www mvp usace army mil/reug latory/default asp?paeeid=687 or send to: ➢Dept. of the Army, Corps of Engineers, St Paul District ATTN: CO -11 190 Fifth Street East St. Paul, MN 55101-1638 ➢For Wetland Bank Plan applications, also send a copy of the application to: Minnesota Board of Water and Soil Resources Wetland Bank Coordinator 520 Lafayette Road North St. Paul, MN 55155 6. ATTACEAMNTS In addition to the application, list any other attachments: ® Joint Water Resources Application for Approval of Wetland Type and Boundary, dated November 6's, 2015 ® Wetland Delineation Retort, dated August 2015. BWSR Forms 11-25-09 Page 4 of 3 MBOARD OF WATER AND SOIL RESOURCES Minnesota Wetland Conservation Act Notice of Decision Local Government Unit: City of Chanhassen County: Carver Applicant Name: Jessica Galatz, Hennepin County Regional Rail Authority Applicant Representative: Sarah Johnson, Barr Engineering Project Name: HCRRA Minnesota River Bluffs LRT Regional Trail Slope Stabilization Delineation Update LGU Project No. (if any): Date Complete Application Received by LGU: 10/30/2019 Date of LGU Decision: 12/5/2019 Date this Notice was Sent: 12/9/2019 NCA Decision Type - check all that apply ®Wetland Boundary/Type ❑Sequencing ❑Replacement Plan ❑Bank Plan (not credit purchase) ❑No -Loss (8420.0415) ❑Exemption (8420.0420) Part:❑A❑B ❑COD❑E OF ❑G ❑H Subpart: ❑2❑3❑4❑5 ❑607 0809 teplacement Plan Impacts (replacement plan decisions only) Total WCA Wetland Impact Area: Wetland Replacement Type: ❑ Project Specific Credits: ❑ Bank Credits: Bank Account Number(s): Technical Evaluation Panel Findings and Recommendations (attach if any) ❑ Approve ❑ Approve w/Conditions ❑ Deny ® No TEP Recommendation LGU Decision ❑ Approved with Conditions (specify below)' ® Approved' List Conditions: Decision -Maker for this Application: M Staff ❑ Governing Board/Council ❑ Other: Decision is valid for: ® 5 years (default) ❑ Other (specify): ❑ Denied , ,_,, ..yy, wu, o ..u, w.m unu, urr,n wnp. n.o ...c w....... ww u/ mry.r4uucu wc.mnu uune uru.u. ru. p.uiru specific replacement o financial assurance per MN Rule 8410.0522, Subp. 9 and evidence that all required forms have been recorded on the title of the property on which the replacement wetland is located must be provided to the LGU far the approval to be valid. LGU Findings — Attach document(s) and/or insert narrative providing the basis for the LGU decision' ® Attachment(s) (specify): Wetland Delineation Figure ElSummary: The LGU reviewed the site in the field on October 29, 2019. No comments were received from the TEP and the LGU concurred with the boundary and type observed in the field. I Findings must consider onv TEV recommendations Attached Project Documents BWSR NOD Form— November 5, 2019 1 ® Site Location Map ❑ Project Plan(s)/Descriptions/Reports (specify): Appeals of LGU Decisions If you wish to appeal this decision, you must provide a written request within 30 calendar days of the date you received the notice. All appeals must be submitted to the Board of Water and Soil Resources Executive Director along with a check payable to BWSR for $500 unless the LGU has adopted a local appeal process as identified below. The check must be sent by mail and the written request to appeal can be submitted by mail or e-mail. The appeal should include a copy of this notice, name and contact information of appellant(s) and their representatives (if applicable), a statement clarifying the intent to appeal and supporting information as to why the decision is in error. Send to: Appeals & Regulatory Compliance Coordinator Minnesota Board of Water & Soils Resources 520 Lafayette Road North St. Paul, MN 55155 travis.germundson(@state.mn.us Does the LGU have a local appeal process applicable to this decision? ® Yes' ❑ No 'If yes, all appeals must first be considered via the local appeals process. Local Appeals Submittal Requirements (LGU must describe how to appeal, submittal requirements, fees, etc. as applicable) Send petition and $50.00 to 7700 Market Boulevard, PO Box 147, Chanhassen, MN 55317 Notice Distribution (include name) Required on all notices: M SWCDTEP Member: Aaron Finke M BWSR TEP Member: Ben Carlson ® LGU TEP Member (if different than LGU contact): Todd Gerhardt, City of Chanhassen, Andi Moffatt, WSB ® DNR Representative: Leslie Parris, Jennie Skancke ® Watershed District or Watershed Mgmt. Org.: Linda Loomis, Lower MN River Watershed District ® Applicant (notice only): Jessica Galatz, Hennepin County Regional Rail Authority ® Agent/Consultant (notice only): Sarah Johnson, Barr Engineering; Tyler Conley, Barr Engineering Optional or As Applicable: ® Corps of Engineers: Mariah Weitzenkamp ❑ BWSR Wetland Mitigation Coordinator (required for bank plan applications only): ® Members of the Public (notice only): Leslie Stovring, Eden Prairie LGU; Erik Henricksen, City of Chanhassen; Terry Jeffery, RPBCWD ❑ Other: Signature:Datta ,, T s notice and accompanying aplikatloe mrterids may be sem ekctrookalty or by maA. The ILGU may opt to seed a summary o1 the application to members of the pabac upon request per 2MAZ55, Subp. 3. BWSR NOD Form — November 5, 2019 Ct lakota La East,00d Ct Minnesota Bluff Rivers LRT Regional Trail OConstruction Limits ,- County Boundary Q Public Land Survey Section 9 Co dor I a 0 0 700 Feet Imagery Source, NearMap, April 2019 W _ / 1 r F ' Farmsre� C" - t Cr- U1N•J Patnfindet D� r .. V d� J � • A 9 Co dor I a 0 0 700 Feet Imagery Source, NearMap, April 2019 ® Wetland Sample Location Wetland Classifications D DELINEATIONN WETLAN - O Construction Limits C3 Type 3 O . a BARR � Approximate Stream Channel Type 6 111111111011111mr—= Chanhassen, Minnesota 0 100 egis iX.. g K Delineated Wetlands Feet Imagery Source; NeorMap, April 2019 FIGURE 6 Awt ' Y A R s, A^ _'-• G It fi �i f "Ita _ t a I' +� Wetland Classifications N Type 6 . . ® Wetland Sample Location OConstruction Limits Approximate Stream Channel Delineated Wetlands 0 100 Feet Imogery Source; NearMap, April 2019 ` f Y b 4# 'af 6 ►R@ it,", u f \ • i -:41w } y .PIw- ti O Construction Limits Wetland Classifications WETLAND DEUNEATION MAPN 2015 Delineated Wetlands C3Type 1 OMinnesota Approximate Stream Channel Type 6 0 100'' K Delineated Wetlands Feet Imagery Saume, NearMap, April 2019 F9 A, 0- O Construction Limits 2015 Delineated Wetlands BARB Approximate Stream Channel ---P- Culvert Pipe —41 0 0 100 Feet Imagery Source, NearMop April 2019 MW MIJ!"I APPENDIX B Plan Set Refer to Attachment 3 for the Design Plan Set Threatened Endangered APPENDIX Memorandum resourceful. naturally. BARB engineering and environmental consultants Technical Memorandum To: File From: Tyler Conley Subject: Threatened and Endangered Species Review Date: 12/05/2019 Project: Chanhassen Slope Failure Project Barr Engineering Co. (Barr) has completed a threatened and endangered species desktop review for the Hennepin County Regional Railroad Authority (HCRRRA) Slope Failure Project. The project area consists of 9.58 acres centered on the Minnesota River Bluffs LRT Regional Trail. Located within the City of Chanhassen and City of Eden Prairie Minnesota, Section 23, T1 16W, R23N. Federally listed species are protected by the federal government under the Endangered Species Act and require consideration for projects involving federal permits. State listed species are protected under Minnesota's Endangered and Threatened Species Law and must be considered for state level permitting requirements. The project area was reviewed for federal and state listed species and their associated habitats that may be found in the project area. This desktop review was completed in November 2019 using a combination of data available from the United States Fish and Wildlife Service (USFWS) and the Minnesota Department of Natural Resources (MNDNR). 1.1 Federally listed species The USFWS Information, Planning, and Conservation System (IPaQ identified two federally listed species as occurring within the project area, the northern long-eared bat (Myotic septentrionalis federally threatened) and the Rusty patched bumble bee (Bombus a/finis; federally endangered). No designated critical habitat for any federally listed species is located within the project area. The northern long-eared bat inhabits caves, mines, and forests. According to the MNDNR, the nearest hibemacula is over 6.7 miles southwest of the project area, and no maternity roost trees have been identified within the vicinity of the project area. To minimize the potential impact on the species tree clearing will be conducted between November 1 and March 31. Therefore, project clearing activites completed prior to April 1, 2020 are anticipated to have no effect on northern long-eared bat. Rusty patched bumble bees are typically found in grasslands with flowering plants from April through October. They are typically nesting in underground and abandoned rodent cavities or clumps of grasses above ground as nesting sites. During the winter months, queens typically overwinter in underground cavities in upland forests dominated by maple -basswood or oak -hickory trees. The project area is located within USFWS designated High Potentail Zone for the rusty patched bumble bee. The USFWS Section 7 guidance recommends USFWS consultation for projects located within the High Potential zone. Barr Engineering Co. 4300 MarketPointe Drive, Suite 200, Minneapolis, MN 55435 952.832.2600 www.barr.com To: File From: Tyler Conley Subject: Threatened and Endangered Species Review Date: 12/05/2019 1.2 State -listed species Barr Engineering Co. (Barr) has a license agreement (LA -898) with the MNDNR for access to the Natural Heritage Information System (NNIS) database, which was queried in November 2019 to determine if any rare species could potentially be affected by the proposed Project. Two state -listed species have been previously recorded within the project area; American ginseng (Panax quinquefolius), and smooth rock cress (Boechera laevigata). In addition, the NHIS database identified five, state -endangered, threatened, special concern or watchlist species have been documented within one mile of the proposed project area (Table 1). Five native plant communities were also noted. Table 1 Rare Species Documented within One Mile of Proposed Project Area According to MNDNR NHIS 1: Habitat information obtained from MDNR Rare Species Guide: httpsV/www.dnr.state.mn.us/rsg/index.htmi Kitten tails is the only state listed threatened species identified within one mile of the project area. Primary habitat for the species consists of oak savanna communities on north facing slopes. No such habitat is present within the project area. The majority of the project area is densely wooded deciduous forest with a southeast facing slope. No dry prairie is present. Therefore it is unlikely for the species to be located within the project area. The remaining state listed species are listed as species of special concern. These species are monitored by the DNR but are not protected under state law. Federal Common Name Scientific Name Status State Status Habitat' Primarily found in oak savanna communities, though it occurs in dry prairies and oak woodlands. Plants show a preference for partial to open light and Kitten -tails Besseya bullii N/A Threatened upper slopes. Some populations exhibit a preference for less xeric north facing slopes in prairie habitats. Soils are most often sandy to gravelly, well -drained soil derived from alluvium or limestone. Smooth Rock Boechera laevigata N/A Special concern Found to occur on slopes in mesic Cress deciduous forests. Chondestes Typically in dry short prairie grasslands in Lark Sparrow N/A Special concern areas with sand or gravel spoils with some grammacus bare ground and scattered trees. American quinquefolius None Special concern Typically found in well-developed forest GinsengPanax soil, mesic loamy soil. Gophersnake Pituophis catenifer None Special concern Prefers well -drained, loose sandy andgravel soils. 1: Habitat information obtained from MDNR Rare Species Guide: httpsV/www.dnr.state.mn.us/rsg/index.htmi Kitten tails is the only state listed threatened species identified within one mile of the project area. Primary habitat for the species consists of oak savanna communities on north facing slopes. No such habitat is present within the project area. The majority of the project area is densely wooded deciduous forest with a southeast facing slope. No dry prairie is present. Therefore it is unlikely for the species to be located within the project area. The remaining state listed species are listed as species of special concern. These species are monitored by the DNR but are not protected under state law. APPENDIX D SHPO Historical/Architectural Resource CR -CHC -049 Memorandum resourceful. naturally. BARR engineering and environmental consultants Technical Memorandum To: Jessica Galatz From: Joel Swenson Subject: SHPO Historical/Architectural Resource CR -CHC -049 Date: 09/15/2015 Project: 23101014.00/004-100 c: Kristin Alstadt As part of finalizing Task 2 and moving into final design, Task 3, the HCRRA (Hennepin County Regional Rail Authority) and the Barr design team needed to understand the existence and extents of any wetlands or fens within HCRRA right-of-way. This would include anything that would impact the design option selected by HCRRA. A preliminary desktop review of the site was performed by Barr staff in February, 2015. A complete wetland delineation was recently performed June 17, 2015. A report summarizing the preliminary and final wetland delineation findings was submitted to the HCRRA in July. In addition to the wetland delineation, the Minnesota State Historical Preservation Office was contacted by Barr staff to perform a database search for potential historical and archaeological resources within this area of Section 25 and 36, of Township 116, Range 23 in the City of Chanhassen within Carver County. According to the SHPO database, a historic feature (CR -CHC -049) is placed south of the landslide as shown on Figure 1 (also attached). Figure 1. Historical/Architectural resource database results Barr Engineering Co. 4700 West 77th Street, Suite 200, Minneapolis, MN 55435 952.832.2600 www borrcom I rl To: Jessica Galatz From: Joel Swenson Subject: SHPO Historical/Architectural Resource CR -CHC -049 Date: 09/15/2015 The Historic feature is listed as a house (highlighted in yellow in Figure 2). History/Architecture Inventory nlorarrw¢ �oo.n. In w a. R.1.. u8G8 4l 1! m me Y,+rw.r. Mc : C. arvrtoaar�: a� y ofI .4141!C M 14 116 23 is YAi'fiT 9►.s QCS001 D.*w iM! dP1111.1IIAI tVn 1M v M Alepz Q�LMS 9i*.V 45A XYM110.1iMlI .h Ila U M Ot49u RLNWM �..M.R M ft Om 116 U M Et1R' QaEE014 Com. D.W' 615T"ao. 116 a M fit' Mffi C®e D.U' sttlpq ae.aml. 116 n M.W-NE Qa1C0Y Oma yy!!!alarm. lU D MW.IM alae C®eoJ 225F!,, wJMn: ua v M W4W O.CMG�1U Figure 2. Historical/Architectural Inventory To further investigate the potential for cultural resources within the project area or vicinity, Barr staff scheduled a visit to the SHPO office to pull the file for this Inventory Number CR -CHC -049. Upon arriving at the office, it was determined that a file had not been created for this inventory number as of the afternoon of July 10, 2015. Julie Hillenbrand (a grant process facilitator at SHPO) left a voicemail with Barr staff KNA the next morning on July 11, 2015 stating that their independent contractor who they hire to create the files has not provided them with any documentation for this inventory number. Julie and Tom Cinadr (property information/database searches at SHPO) both indicated that they had no idea when they expected to receive files for this inventory number. Alk